BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1746

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97057.1|  unnamed protein product                                266   4e-83   Coffea canephora [robusta coffee]
ref|XP_006349606.1|  PREDICTED: adenylyl cyclase-associated prote...    263   6e-82   Solanum tuberosum [potatoes]
ref|XP_009619104.1|  PREDICTED: cyclase-associated protein 1-like       263   8e-82   Nicotiana tomentosiformis
ref|XP_006423253.1|  hypothetical protein CICLE_v10028340mg             263   9e-82   Citrus clementina [clementine]
ref|XP_009775243.1|  PREDICTED: cyclase-associated protein 1-like       259   2e-80   Nicotiana sylvestris
ref|XP_004248719.1|  PREDICTED: cyclase-associated protein 1            259   2e-80   Solanum lycopersicum
ref|XP_002509481.1|  adenylyl cyclase-associated protein, putative      258   4e-80   Ricinus communis
ref|XP_011088387.1|  PREDICTED: cyclase-associated protein 1            258   7e-80   Sesamum indicum [beniseed]
ref|XP_006412221.1|  hypothetical protein EUTSA_v10025082mg             255   8e-79   Eutrema salsugineum [saltwater cress]
ref|XP_012069926.1|  PREDICTED: cyclase-associated protein 1            254   2e-78   Jatropha curcas
ref|XP_009112095.1|  PREDICTED: cyclase-associated protein 1            251   3e-77   Brassica rapa
ref|XP_004507425.1|  PREDICTED: adenylyl cyclase-associated prote...    250   7e-77   Cicer arietinum [garbanzo]
emb|CDX75438.1|  BnaA01g02640D                                          248   3e-76   
ref|XP_010530841.1|  PREDICTED: cyclase-associated protein 1            248   3e-76   Tarenaya hassleriana [spider flower]
gb|ADZ16117.1|  adenylyl cyclase associated protein                     247   4e-76   Gossypium hirsutum [American cotton]
ref|XP_008375926.1|  PREDICTED: cyclase-associated protein 1            248   4e-76   Malus domestica [apple tree]
gb|AEN70782.1|  adenylyl cyclase-associated protein                     247   4e-76   Gossypium barbadense var. brasiliense
gb|ADZ16115.1|  adenylyl cyclase associated protein                     247   4e-76   Gossypium raimondii
gb|KJB79111.1|  hypothetical protein B456_013G037400                    247   4e-76   Gossypium raimondii
gb|AEN70776.1|  adenylyl cyclase-associated protein                     247   5e-76   Gossypium mustelinum
gb|KJB79112.1|  hypothetical protein B456_013G037400                    247   5e-76   Gossypium raimondii
gb|KJB79115.1|  hypothetical protein B456_013G037400                    247   6e-76   Gossypium raimondii
ref|XP_003631649.1|  PREDICTED: cyclase-associated protein 1            247   9e-76   Vitis vinifera
gb|KJB79114.1|  hypothetical protein B456_013G037400                    247   9e-76   Gossypium raimondii
ref|XP_010447070.1|  PREDICTED: cyclase-associated protein 1 isof...    247   1e-75   Camelina sativa [gold-of-pleasure]
gb|AEN70789.1|  adenylyl cyclase-associated protein                     247   1e-75   Gossypium davidsonii
gb|AEN70772.1|  adenylyl cyclase-associated protein                     246   2e-75   Gossypium laxum
emb|CAN61863.1|  hypothetical protein VITISV_043448                     246   2e-75   Vitis vinifera
ref|NP_195175.1|  cyclase associated protein 1                          246   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|ADZ16113.1|  adenylyl cyclase associated protein                     246   2e-75   Gossypium barbadense [Egyptian cotton]
gb|AEN70792.1|  adenylyl cyclase-associated protein                     246   2e-75   Gossypium gossypioides
gb|AEN70771.1|  adenylyl cyclase-associated protein                     246   2e-75   Gossypium thurberi
gb|AEN70786.1|  adenylyl cyclase-associated protein                     245   2e-75   Gossypium hirsutum subsp. latifolium
gb|ABU97498.1|  adenylyl cyclase-associated protein                     246   2e-75   Gossypium arboreum [tree cotton]
emb|CDX69065.1|  BnaC01g03880D                                          246   3e-75   
ref|XP_011048631.1|  PREDICTED: cyclase-associated protein 1-like       246   3e-75   Populus euphratica
gb|ADZ16114.1|  adenylyl cyclase associated protein                     246   3e-75   Gossypium herbaceum subsp. africanum
gb|ADZ16112.1|  adenylyl cyclase associated protein                     246   3e-75   Gossypium barbadense [Egyptian cotton]
gb|AEN70781.1|  adenylyl cyclase-associated protein                     245   4e-75   Gossypium barbadense var. brasiliense
gb|AEN70773.1|  adenylyl cyclase-associated protein                     245   4e-75   Gossypium schwendimanii
ref|XP_002867116.1|  ATCAP1                                             245   5e-75   
ref|XP_009374180.1|  PREDICTED: cyclase-associated protein 1            245   5e-75   Pyrus x bretschneideri [bai li]
dbj|BAA36585.1|  adenylyl cyclase associated protein                    245   6e-75   Gossypium hirsutum [American cotton]
gb|AEN70791.1|  adenylyl cyclase-associated protein                     245   6e-75   Gossypium aridum
ref|XP_007042208.1|  Cyclase associated protein 1, 1,CAP1               244   8e-75   
gb|AEN70794.1|  adenylyl cyclase-associated protein                     244   9e-75   Gossypium trilobum
gb|EYU37793.1|  hypothetical protein MIMGU_mgv1a005340mg                244   1e-74   Erythranthe guttata [common monkey flower]
ref|XP_002306100.1|  cyclase associated protein 1                       244   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_003606897.1|  Adenylyl cyclase-associated protein                244   1e-74   Medicago truncatula
ref|XP_008377316.1|  PREDICTED: cyclase-associated protein 1-like       244   2e-74   Malus domestica [apple tree]
ref|XP_009108728.1|  PREDICTED: cyclase-associated protein 1-like       244   2e-74   Brassica rapa
gb|AEN70775.1|  adenylyl cyclase-associated protein                     243   2e-74   Gossypium mustelinum
gb|AFK47086.1|  unknown                                                 243   4e-74   Lotus japonicus
gb|AEN70793.1|  adenylyl cyclase-associated protein                     243   4e-74   Gossypium lobatum
gb|ABU97500.1|  adenylyl cyclase-associated protein                     243   4e-74   Gossypium arboreum [tree cotton]
ref|XP_002313050.2|  cyclase associated protein 1                       242   6e-74   
ref|XP_006286091.1|  hypothetical protein CARUB_v10007634mg             242   7e-74   Capsella rubella
ref|XP_010254869.1|  PREDICTED: cyclase-associated protein 1-like       242   9e-74   Nelumbo nucifera [Indian lotus]
gb|KFK30061.1|  hypothetical protein AALP_AA7G211700                    242   9e-74   Arabis alpina [alpine rockcress]
ref|XP_004299093.1|  PREDICTED: cyclase-associated protein 1            241   1e-73   Fragaria vesca subsp. vesca
ref|XP_011037533.1|  PREDICTED: cyclase-associated protein 1-like       241   2e-73   Populus euphratica
ref|XP_010447072.1|  PREDICTED: cyclase-associated protein 1 isof...    240   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_011092784.1|  PREDICTED: cyclase-associated protein 1-like       239   7e-73   Sesamum indicum [beniseed]
gb|EYU42620.1|  hypothetical protein MIMGU_mgv1a021022mg                239   7e-73   Erythranthe guttata [common monkey flower]
ref|XP_004148849.1|  PREDICTED: cyclase-associated protein 1-like       239   2e-72   Cucumis sativus [cucumbers]
ref|XP_003537875.1|  PREDICTED: cyclase-associated protein 1-like       238   2e-72   Glycine max [soybeans]
emb|CDX76285.1|  BnaA08g11150D                                          238   3e-72   
ref|XP_010548053.1|  PREDICTED: cyclase-associated protein 1            238   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_009804915.1|  PREDICTED: cyclase-associated protein 1            237   5e-72   Nicotiana sylvestris
ref|XP_008457926.1|  PREDICTED: cyclase-associated protein 1-like       237   7e-72   Cucumis melo [Oriental melon]
ref|XP_010263686.1|  PREDICTED: cyclase-associated protein 1-like       236   1e-71   Nelumbo nucifera [Indian lotus]
emb|CDY46244.1|  BnaC03g66050D                                          236   2e-71   Brassica napus [oilseed rape]
ref|XP_010437609.1|  PREDICTED: cyclase-associated protein 1-like       235   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010432407.1|  PREDICTED: cyclase-associated protein 1-like       234   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009605961.1|  PREDICTED: cyclase-associated protein 1            233   4e-70   Nicotiana tomentosiformis
ref|XP_004150414.1|  PREDICTED: cyclase-associated protein 1-like       232   5e-70   Cucumis sativus [cucumbers]
ref|XP_006365096.1|  PREDICTED: adenylyl cyclase-associated prote...    232   5e-70   Solanum tuberosum [potatoes]
ref|XP_003541049.1|  PREDICTED: cyclase-associated protein 1-like       231   1e-69   Glycine max [soybeans]
ref|XP_007200993.1|  hypothetical protein PRUPE_ppa005136mg             230   2e-69   Prunus persica
ref|XP_004230883.1|  PREDICTED: cyclase-associated protein 1            229   5e-69   Solanum lycopersicum
gb|KHN25370.1|  Adenylyl cyclase-associated protein                     227   4e-68   Glycine soja [wild soybean]
ref|XP_008447035.1|  PREDICTED: cyclase-associated protein 1            227   4e-68   Cucumis melo [Oriental melon]
ref|XP_010107846.1|  Adenylyl cyclase-associated protein 2              230   6e-68   
ref|XP_010028583.1|  PREDICTED: LOW QUALITY PROTEIN: cyclase-asso...    227   7e-68   Eucalyptus grandis [rose gum]
ref|XP_009396021.1|  PREDICTED: cyclase-associated protein 1-like       226   8e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936278.1|  PREDICTED: cyclase-associated protein 1            226   1e-67   Elaeis guineensis
ref|XP_010690892.1|  PREDICTED: cyclase-associated protein 1 isof...    225   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010939270.1|  PREDICTED: cyclase-associated protein 1-like       225   3e-67   Elaeis guineensis
ref|XP_007131840.1|  hypothetical protein PHAVU_011G045700g             222   4e-66   Phaseolus vulgaris [French bean]
ref|XP_009419491.1|  PREDICTED: cyclase-associated protein 1-like       221   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11477.1|  Adenylyl cyclase-associated                             221   2e-65   Gossypium arboreum [tree cotton]
ref|XP_009411142.1|  PREDICTED: cyclase-associated protein 1-like       220   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB32500.1|  hypothetical protein B456_005G243200                    219   7e-65   Gossypium raimondii
ref|XP_008778137.1|  PREDICTED: cyclase-associated protein 1-like       209   2e-64   Phoenix dactylifera
ref|XP_006856025.1|  PREDICTED: cyclase-associated protein 1            214   3e-63   Amborella trichopoda
gb|EPS61598.1|  adenylyl cyclase-associated protein                     214   4e-63   Genlisea aurea
ref|XP_008785664.1|  PREDICTED: LOW QUALITY PROTEIN: cyclase-asso...    213   1e-62   
ref|XP_004981942.1|  PREDICTED: adenylyl cyclase-associated prote...    201   3e-58   Setaria italica
ref|NP_001051112.2|  Os03g0722600                                       195   4e-57   
ref|XP_008665331.1|  PREDICTED: cyclase-associated protein 1-like       198   8e-57   
ref|XP_008643463.1|  PREDICTED: uncharacterized protein LOC100279...    198   8e-57   Zea mays [maize]
ref|XP_006650514.1|  PREDICTED: cyclase-associated protein 1-like       198   9e-57   Oryza brachyantha
gb|ABF98601.1|  cyclase-associated protein, putative, expressed         194   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95693.1|  CAP protein                                             194   3e-55   Oryza sativa Japonica Group [Japonica rice]
gb|KCW55347.1|  hypothetical protein EUGRSUZ_I01265                     188   1e-53   Eucalyptus grandis [rose gum]
ref|XP_003560473.1|  PREDICTED: cyclase-associated protein 1            188   4e-53   Brachypodium distachyon [annual false brome]
gb|EAZ07173.1|  hypothetical protein OsI_29418                          180   3e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_006659462.1|  PREDICTED: cyclase-associated protein 1-like       176   2e-48   Oryza brachyantha
ref|XP_010235186.1|  PREDICTED: cyclase-associated protein 1-like       175   3e-48   Brachypodium distachyon [annual false brome]
ref|XP_002444442.1|  hypothetical protein SORBIDRAFT_07g022030          172   3e-47   Sorghum bicolor [broomcorn]
ref|XP_004973587.1|  PREDICTED: adenylyl cyclase-associated prote...    171   9e-47   Setaria italica
ref|XP_008664624.1|  PREDICTED: cyclase-associated protein 1-like       165   1e-44   
ref|NP_001061934.1|  Os08g0447900                                       164   2e-44   
gb|EEC76093.1|  hypothetical protein OsI_13337                          163   7e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_002987315.1|  hypothetical protein SELMODRAFT_269241             155   9e-41   Selaginella moellendorffii
ref|XP_002976329.1|  hypothetical protein SELMODRAFT_175612             155   1e-40   
gb|KDO49088.1|  hypothetical protein CISIN_1g016407mg                   153   2e-40   Citrus sinensis [apfelsine]
ref|XP_001773273.1|  predicted protein                                  149   1e-38   
ref|XP_008236881.1|  PREDICTED: cyclase-associated protein 1            146   9e-37   
ref|XP_008450201.1|  PREDICTED: cyclase-associated protein 1-like       137   3e-36   
gb|EEE59831.1|  hypothetical protein OsJ_12395                          139   7e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010690893.1|  PREDICTED: cyclase-associated protein 1 isof...    134   1e-33   
ref|XP_003057213.1|  predicted protein                                  118   2e-27   Micromonas pusilla CCMP1545
ref|XP_002505939.1|  predicted protein                                  117   2e-27   Micromonas commoda
ref|NP_001145831.1|  adenylyl cyclase-associated protein                115   1e-26   Zea mays [maize]
gb|EMT04895.1|  Adenylyl cyclase-associated protein                     115   1e-26   
gb|EMS59857.1|  Adenylyl cyclase-associated protein                     114   1e-26   Triticum urartu
gb|AFW67775.1|  hypothetical protein ZEAMMB73_403811                  90.1    2e-19   
ref|XP_005842875.1|  hypothetical protein CHLNCDRAFT_142506           95.1    4e-19   Chlorella variabilis
ref|XP_005650031.1|  hypothetical protein COCSUDRAFT_46736            91.7    2e-18   Coccomyxa subellipsoidea C-169
ref|XP_008845283.1|  PREDICTED: adenylyl cyclase-associated prote...  92.0    4e-18   Nannospalax galili
ref|XP_004383037.1|  PREDICTED: adenylyl cyclase-associated prote...  91.7    5e-18   Trichechus manatus latirostris
emb|CDQ65132.1|  unnamed protein product                              90.9    8e-18   Oncorhynchus mykiss
ref|XP_004323891.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    8e-18   
gb|ABM92205.1|  CAP, adenylate cyclase-associated protein, 2 (yeast)  90.9    9e-18   synthetic construct
ref|XP_008056860.1|  PREDICTED: adenylyl cyclase-associated prote...  90.5    1e-17   Carlito syrichta
ref|XP_008329363.1|  PREDICTED: adenylyl cyclase-associated prote...  90.5    1e-17   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008992170.1|  PREDICTED: adenylyl cyclase-associated prote...  90.1    2e-17   Callithrix jacchus [common marmoset]
ref|XP_002463964.1|  hypothetical protein SORBIDRAFT_01g009760        89.0    2e-17   
ref|XP_004693343.1|  PREDICTED: adenylyl cyclase-associated prote...  88.6    4e-17   Condylura cristata
ref|XP_005964470.1|  PREDICTED: adenylyl cyclase-associated prote...  89.0    4e-17   Pantholops hodgsonii [Tibetan antelope]
ref|XP_003496059.1|  PREDICTED: adenylyl cyclase-associated prote...  89.0    5e-17   Cricetulus griseus [Chinese hamsters]
ref|XP_005355164.1|  PREDICTED: adenylyl cyclase-associated prote...  88.6    5e-17   Microtus ochrogaster [prairie voles]
ref|XP_010732388.1|  PREDICTED: adenylyl cyclase-associated prote...  88.6    6e-17   
ref|XP_003927371.1|  PREDICTED: adenylyl cyclase-associated prote...  87.8    1e-16   Saimiri boliviensis boliviensis
ref|XP_011956643.1|  PREDICTED: adenylyl cyclase-associated prote...  87.8    1e-16   
ref|XP_003468803.1|  PREDICTED: adenylyl cyclase-associated prote...  87.8    1e-16   Cavia porcellus [guinea pig]
ref|XP_003416506.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    1e-16   Loxodonta africana [African bush elephant]
ref|XP_008975022.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    1e-16   Pan paniscus [bonobo]
ref|XP_001376362.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    1e-16   Monodelphis domestica
ref|XP_001170453.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    2e-16   
ref|XP_006198680.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    2e-16   Vicugna pacos
ref|XP_004043357.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    2e-16   
ref|NP_006357.1|  adenylyl cyclase-associated protein 2               87.4    2e-16   Homo sapiens [man]
gb|AAX29556.1|  adenylate cyclase-associated protein 2                87.4    2e-16   synthetic construct
ref|XP_010943988.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    2e-16   Camelus bactrianus [camel]
ref|XP_006631262.1|  PREDICTED: adenylyl cyclase-associated prote...  87.4    2e-16   Lepisosteus oculatus
ref|NP_446326.1|  adenylyl cyclase-associated protein 2               87.4    2e-16   Rattus norvegicus [brown rat]
ref|XP_006631263.1|  PREDICTED: adenylyl cyclase-associated prote...  87.0    2e-16   
ref|XP_003760201.1|  PREDICTED: adenylyl cyclase-associated prote...  86.7    2e-16   Sarcophilus harrisii
ref|NP_001253461.1|  adenylyl cyclase-associated protein 2            87.0    2e-16   Macaca mulatta [rhesus macaque]
ref|XP_011818136.1|  PREDICTED: adenylyl cyclase-associated prote...  87.0    2e-16   Colobus angolensis palliatus
ref|XP_011886786.1|  PREDICTED: adenylyl cyclase-associated prote...  86.7    2e-16   Cercocebus atys
gb|EHH17975.1|  Adenylyl cyclase-associated protein 2                 86.7    2e-16   Macaca mulatta [rhesus macaque]
ref|XP_005814142.1|  PREDICTED: adenylyl cyclase-associated prote...  86.3    2e-16   
ref|XP_003788423.1|  PREDICTED: adenylyl cyclase-associated prote...  86.7    3e-16   
ref|XP_009202749.1|  PREDICTED: RNA-binding protein 24 isoform X1     87.0    3e-16   
ref|XP_010898586.1|  PREDICTED: adenylyl cyclase-associated prote...  86.7    3e-16   Esox lucius
ref|XP_006194351.1|  PREDICTED: adenylyl cyclase-associated prote...  86.7    3e-16   Camelus ferus
ref|XP_004761336.1|  PREDICTED: adenylyl cyclase-associated prote...  86.7    3e-16   Mustela putorius furo [black ferret]
gb|EDL41025.1|  CAP, adenylate cyclase-associated protein, 2 (yea...  85.9    3e-16   Mus musculus [mouse]
ref|XP_004273591.1|  PREDICTED: adenylyl cyclase-associated prote...  86.3    3e-16   Orcinus orca [Orca]
ref|XP_007971800.1|  PREDICTED: adenylyl cyclase-associated prote...  86.3    4e-16   Chlorocebus sabaeus
ref|XP_005696896.1|  PREDICTED: adenylyl cyclase-associated prote...  85.9    5e-16   
sp|Q5R5X8.1|CAP2_PONAB  RecName: Full=Adenylyl cyclase-associated...  85.9    6e-16   Pongo abelii [orang utan]
ref|NP_001125913.1|  adenylyl cyclase-associated protein 2            85.9    6e-16   Pongo abelii [orang utan]
ref|XP_010351029.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    6e-16   Rhinopithecus roxellana
emb|CAI29662.1|  hypothetical protein                                 85.5    6e-16   Pongo abelii [orang utan]
gb|EDL41026.1|  CAP, adenylate cyclase-associated protein, 2 (yea...  85.5    7e-16   Mus musculus [mouse]
ref|XP_006972903.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    7e-16   
ref|NP_080332.1|  adenylyl cyclase-associated protein 2               85.5    7e-16   Mus musculus [mouse]
ref|XP_006517009.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    7e-16   Mus musculus [mouse]
ref|XP_006972902.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    7e-16   
ref|XP_005403463.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    7e-16   Chinchilla lanigera
tpg|DAA16133.1|  TPA: CAP, adenylate cyclase-associated protein, 2    85.5    8e-16   Bos taurus [bovine]
ref|XP_007950881.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    8e-16   Orycteropus afer afer
ref|XP_006972904.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    8e-16   Peromyscus maniculatus bairdii
emb|CDQ79594.1|  unnamed protein product                              85.1    8e-16   Oncorhynchus mykiss
ref|NP_001092449.1|  adenylyl cyclase-associated protein 2            85.5    8e-16   Bos taurus [bovine]
ref|XP_006072568.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    8e-16   Bubalus bubalis [domestic water buffalo]
ref|XP_005898287.1|  PREDICTED: adenylyl cyclase-associated prote...  85.5    8e-16   Bos mutus
ref|XP_004593187.1|  PREDICTED: adenylyl cyclase-associated prote...  85.1    8e-16   Ochotona princeps [southern American pika]
ref|XP_010816777.1|  PREDICTED: adenylyl cyclase-associated prote...  85.1    9e-16   
ref|XP_007129231.1|  PREDICTED: adenylyl cyclase-associated prote...  85.1    1e-15   
ref|XP_003263591.1|  PREDICTED: adenylyl cyclase-associated prote...  85.1    1e-15   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007129232.1|  PREDICTED: adenylyl cyclase-associated prote...  85.1    1e-15   
ref|XP_005329199.1|  PREDICTED: adenylyl cyclase-associated prote...  85.1    1e-15   
ref|XP_004548966.1|  PREDICTED: adenylyl cyclase-associated prote...  84.7    1e-15   
ref|XP_007197231.1|  PREDICTED: adenylyl cyclase-associated prote...  85.1    1e-15   Balaenoptera acutorostrata scammoni
ref|NP_001133556.1|  Adenylyl cyclase-associated protein 1            84.7    1e-15   Salmo salar
ref|XP_004847694.1|  PREDICTED: adenylyl cyclase-associated prote...  84.7    1e-15   Heterocephalus glaber [naked mole rat]
ref|XP_007950151.1|  PREDICTED: adenylyl cyclase-associated prote...  84.7    1e-15   Orycteropus afer afer
ref|XP_005964471.1|  PREDICTED: adenylyl cyclase-associated prote...  84.3    1e-15   Pantholops hodgsonii [Tibetan antelope]
gb|EPQ11934.1|  Adenylyl cyclase-associated protein 2                 85.1    1e-15   Myotis brandtii
gb|ELQ40478.1|  adenylyl cyclase-associated protein                   84.7    1e-15   Magnaporthe oryzae Y34
ref|XP_010621211.1|  PREDICTED: adenylyl cyclase-associated prote...  84.7    1e-15   Fukomys damarensis [Damara mole rat]
ref|XP_003714719.1|  adenylyl cyclase-associated protein              85.1    1e-15   Magnaporthe oryzae 70-15
ref|XP_008691010.1|  PREDICTED: adenylyl cyclase-associated prote...  84.7    1e-15   Ursus maritimus [white bear]
ref|XP_007655721.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...  84.0    1e-15   
ref|XP_005656149.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    2e-15   
ref|XP_003969232.1|  PREDICTED: adenylyl cyclase-associated prote...  84.3    2e-15   
ref|XP_010593550.1|  PREDICTED: adenylyl cyclase-associated prote...  84.0    2e-15   Loxodonta africana [African bush elephant]
ref|XP_009579928.1|  PREDICTED: adenylyl cyclase-associated prote...  80.9    2e-15   Fulmarus glacialis
gb|EFB21042.1|  hypothetical protein PANDA_016728                     84.3    2e-15   Ailuropoda melanoleuca
ref|XP_004667990.1|  PREDICTED: adenylyl cyclase-associated prote...  84.0    2e-15   Jaculus jaculus
ref|XP_004882922.1|  PREDICTED: adenylyl cyclase-associated prote...  84.0    2e-15   
ref|XP_006091808.1|  PREDICTED: adenylyl cyclase-associated prote...  84.0    2e-15   
ref|XP_002927031.1|  PREDICTED: adenylyl cyclase-associated prote...  84.0    2e-15   Ailuropoda melanoleuca
ref|XP_006764135.1|  PREDICTED: adenylyl cyclase-associated prote...  84.0    2e-15   Myotis davidii
ref|XP_005656145.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    3e-15   
ref|XP_006888731.1|  PREDICTED: adenylyl cyclase-associated prote...  84.0    3e-15   Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CAI46134.1|  hypothetical protein                                 83.2    3e-15   Homo sapiens [man]
ref|XP_004704997.1|  PREDICTED: adenylyl cyclase-associated prote...  83.6    3e-15   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004665349.1|  PREDICTED: adenylyl cyclase-associated prote...  83.6    3e-15   Jaculus jaculus
ref|XP_003765456.1|  PREDICTED: adenylyl cyclase-associated prote...  83.6    3e-15   Sarcophilus harrisii
ref|XP_006165585.1|  PREDICTED: adenylyl cyclase-associated prote...  83.6    3e-15   Tupaia chinensis
ref|XP_004406084.1|  PREDICTED: adenylyl cyclase-associated prote...  83.6    3e-15   Odobenus rosmarus divergens
ref|XP_006867667.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    3e-15   Chrysochloris asiatica
ref|XP_005873097.1|  PREDICTED: adenylyl cyclase-associated prote...  83.6    3e-15   Myotis brandtii
ref|XP_009968334.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-15   Tyto alba [Schleiereule]
dbj|BAH11460.1|  unnamed protein product                              82.8    4e-15   Homo sapiens [man]
gb|ELR49684.1|  Adenylyl cyclase-associated protein 1                 83.2    4e-15   Bos mutus
ref|XP_009863973.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-15   Apaloderma vittatum
ref|XP_006198682.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    4e-15   
ref|XP_006861078.1|  PREDICTED: adenylyl cyclase-associated prote...  83.2    4e-15   Chrysochloris asiatica
ref|XP_005494743.1|  PREDICTED: adenylyl cyclase-associated prote...  83.2    5e-15   Zonotrichia albicollis
ref|XP_004704996.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    5e-15   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005993962.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    6e-15   Latimeria chalumnae
ref|XP_005656154.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    6e-15   
ref|XP_008588043.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    6e-15   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005739752.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    6e-15   Pundamilia nyererei
ref|XP_002720911.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    6e-15   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006091809.1|  PREDICTED: adenylyl cyclase-associated prote...  82.8    6e-15   
ref|XP_005873098.1|  PREDICTED: adenylyl cyclase-associated prote...  82.4    7e-15   
ref|XP_002196792.2|  PREDICTED: adenylyl cyclase-associated prote...  82.4    8e-15   Taeniopygia guttata
ref|XP_005058254.1|  PREDICTED: adenylyl cyclase-associated prote...  82.4    9e-15   
emb|CAF92650.1|  unnamed protein product                              82.4    9e-15   Tetraodon nigroviridis
ref|XP_010305303.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    9e-15   Balearica regulorum gibbericeps
ref|XP_005353362.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    9e-15   Microtus ochrogaster [prairie voles]
ref|XP_003799026.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    9e-15   
ref|XP_004371955.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    9e-15   Trichechus manatus latirostris
ref|XP_006194353.1|  PREDICTED: adenylyl cyclase-associated prote...  81.6    1e-14   
ref|XP_005938812.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    1e-14   Haplochromis burtoni
ref|XP_008144309.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    1e-14   Eptesicus fuscus
ref|XP_003127870.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-14   
gb|EDL80362.1|  CAP, adenylate cyclase-associated protein 1 (yeas...  80.1    1e-14   Rattus norvegicus [brown rat]
ref|XP_006909304.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    1e-14   Pteropus alecto
ref|XP_004074190.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    1e-14   Oryzias latipes [Japanese rice fish]
ref|XP_006727774.1|  PREDICTED: adenylyl cyclase-associated prote...  82.0    1e-14   Leptonychotes weddellii
ref|XP_008633293.1|  PREDICTED: adenylyl cyclase-associated prote...  81.6    1e-14   Corvus brachyrhynchos
gb|ELK14951.1|  Adenylyl cyclase-associated protein 2                 81.6    1e-14   Pteropus alecto
ref|XP_010146848.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    1e-14   Eurypyga helias
ref|XP_003447228.1|  PREDICTED: adenylyl cyclase-associated prote...  81.6    1e-14   Oreochromis niloticus
ref|XP_009239721.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    1e-14   
dbj|BAB26786.1|  unnamed protein product                              81.6    1e-14   Mus musculus [mouse]
ref|XP_007245760.1|  PREDICTED: adenylyl cyclase-associated prote...  81.6    1e-14   Astyanax mexicanus [blind cave fish]
ref|XP_011361156.1|  PREDICTED: adenylyl cyclase-associated prote...  81.6    1e-14   Pteropus vampyrus
ref|XP_005111120.1|  PREDICTED: uncharacterized protein LOC101845282  81.3    1e-14   
ref|XP_006992312.1|  PREDICTED: adenylyl cyclase-associated prote...  81.6    2e-14   
ref|XP_535897.2|  PREDICTED: adenylyl cyclase-associated protein ...  81.6    2e-14   Canis lupus familiaris [dogs]
ref|XP_010122707.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-14   Chlamydotis macqueenii
ref|XP_003799027.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    2e-14   Otolemur garnettii
ref|XP_007527140.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    2e-14   
ref|XP_004740743.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    2e-14   
ref|XP_004740745.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    2e-14   Mustela putorius furo [black ferret]
ref|XP_005427223.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    2e-14   Geospiza fortis
ref|XP_005898288.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    2e-14   Bos mutus
ref|XP_001634942.1|  predicted protein                                78.6    2e-14   Nematostella vectensis
ref|XP_008710219.1|  PREDICTED: adenylyl cyclase-associated prote...  80.9    3e-14   Ursus maritimus [white bear]
ref|XP_003263592.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    3e-14   
ref|XP_003642632.1|  PREDICTED: adenylyl cyclase-associated prote...  81.3    3e-14   
ref|XP_007527141.1|  PREDICTED: adenylyl cyclase-associated prote...  80.9    3e-14   
ref|XP_008578476.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    3e-14   
ref|XP_007539337.1|  PREDICTED: adenylyl cyclase-associated prote...  80.9    3e-14   
ref|XP_005395335.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    3e-14   
ref|XP_004740744.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    3e-14   
ref|XP_848565.1|  PREDICTED: adenylyl cyclase-associated protein ...  80.5    4e-14   
ref|XP_005084392.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_004715348.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_010070712.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_004614276.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_001493568.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_003505107.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_004432154.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_007089822.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_007576532.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_007950166.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    4e-14   
ref|XP_008303166.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-14   
ref|XP_008169234.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-14   
ref|XP_003985800.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_005607231.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-14   
ref|XP_005628947.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-14   
ref|XP_009203956.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    4e-14   
ref|XP_005868717.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-14   
ref|XP_006098198.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    4e-14   
ref|XP_009882473.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    4e-14   
ref|NP_071778.2|  adenylyl cyclase-associated protein 1               80.1    4e-14   
ref|XP_005868715.1|  PREDICTED: adenylyl cyclase-associated prote...  80.5    5e-14   
ref|NP_956203.1|  adenylyl cyclase-associated protein 1               80.1    5e-14   
ref|XP_010137301.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
gb|AAA41579.1|  cyclase-associated protein                            80.1    5e-14   
ref|XP_003227611.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
ref|XP_006061981.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
gb|AAI50357.1|  Cap1 CAP, adenylate cyclase-associated protein 1      80.1    5e-14   
ref|XP_007461326.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...  80.1    5e-14   
ref|XP_005529871.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
dbj|BAE88235.1|  unnamed protein product                              78.6    5e-14   
ref|XP_006758034.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
dbj|BAE87547.1|  unnamed protein product                              79.0    5e-14   
ref|XP_004484841.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
ref|XP_006758032.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
ref|XP_010861116.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
ref|XP_007950882.1|  PREDICTED: adenylyl cyclase-associated prote...  80.1    5e-14   
ref|NP_001001239.1|  CAP, adenylate cyclase-associated protein 1      80.1    5e-14   
ref|XP_009096831.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    5e-14   
ref|XP_009096832.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    5e-14   
gb|ERE85598.1|  adenylyl cyclase-associated protein 1-like isoform 2  80.1    6e-14   
ref|XP_010126228.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    6e-14   
ref|XP_009203933.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    6e-14   
ref|XP_007089821.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    6e-14   
gb|EPQ09246.1|  Adenylyl cyclase-associated protein 1                 80.1    6e-14   
ref|XP_005628948.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_003653062.1|  hypothetical protein THITE_2115066               79.7    7e-14   
ref|XP_006061979.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_008149406.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_005395332.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_009499805.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_009324762.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_006737570.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_005235119.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_007077462.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    7e-14   
ref|XP_004406086.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    8e-14   
ref|XP_005434963.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    8e-14   
ref|XP_006098199.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    8e-14   
ref|XP_005868716.1|  PREDICTED: adenylyl cyclase-associated prote...  79.7    8e-14   
ref|XP_010175820.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
gb|EFB13520.1|  hypothetical protein PANDA_017394                     79.3    9e-14   
ref|XP_011233455.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
ref|XP_006758033.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
ref|XP_004484843.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
gb|EHH14648.1|  hypothetical protein EGK_00610                        79.3    9e-14   
ref|XP_001365608.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
ref|XP_009896390.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
ref|XP_008071360.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
gb|EHH49807.1|  hypothetical protein EGM_00529                        79.3    9e-14   
ref|XP_008918818.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
ref|XP_001503410.2|  PREDICTED: adenylyl cyclase-associated prote...  79.3    9e-14   
ref|XP_011935796.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_004266450.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    1e-13   
gb|ELK34614.1|  Adenylyl cyclase-associated protein 1                 79.3    1e-13   
ref|XP_007114322.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    1e-13   
ref|XP_005543903.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    1e-13   
ref|XP_010207456.1|  PREDICTED: adenylyl cyclase-associated prote...  79.3    1e-13   
ref|XP_011810615.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_004093242.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...  79.3    1e-13   
sp|Q4R4I6.3|CAP1_MACFA  RecName: Full=Adenylyl cyclase-associated...  79.0    1e-13   
ref|XP_009676248.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_007077463.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_011810614.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_008710220.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_006006838.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    1e-13   
ref|XP_009271982.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_005149946.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_011376287.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_008495361.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_009499806.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_006904030.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_009999246.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_009636245.1|  PREDICTED: adenylyl cyclase-associated prote...  79.0    1e-13   
ref|XP_009019619.1|  hypothetical protein HELRODRAFT_66158            79.0    1e-13   
gb|ELK19496.1|  Adenylyl cyclase-associated protein 1                 79.0    1e-13   
ref|XP_011959062.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    1e-13   
ref|XP_005970526.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    1e-13   
ref|XP_005204713.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_005904935.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
gb|KFM05524.1|  Adenylyl cyclase-associated protein 1                 78.6    2e-13   
ref|XP_009917477.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_005678705.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_010286700.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_011233454.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
gb|KFD55265.1|  hypothetical protein M513_03906                       78.6    2e-13   
ref|XP_010137300.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_009274522.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_005317919.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_009881073.1|  PREDICTED: adenylyl cyclase-associated prote...  78.6    2e-13   
ref|XP_008941672.1|  PREDICTED: adenylyl cyclase-associated prote...  75.9    2e-13   
ref|XP_009473692.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
gb|KHJ45172.1|  CAP protein                                           78.6    2e-13   
ref|XP_011538813.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_008966632.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_005270425.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_009937699.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
gb|AAP36887.1|  Homo sapiens adenylyl cyclase-associated protein      78.2    2e-13   
dbj|BAE25697.1|  unnamed protein product                              78.2    2e-13   
ref|XP_010721818.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_009452975.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_005970523.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_004025576.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
dbj|BAD96233.1|  adenylyl cyclase-associated protein variant          78.2    2e-13   
ref|XP_003815466.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
dbj|BAE42104.1|  unnamed protein product                              78.2    2e-13   
ref|NP_006358.1|  adenylyl cyclase-associated protein 1               78.2    2e-13   
gb|AAC37610.1|  adenylyl cyclase-associated protein                   78.2    2e-13   
ref|NP_031624.2|  adenylyl cyclase-associated protein 1               78.2    2e-13   
ref|XP_007164771.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
gb|ABM81586.1|  CAP, adenylate cyclase-associated protein 1 (yeast)   78.2    2e-13   
ref|XP_006019357.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_007453821.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_004001884.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|NP_001030182.1|  adenylyl cyclase-associated protein 1            78.2    2e-13   
ref|XP_009203949.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    2e-13   
dbj|BAG38086.1|  unnamed protein product                              78.2    2e-13   
ref|XP_004678898.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_008421240.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...  77.8    2e-13   
gb|KFP04456.1|  Adenylyl cyclase-associated protein 1                 77.8    2e-13   
gb|EDL30398.1|  CAP, adenylate cyclase-associated protein 1 (yeas...  78.2    2e-13   
ref|XP_006215927.1|  PREDICTED: adenylyl cyclase-associated prote...  78.2    2e-13   
ref|XP_009330424.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    2e-13   
ref|XP_005678703.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    2e-13   
ref|XP_010303131.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    2e-13   
ref|XP_003204773.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_004426065.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
gb|EDL30399.1|  CAP, adenylate cyclase-associated protein 1 (yeas...  78.2    3e-13   
ref|XP_010018923.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_009978742.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_003937061.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_006165009.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_003799032.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    3e-13   
ref|XP_004415421.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_008496674.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_011833045.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_005512594.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_009562447.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_010289159.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_006061980.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_009917476.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_006909306.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    3e-13   
ref|XP_011833044.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_010958115.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_418936.2|  PREDICTED: adenylyl cyclase-associated protein ...  77.8    3e-13   
ref|XP_009896391.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_008144311.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    3e-13   
ref|XP_009882472.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_004450686.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_005023104.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_011361158.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    3e-13   
ref|XP_009250269.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_004266448.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_004426064.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_004641127.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
ref|XP_005525330.1|  PREDICTED: adenylyl cyclase-associated prote...  77.8    3e-13   
dbj|BAE23277.1|  unnamed protein product                              77.4    3e-13   
ref|XP_010574378.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    3e-13   
ref|XP_009929138.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    3e-13   
ref|XP_007114320.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    3e-13   
ref|NP_001126158.1|  adenylyl cyclase-associated protein 1            77.4    4e-13   
ref|XP_010175819.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|XP_009964312.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...  77.4    4e-13   
ref|XP_004678899.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|XP_009583379.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|XP_005904936.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|XP_009473691.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
gb|EPY78467.1|  adenylyl cyclase-associated protein 1                 77.4    4e-13   
ref|XP_009693842.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|XP_010158245.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|XP_010958112.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
gb|AAP57717.1|  cyclase-associated protein 1b                         77.4    4e-13   
ref|XP_007067663.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|XP_006188100.1|  PREDICTED: adenylyl cyclase-associated prote...  77.4    4e-13   
ref|NP_001082639.1|  CAP, adenylate cyclase-associated protein 1      77.0    5e-13   
ref|XP_010135264.1|  PREDICTED: adenylyl cyclase-associated prote...  77.0    5e-13   
ref|XP_008920531.1|  PREDICTED: adenylyl cyclase-associated prote...  77.0    5e-13   
ref|XP_001082428.1|  PREDICTED: adenylyl cyclase-associated prote...  77.0    5e-13   
ref|XP_011582296.1|  PREDICTED: adenylyl cyclase-associated prote...  77.0    5e-13   
ref|XP_005041627.1|  PREDICTED: adenylyl cyclase-associated prote...  77.0    5e-13   
gb|AAH91655.1|  Zgc:73317 protein                                     77.0    5e-13   
ref|XP_009469078.1|  PREDICTED: adenylyl cyclase-associated prote...  77.0    6e-13   
ref|NP_957130.1|  adenylyl cyclase-associated protein 2               77.0    6e-13   
gb|EAX07240.1|  CAP, adenylate cyclase-associated protein 1 (yeas...  76.6    6e-13   
ref|XP_005481805.1|  PREDICTED: adenylyl cyclase-associated prote...  77.0    6e-13   
ref|XP_006188099.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    6e-13   
ref|XP_005159849.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    6e-13   
ref|XP_009813967.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    6e-13   
ref|XP_010789579.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...  76.6    7e-13   
ref|XP_005968023.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    7e-13   
ref|XP_006114852.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    7e-13   
ref|XP_005968024.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    7e-13   
gb|EHB14571.1|  Adenylyl cyclase-associated protein 1                 76.6    7e-13   
ref|XP_009084584.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    7e-13   
ref|XP_008629116.1|  PREDICTED: adenylyl cyclase-associated prote...  76.6    7e-13   



>emb|CDO97057.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 146/169 (86%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAVARLE LS G    G S ++   AA+ DPSIVA+EDLI+Q VGR+SSA
Sbjct  1    MDEKLIQRLESAVARLEALSCG---RGGSPDIGGDAASLDPSIVAYEDLIAQFVGRVSSA  57

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVLD TKI++ AFS QKELLIK K  QKPDM GL EFLKPLNEVI++ + +TEG
Sbjct  58   AEKIGGQVLDVTKIMEQAFSTQKELLIKVKQSQKPDMAGLVEFLKPLNEVIVKATKMTEG  117

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAATDSLTALAWIAY+GKDCGMSMPIAHVEESWQMAEFY+
Sbjct  118  RRSDFFNHLKAATDSLTALAWIAYSGKDCGMSMPIAHVEESWQMAEFYS  166



>ref|XP_006349606.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Solanum 
tuberosum]
Length=471

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAV+RLE LS GG   G S     +AAA DPSI+AF+DL SQ VGR+ +A
Sbjct  1    MDEKLIQRLESAVSRLEALSVGG---GPSLGDGEAAAALDPSIIAFDDLRSQFVGRVCTA  57

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVLD TKIV++AF AQ+ELLIK K  QKP M GL+EFLKPLN+VI++G+ +TEG
Sbjct  58   AEKIGGQVLDVTKIVEEAFEAQRELLIKIKETQKPSMSGLAEFLKPLNDVIVKGTKMTEG  117

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAA DSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  118  RRSDFFNHLKAAVDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  166



>ref|XP_009619104.1| PREDICTED: cyclase-associated protein 1-like [Nicotiana tomentosiformis]
Length=474

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAV RLE LS GGF  G S     +AA  DPSI+AF+DL SQ VGR+ SA
Sbjct  1    MDEKLIQRLESAVTRLEALSAGGFSGGVSPGEGEAAAVLDPSIIAFDDLRSQFVGRVRSA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGG+VLD TKIV++AF AQ+ELLIK K  QKPDM GL+EFLKPLN+VI++ + + EG
Sbjct  61   AEKIGGRVLDVTKIVEEAFEAQRELLIKIKQTQKPDMSGLAEFLKPLNDVIVKATKMIEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RR DFFNHLKAA DSLTALAWIAYTGKDCG+SMPIAHVEESWQMAEFYN
Sbjct  121  RRPDFFNHLKAAVDSLTALAWIAYTGKDCGLSMPIAHVEESWQMAEFYN  169



>ref|XP_006423253.1| hypothetical protein CICLE_v10028340mg [Citrus clementina]
 ref|XP_006487151.1| PREDICTED: cyclase-associated protein 1-like [Citrus sinensis]
 gb|ESR36493.1| hypothetical protein CICLE_v10028340mg [Citrus clementina]
Length=479

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLE+AV+RLE +S  G G G     D + AASDPSI A++DL+SQ +GR+S+A
Sbjct  1    MDEKLIQRLEAAVSRLEAISVRG-GSGVESFGDGADAASDPSIKAYDDLMSQYLGRVSAA  59

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVLDATKIV+ AFSAQKELL+K K  QKPD+ GL+EFLKPLNEVIM+ +++TEG
Sbjct  60   AEKIGGQVLDATKIVEQAFSAQKELLVKVKQTQKPDLVGLAEFLKPLNEVIMKANAMTEG  119

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLK+A DSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  120  RRSDFFNHLKSAADSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYS  168



>ref|XP_009775243.1| PREDICTED: cyclase-associated protein 1-like [Nicotiana sylvestris]
Length=474

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDE+LIQRLESAV RLE LS GGF  G S     +AA  DPSI+AF+DL SQ  GR+ SA
Sbjct  1    MDEELIQRLESAVTRLEALSAGGFSGGVSPGEGEAAAVLDPSIIAFDDLRSQFAGRVRSA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGG+VLD TKIV++AF AQ+ELLIK K  QKPDM GL+EFLKPLN+VI++ + + EG
Sbjct  61   AEKIGGRVLDVTKIVEEAFEAQRELLIKIKQTQKPDMSGLAEFLKPLNDVIVKATKMIEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RR DFFNHLKAA DSLTALAWIAYTGKDCG+SMPIAHVEESWQMAEFYN
Sbjct  121  RRPDFFNHLKAAVDSLTALAWIAYTGKDCGLSMPIAHVEESWQMAEFYN  169



>ref|XP_004248719.1| PREDICTED: cyclase-associated protein 1 [Solanum lycopersicum]
Length=471

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAV+RLE LS GG   G S     +AAA DPSI+AF+DL S+ VGR+ +A
Sbjct  1    MDEKLIQRLESAVSRLEALSVGG---GVSLGDGEAAAALDPSIIAFDDLRSRFVGRVCTA  57

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVLD TKIV++AF AQ+ELLIK K  QKP M GL+EFLKPLN+VI++G+ +TEG
Sbjct  58   AEKIGGQVLDVTKIVEEAFEAQRELLIKIKETQKPSMSGLAEFLKPLNDVIVKGTKMTEG  117

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSD FNHLKAA DSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  118  RRSDLFNHLKAAVDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  166



>ref|XP_002509481.1| adenylyl cyclase-associated protein, putative [Ricinus communis]
 gb|EEF50868.1| adenylyl cyclase-associated protein, putative [Ricinus communis]
Length=475

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVD-VSAAASDPSIVAFEDLISQCVGRLSS  285
            M+EKL+ RLESAVARLE LST GF  G   +      AASDPSIVAF+D I Q +GRL +
Sbjct  1    MEEKLVARLESAVARLEALSTSGFRGGAVGDFSGADVAASDPSIVAFDDFIGQYLGRLWN  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TKIV++AFSA K+LLI+ K  QKP++ GL+EFLKPLNEVIM+ +++TE
Sbjct  61   AAEKIGGQVLDVTKIVQEAFSALKQLLIQAKQTQKPELAGLAEFLKPLNEVIMKATAMTE  120

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  GRRSDFFNHLKSAADSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  170



>ref|XP_011088387.1| PREDICTED: cyclase-associated protein 1 [Sesamum indicum]
Length=472

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDE L++RLE+AV RLE LS GGF  G   E    AAA+DPSIVAF+DLISQCV R++SA
Sbjct  1    MDENLVKRLEAAVVRLEALSAGGFQRGVELEDSGDAAAADPSIVAFDDLISQCVSRVTSA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
             EKIGGQVLD ++ + +AF+ Q+ELL+KTK  QKPDM GL EFLKPLNEVI + S+LTEG
Sbjct  61   GEKIGGQVLDVSRFIAEAFNVQRELLVKTKQSQKPDMAGLVEFLKPLNEVITKASALTEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            +RSD+F+HLK   DSL ALAWIAYTGKDCGMSMPIAHVEESWQMAEFY
Sbjct  121  KRSDYFHHLKTGADSLAALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  168



>ref|XP_006412221.1| hypothetical protein EUTSA_v10025082mg [Eutrema salsugineum]
 gb|ESQ53674.1| hypothetical protein EUTSA_v10025082mg [Eutrema salsugineum]
Length=478

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 144/175 (82%), Gaps = 6/175 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSA------AASDPSIVAFEDLISQCV  270
            M+E LI+RLE+AV RLE +S+ G G   SR  D SA      AASDPSIVA+EDLISQCV
Sbjct  1    MEEDLIKRLEAAVTRLEGISSNGGGVTLSRGGDFSAGAGTDVAASDPSIVAYEDLISQCV  60

Query  271  GRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRG  450
            GR  SAAEKIGG VLD TKIV +AF+ QKELL++ K  QKPDM GL+ FLKPLNEV M+ 
Sbjct  61   GRALSAAEKIGGPVLDVTKIVAEAFATQKELLVRLKQTQKPDMAGLAGFLKPLNEVTMKA  120

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             ++T+G+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  DAMTQGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  175



>ref|XP_012069926.1| PREDICTED: cyclase-associated protein 1 [Jatropha curcas]
 ref|XP_012069932.1| PREDICTED: cyclase-associated protein 1 [Jatropha curcas]
 gb|KDP46247.1| hypothetical protein JCGZ_10087 [Jatropha curcas]
Length=474

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EKLI RLESAVARLE LST G       +      ASDPSI+AF+DLI Q +GR+SSA
Sbjct  1    MEEKLIARLESAVARLEALSTSGIRERGGLDFGAFDVASDPSILAFDDLIGQYLGRVSSA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQV + TKI++ AFS QKELL+K K  QKP + GL+EFLKPLNEVIM+ +++TEG
Sbjct  61   AEKIGGQVWEVTKIIQQAFSVQKELLVKAKQTQKPGLAGLAEFLKPLNEVIMKANAMTEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLK+A DSLTALAWIAYTGKDCGM+MPIAHVEESWQMAEFYN
Sbjct  121  RRSDFFNHLKSAADSLTALAWIAYTGKDCGMNMPIAHVEESWQMAEFYN  169



>ref|XP_009112095.1| PREDICTED: cyclase-associated protein 1 [Brassica rapa]
Length=477

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 146/176 (83%), Gaps = 7/176 (4%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGT-SREVDVSA-----AASDPSIVAFEDLISQC  267
            MDE LI+RLE+AV RLE +S TGG G  T SR  D SA     A+SDPSI+A+EDLISQC
Sbjct  1    MDESLIKRLEAAVTRLEGISSTGGGGVTTLSRGGDFSAGTDAAASSDPSILAYEDLISQC  60

Query  268  VGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMR  447
            VGR  SAAEKIGG VLD TKIV +AF+ QK+LL++ K  QKPDM GL+ FLKPLN+V M+
Sbjct  61   VGRALSAAEKIGGPVLDVTKIVAEAFATQKDLLVRIKQTQKPDMAGLAGFLKPLNDVTMK  120

Query  448  GSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
              ++T+GRRSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  ADAMTQGRRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  176



>ref|XP_004507425.1| PREDICTED: adenylyl cyclase-associated protein-like [Cicer arietinum]
Length=469

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAV+RLE +STG   H  S   D S AA DPS+VAF DLI Q VGR+SSA
Sbjct  1    MDEKLIQRLESAVSRLEAISTGT--HSASSPSDASDAAFDPSVVAFGDLIDQYVGRVSSA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AE IGGQVL+ T  VK+AF+AQKELLIK K  QKPD  GL+EFLKPLNEVI++ +SLTEG
Sbjct  59   AEIIGGQVLEVTNRVKEAFAAQKELLIKLKHTQKPDPAGLAEFLKPLNEVIVKATSLTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAA DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  119  RRSDFFNHLKAAVDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYS  167



>emb|CDX75438.1| BnaA01g02640D [Brassica napus]
Length=469

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 9/178 (5%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGT-SREVDVS-------AAASDPSIVAFEDLIS  261
            M+E LI+RLE+AV RLE +S TGG G  T SR  D S       AA+SDPSI+A+EDLIS
Sbjct  1    MEESLIKRLEAAVTRLEGISSTGGGGVTTLSRGGDFSSGAGTDAAASSDPSILAYEDLIS  60

Query  262  QCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVI  441
            QCVGR  SAAEKIGG VLD TKIV +AF+ QK+LL++ K  QKPDM GL+ FLKPLN+V 
Sbjct  61   QCVGRALSAAEKIGGPVLDVTKIVAEAFATQKDLLVRIKQTQKPDMAGLAGFLKPLNDVT  120

Query  442  MRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            M+  ++T+GRRSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  MKADAMTQGRRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  178



>ref|XP_010530841.1| PREDICTED: cyclase-associated protein 1 [Tarenaya hassleriana]
Length=475

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLST---GGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRL  279
            M+E LI+RLE+AV RLE +S    G F  G   E     A+SDP I+A+EDLISQCVGR+
Sbjct  1    MEEDLIKRLEAAVTRLEAVSRSAGGAFLSGVG-ETAADGASSDPEILAYEDLISQCVGRV  59

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
             SAAE IGGQVLDA+KIV +AF+AQKELL++ K  QKPD+ GL +FLKPLNEVI++ +++
Sbjct  60   LSAAENIGGQVLDASKIVAEAFNAQKELLVRVKQTQKPDLAGLGDFLKPLNEVIVKANAM  119

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             EG+RSDFFNHLKAA DSLTALAWIA+TGKDCGMSMPIAH+EESWQMAEFYN
Sbjct  120  IEGKRSDFFNHLKAAADSLTALAWIAFTGKDCGMSMPIAHIEESWQMAEFYN  171



>gb|ADZ16117.1| adenylyl cyclase associated protein [Gossypium hirsutum]
Length=445

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>ref|XP_008375926.1| PREDICTED: cyclase-associated protein 1 [Malus domestica]
Length=476

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+EKLI+RLESAV+RLE LS T G G  T+R  D   A  DPSI+A+EDLI Q +GR+S+
Sbjct  1    MEEKLIERLESAVSRLEALSLTAGGGSATARGFD--DAPLDPSILAYEDLIGQYLGRVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+++ AFSAQK+LLI+ K  QKPD  GL+EFLKPLNE I + +SLTE
Sbjct  59   AAEKIGGQVLDITKVLQQAFSAQKDLLIQVKQTQKPDNAGLAEFLKPLNEAITKANSLTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            GRRSDFFNHLK A DSL+ALAWIAYTGK+CGMSMPIAHVEESWQMAEFY
Sbjct  119  GRRSDFFNHLKTAADSLSALAWIAYTGKECGMSMPIAHVEESWQMAEFY  167



>gb|AEN70782.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
brasiliense]
 gb|AEN70784.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
peruvianum]
Length=445

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|ADZ16115.1| adenylyl cyclase associated protein [Gossypium raimondii]
Length=445

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|KJB79111.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=445

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70776.1| adenylyl cyclase-associated protein [Gossypium mustelinum]
Length=445

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|KJB79112.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=446

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|KJB79115.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=454

 Score =   247 bits (630),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>ref|XP_003631649.1| PREDICTED: cyclase-associated protein 1 [Vitis vinifera]
 emb|CBI32583.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAV RLE + T GF  G S E    AA  DP+IVAF+DL+++ V R+S+A
Sbjct  1    MDEKLIQRLESAVTRLEVV-TAGFRGGGSPETGAEAAL-DPAIVAFDDLMAEFVARVSAA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIGG+VL+ATKI+++AFS QKELL+K K  QKPD  G++EFLKPL+EVIM+ ++LTEG
Sbjct  59   AGKIGGKVLEATKILEEAFSVQKELLVKVKQSQKPDPAGMAEFLKPLHEVIMKANALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLK A DSLTALAWIAYTGKDCGMS+PIAHVEESWQMAEFYN
Sbjct  119  RRSDFFNHLKTAADSLTALAWIAYTGKDCGMSLPIAHVEESWQMAEFYN  167



>gb|KJB79114.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=465

 Score =   247 bits (630),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>ref|XP_010447070.1| PREDICTED: cyclase-associated protein 1 isoform X1 [Camelina 
sativa]
Length=476

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 144/174 (83%), Gaps = 5/174 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-----HGTSREVDVSAAASDPSIVAFEDLISQCVG  273
            M+E LI+RLE+AV RLE +S+ G G      G    +D   A+SDPSI+A++DLISQCVG
Sbjct  1    MEEDLIKRLEAAVTRLEGISSNGGGVVSVSRGGDFSIDDDVASSDPSILAYDDLISQCVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
            R  +AAEKIGG VLD TK+V +AF++QKELL++ K  QKPD+ GL+ FLKPLN+V M+ +
Sbjct  61   RALTAAEKIGGVVLDVTKVVAEAFASQKELLVRIKQTQKPDLAGLAGFLKPLNDVTMKAN  120

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            ++TEG+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  AMTEGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  174



>gb|AEN70789.1| adenylyl cyclase-associated protein [Gossypium davidsonii]
 gb|AEN70790.1| adenylyl cyclase-associated protein [Gossypium klotzschianum]
Length=471

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70772.1| adenylyl cyclase-associated protein [Gossypium laxum]
 gb|AEN70774.1| adenylyl cyclase-associated protein [Gossypium turneri]
 gb|AEN70787.1| adenylyl cyclase-associated protein [Gossypium armourianum]
 gb|AEN70788.1| adenylyl cyclase-associated protein [Gossypium harknessii]
Length=471

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>emb|CAN61863.1| hypothetical protein VITISV_043448 [Vitis vinifera]
Length=479

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAV RLE + T GF  G S E    AA  DP+IVAF+DL+++ V R+S+A
Sbjct  1    MDEKLIQRLESAVXRLEVV-TAGFRGGGSPETGAEAAL-DPAIVAFDDLMAEFVARVSAA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIGG+VL+ATKI+++AFS QKELL+K K  QKPD  G++EFLKPL+EVIM+ ++LTEG
Sbjct  59   AGKIGGKVLEATKILEEAFSVQKELLVKVKQSQKPDPAGMAEFLKPLHEVIMKANALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLK A DSLTALAWIAYTGKDCGMS+PIAHVEESWQMAEFYN
Sbjct  119  RRSDFFNHLKTAADSLTALAWIAYTGKDCGMSLPIAHVEESWQMAEFYN  167



>ref|NP_195175.1| cyclase associated protein 1 [Arabidopsis thaliana]
 sp|O65902.1|ACAP1_ARATH RecName: Full=Cyclase-associated protein 1; Short=AtCAP1; AltName: 
Full=Adenylyl cyclase-associated protein [Arabidopsis 
thaliana]
 emb|CAA18828.1| putative cyclase associated protein CAP [Arabidopsis thaliana]
 dbj|BAA28621.1| Atcap1 [Arabidopsis thaliana]
 emb|CAB80166.1| putative cyclase associated protein CAP [Arabidopsis thaliana]
 gb|ABJ17096.1| At4g34490 [Arabidopsis thaliana]
 gb|AEE86385.1| cyclase associated protein 1 [Arabidopsis thaliana]
Length=476

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 145/176 (82%), Gaps = 7/176 (4%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGH-GTSREVDVSAAA------SDPSIVAFEDLISQC  267
            M+E LI+RLE+AV RLE +S+ G G    SR  D S+AA      SDPSI+A+EDLISQC
Sbjct  1    MEEDLIKRLEAAVTRLEGISSNGGGVVSLSRGGDFSSAAGIDIASSDPSILAYEDLISQC  60

Query  268  VGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMR  447
            VGR  +AAEKIGG VLD TKIV +AF++QKELL++ K  QKPD+ GL+ FLKPLN+V M+
Sbjct  61   VGRALTAAEKIGGPVLDVTKIVAEAFASQKELLVRIKQTQKPDLAGLAGFLKPLNDVTMK  120

Query  448  GSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             +++TEG+RSDFFNHLKAA DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  ANAMTEGKRSDFFNHLKAACDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  176



>gb|ADZ16113.1| adenylyl cyclase associated protein [Gossypium barbadense]
 gb|AEN70778.1| adenylyl cyclase-associated protein [Gossypium darwinii]
 gb|AEN70780.1| adenylyl cyclase-associated protein [Gossypium tomentosum]
Length=445

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ +  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIEQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70792.1| adenylyl cyclase-associated protein [Gossypium gossypioides]
Length=471

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70771.1| adenylyl cyclase-associated protein [Gossypium thurberi]
Length=471

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLIEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70786.1| adenylyl cyclase-associated protein [Gossypium hirsutum subsp. 
latifolium]
Length=445

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+ VARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAVVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|ABU97498.1| adenylyl cyclase-associated protein [Gossypium arboreum]
 gb|ABU97499.1| adenylyl cyclase-associated protein [Gossypium arboreum]
 gb|KHG07838.1| Adenylyl cyclase-associated 1 [Gossypium arboreum]
Length=471

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISDRGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>emb|CDX69065.1| BnaC01g03880D [Brassica napus]
Length=480

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 146/179 (82%), Gaps = 10/179 (6%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGT-SREVDVSAA--------ASDPSIVAFEDLI  258
            MDE LI+RLE+AV RLE +S TGG G  T SR  D SAA        +SDPSI+A+EDLI
Sbjct  1    MDESLIKRLEAAVTRLEGISSTGGGGVTTLSRGGDFSAAGAGTDAAASSDPSILAYEDLI  60

Query  259  SQCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEV  438
            SQCVGR  SAAEKIGG VLD TKIV +AF+ QK+LL++ K  QKPDM GL+ FLKPLN+V
Sbjct  61   SQCVGRALSAAEKIGGPVLDVTKIVAEAFATQKDLLVRIKQAQKPDMAGLAGFLKPLNDV  120

Query  439  IMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             M+  ++T+GRRSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  TMKADAMTQGRRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  179



>ref|XP_011048631.1| PREDICTED: cyclase-associated protein 1-like [Populus euphratica]
Length=472

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 142/169 (84%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EKLI+RLESAVARLE LS G  G   S   D  +AA+DPSIVAF+D I    GR+SSA
Sbjct  1    MEEKLIERLESAVARLEALSLGSGGVAVSGGDD--SAATDPSIVAFDDFIGTFFGRVSSA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVL+ T+I+  A +AQKELLIK K  +KPD+ GL+EFLKPLNEVIM+ +S+TEG
Sbjct  59   AEKIGGQVLEVTRILGQALNAQKELLIKIKQTRKPDLAGLAEFLKPLNEVIMKANSMTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAA DSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  119  RRSDFFNHLKAAADSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYS  167



>gb|ADZ16114.1| adenylyl cyclase associated protein [Gossypium herbaceum subsp. 
africanum]
Length=471

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    +D    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISDRGLPDGID--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|ADZ16112.1| adenylyl cyclase associated protein [Gossypium barbadense]
 gb|AEN70777.1| adenylyl cyclase-associated protein [Gossypium darwinii]
 gb|AEN70779.1| adenylyl cyclase-associated protein [Gossypium tomentosum]
 gb|AEN70783.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
peruvianum]
Length=471

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPS++AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISDRGLPDGVD--EVSSDPSVLAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70781.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
brasiliense]
Length=471

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPS++AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISDRGLPDGVD--EVSSDPSVLAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70773.1| adenylyl cyclase-associated protein [Gossypium schwendimanii]
Length=471

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS  G    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSASGISARGLPDRVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>ref|XP_002867116.1| ATCAP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43375.1| ATCAP1 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGH--GTSREVDVSA------AASDPSIVAFEDLISQ  264
            M+E LI+RLE+AV RLE +S+ G G     SR  D S+      A+SDPSI+A+EDLISQ
Sbjct  1    MEEDLIKRLEAAVTRLEGISSYGGGGVVSLSRGGDFSSGAGTDVASSDPSILAYEDLISQ  60

Query  265  CVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIM  444
            CVGR  SAAEKIGG VLD TKIV +AF++QKELL++ K  QKPD+ GL+ FLKPLN+V M
Sbjct  61   CVGRALSAAEKIGGPVLDVTKIVAEAFASQKELLVRIKQTQKPDLAGLAGFLKPLNDVTM  120

Query  445  RGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            + +++TEG+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  KANAMTEGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  177



>ref|XP_009374180.1| PREDICTED: cyclase-associated protein 1 [Pyrus x bretschneideri]
Length=475

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+EKLIQRLESAV+RLE LS +GG G  T+R  +   A  DPSIVA+EDLI Q +GR+S+
Sbjct  1    MEEKLIQRLESAVSRLEALSLSGGGGSATARGFE--DAPLDPSIVAYEDLIGQYLGRVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+++ AFS QK LLI+ K  QKPD  GL+EFLKPLNE I + +SLTE
Sbjct  59   AAEKIGGQVLDITKVLQQAFSTQKGLLIQVKQTQKPDNAGLAEFLKPLNEAITKANSLTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            GRRSDFFNHLK A DSL+ALAWIAYTGK+CGMSMPI HVEESWQMAEFY
Sbjct  119  GRRSDFFNHLKTAADSLSALAWIAYTGKECGMSMPITHVEESWQMAEFY  167



>dbj|BAA36585.1| adenylyl cyclase associated protein [Gossypium hirsutum]
 gb|ADZ16116.1| adenylyl cyclase associated protein [Gossypium hirsutum]
 gb|AEN70785.1| adenylyl cyclase-associated protein [Gossypium hirsutum subsp. 
latifolium]
Length=471

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPS++AF+DL+ Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISDRGLPDGVD--EVSSDPSVLAFDDLMDQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70791.1| adenylyl cyclase-associated protein [Gossypium aridum]
Length=471

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD T +V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTNLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>ref|XP_007042208.1| Cyclase associated protein 1, 1,CAP1 [Theobroma cacao]
 gb|EOX98039.1| Cyclase associated protein 1, 1,CAP1 [Theobroma cacao]
Length=472

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+ KLI+RLE+AVARLE LS GG       +V V  A +DPSIVAF+DL++    R+S+A
Sbjct  1    MEGKLIERLEAAVARLEALSAGGVSARDLPDVGVEVA-TDPSIVAFDDLMANYAARVSAA  59

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVLD TKI+ +A S QK+LLI+ K  QKPDM GL+EFLKPLNE IM+ +++TEG
Sbjct  60   AEKIGGQVLDVTKILVEALSVQKKLLIEIKHAQKPDMAGLAEFLKPLNEAIMKANAMTEG  119

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  120  RRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AEN70794.1| adenylyl cyclase-associated protein [Gossypium trilobum]
Length=471

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPL+EVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLDEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|EYU37793.1| hypothetical protein MIMGU_mgv1a005340mg [Erythranthe guttata]
Length=488

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+E L++RLE AVARLE LS GG   G S E    AAA DPSI+AF+DLISQCV R+++A
Sbjct  1    MEENLVKRLEVAVARLEALSAGG-SRGFSPEDGGDAAAVDPSILAFDDLISQCVNRVTTA  59

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
             EKIGG+VLD +K++ DAF+ QKELL+K K  QKPD  G+ EFLKPLNEV+ + S+LTEG
Sbjct  60   GEKIGGRVLDVSKVIADAFAVQKELLVKIKQTQKPDNAGMMEFLKPLNEVMTKASALTEG  119

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            RR DFF+HLK   DSL ALAWIAYTGKDCGMSMPIAHVEESWQMAEFY
Sbjct  120  RRPDFFHHLKTGADSLAALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  167



>ref|XP_002306100.1| cyclase associated protein 1 [Populus trichocarpa]
 gb|EEE86611.1| cyclase associated protein 1 [Populus trichocarpa]
Length=466

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 140/170 (82%), Gaps = 4/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+E+L+ RLESAVARLE LS  GG   G+  +    A+A+DPSIVAFED +   +GR+SS
Sbjct  1    MEERLMARLESAVARLEALSLRGGSVAGSGGD---DASATDPSIVAFEDFMGAYLGRVSS  57

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            A EKIGGQVL  TKI++ A + QKELLIK K  QKPD+ GL+EFLKPLNEVIM+ +S+TE
Sbjct  58   AGEKIGGQVLAVTKILEQALNMQKELLIKIKQTQKPDLAGLAEFLKPLNEVIMKANSMTE  117

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLKAA DS TALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  118  GRRSDFFNHLKAAADSSTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  167



>ref|XP_003606897.1| Adenylyl cyclase-associated protein [Medicago truncatula]
 gb|AES89094.1| adenylyl cyclase-associated protein [Medicago truncatula]
Length=472

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDE LI+RLESAV RLE LSTG   H +S   D S AASDPS+VAF DLI Q V RLS A
Sbjct  1    MDETLIKRLESAVTRLEALSTGI--HHSSSASDASDAASDPSVVAFVDLIDQYVSRLSKA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A+ IGGQVLD T  VK+AFS QKELLIK K  QKPD  GL+EFLKPLNEVIM+ SSLTEG
Sbjct  59   ADIIGGQVLDVTNRVKEAFSVQKELLIKLKQTQKPDPAGLAEFLKPLNEVIMKASSLTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAA DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  119  RRSDFFNHLKAAVDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYS  167



>ref|XP_008377316.1| PREDICTED: cyclase-associated protein 1-like [Malus domestica]
Length=476

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+EKLIQRLESAV+RLE LS +GG G  T+R      A  DPSIVA+EDLI Q +GR+S+
Sbjct  1    MEEKLIQRLESAVSRLEALSLSGGGGSATAR--GFQDAPLDPSIVAYEDLIGQYLGRVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+++ AFS QK+LLI+ K  QKPD  GL+EFLKPLNE I + +SLTE
Sbjct  59   AAEKIGGQVLDITKVLQQAFSTQKDLLIQVKQTQKPDNAGLAEFLKPLNEAITKANSLTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            GRRSDFFNH K A DSL+ALAW AYTGK+CGMSMPIAHVEESWQMAEFY
Sbjct  119  GRRSDFFNHSKTAADSLSALAWTAYTGKECGMSMPIAHVEESWQMAEFY  167



>ref|XP_009108728.1| PREDICTED: cyclase-associated protein 1-like [Brassica rapa]
Length=476

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 144/174 (83%), Gaps = 8/174 (5%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVS-----AAASDPSIVAFEDLISQCVG  273
            M+E LI+RLE+AV RLE    GG G   SR  D S     AAASDPSI+A++DLISQCVG
Sbjct  1    MEESLIKRLEAAVTRLEG---GGGGVTLSRGGDFSSGANVAAASDPSILAYDDLISQCVG  57

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
            R+ +AAEKIGG VLD TKIV +AF+AQKELL++ K  QKPDM GL+ FLKPLN+V M+  
Sbjct  58   RIITAAEKIGGPVLDVTKIVAEAFAAQKELLVRIKQTQKPDMAGLAGFLKPLNDVTMKAD  117

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            ++T+G+R+D+FNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  118  AMTQGKRNDYFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYS  171



>gb|AEN70775.1| adenylyl cyclase-associated protein [Gossypium mustelinum]
Length=471

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPS++AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISDRGLPDGVD--EVSSDPSVLAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AFS QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++ E
Sbjct  59   AAEKIGGQVLDVTKLVLEAFSVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMME  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|AFK47086.1| unknown [Lotus japonicus]
Length=469

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EKLI RLESAVARLE LS G    G     DV+ AA+DPSI+AF+DL+ Q V R+S+A
Sbjct  1    MEEKLIGRLESAVARLEALSVGF--QGGGGGGDVADAATDPSIIAFDDLMGQYVARVSAA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGG VL+ TK+V++AF+ QK+LLIK K  QKP+  GL+EFLKPLN+VI + S++TEG
Sbjct  59   AEKIGGPVLEVTKVVQEAFAVQKQLLIKVKQSQKPNNAGLAEFLKPLNDVITKSSAMTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            RRSDFFNHLKAA DSLTALAWIA+TGKDCGMSMPIAHVEESWQM+EFY
Sbjct  119  RRSDFFNHLKAAADSLTALAWIAFTGKDCGMSMPIAHVEESWQMSEFY  166



>gb|AEN70793.1| adenylyl cyclase-associated protein [Gossypium lobatum]
Length=471

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+AF+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISARGLPDGVD--EVSSDPSILAFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD T +V +AFS QK+LLI+ K  QKPD+ GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTNLVLEAFSVQKKLLIEIKQTQKPDVAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>gb|ABU97500.1| adenylyl cyclase-associated protein [Gossypium arboreum]
Length=471

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+ KLI+RLE+AVARLE+LS GG    G    VD    +SDPSI+ F+DL++Q   R+S+
Sbjct  1    MEAKLIERLEAAVARLESLSAGGISDRGLPDGVD--EVSSDPSILTFDDLMAQYAARVSA  58

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQVLD TK+V +AF  QK+LLI+ K  QKPDM GL EFLKPLNEVI++ +++TE
Sbjct  59   AAEKIGGQVLDVTKLVLEAFPVQKKLLIEIKQTQKPDMAGLVEFLKPLNEVILKVNAMTE  118

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  GRRSDFFNHLKSAGDSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  168



>ref|XP_002313050.2| cyclase associated protein 1 [Populus trichocarpa]
 gb|EEE87005.2| cyclase associated protein 1 [Populus trichocarpa]
Length=468

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EKLI+RLESAVARLE LS    G   S   D  +AA+DPSIVAF+D I     R+SSA
Sbjct  1    MEEKLIERLESAVARLEALSLRSGGVALSGGDD--SAATDPSIVAFDDFIGTFFVRVSSA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVL+ T+I++ A + QKELLIK K  +KPD+ GL+EFLKPLNEVIM+ +++TEG
Sbjct  59   AEKIGGQVLEVTRILEQALNVQKELLIKIKQTRKPDLAGLAEFLKPLNEVIMKANAMTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAA DSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  119  RRSDFFNHLKAAADSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYS  167



>ref|XP_006286091.1| hypothetical protein CARUB_v10007634mg [Capsella rubella]
 gb|EOA18989.1| hypothetical protein CARUB_v10007634mg [Capsella rubella]
Length=475

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 142/177 (80%), Gaps = 10/177 (6%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTG--------GFGHGTSREVDVSAAASDPSIVAFEDLISQ  264
            M+E LI+RLE+AV RLE +S+             G     DV  A+SDPSI+A+EDLISQ
Sbjct  1    MEEDLIKRLEAAVTRLEGISSNGGGGGGVVSLSRGGDFSTDV--ASSDPSILAYEDLISQ  58

Query  265  CVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIM  444
            CVGR  SAAEKIGG VLD TK+V +AF++QKELL++ K  QKPD+ GL+ FLKPLN+V M
Sbjct  59   CVGRALSAAEKIGGPVLDVTKVVAEAFASQKELLVRIKQTQKPDLAGLAGFLKPLNDVTM  118

Query  445  RGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            + +++TEG+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  KANAMTEGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  175



>ref|XP_010254869.1| PREDICTED: cyclase-associated protein 1-like [Nelumbo nucifera]
Length=475

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EKLIQRLESAVARLE LS G F  G+S E D + A  DP+IVA++D +++ +GR+S+A
Sbjct  1    MEEKLIQRLESAVARLEALSLG-FRPGSSSE-DGADAPVDPAIVAYDDFVAKFLGRVSAA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIGG+VL+ +KI+++AFS QKE L+K K  QKPD+ G++EFLKPLNEVIM+ ++LTEG
Sbjct  59   ATKIGGKVLEISKILEEAFSVQKEFLVKAKQCQKPDIGGMAEFLKPLNEVIMKANALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNH KA  DSLTALAWIAY GKDCGMS+PI HVEESWQMAEFYN
Sbjct  119  RRSDFFNHFKAVADSLTALAWIAYLGKDCGMSLPITHVEESWQMAEFYN  167



>gb|KFK30061.1| hypothetical protein AALP_AA7G211700 [Arabis alpina]
Length=475

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 144/174 (83%), Gaps = 5/174 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGT--SRE---VDVSAAASDPSIVAFEDLISQCVG  273
            M+E LI+RLE+AV RLE +ST G G G   SR     DV+A A+DPSI+A+EDLISQCVG
Sbjct  1    MEEDLIKRLEAAVTRLEGISTNGGGGGVILSRGGDFSDVAAVATDPSILAYEDLISQCVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
            R+ +AAEKIGG VLD TKIV +AF+ QKELL+K K  QKPDM GLS FLKPL++V M+  
Sbjct  61   RVLNAAEKIGGPVLDVTKIVAEAFATQKELLVKIKQTQKPDMVGLSGFLKPLSDVTMKAD  120

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             +T G+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  KMTGGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  174



>ref|XP_004299093.1| PREDICTED: cyclase-associated protein 1 [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 138/169 (82%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EKLIQRLESAV RLE LS   F  G++       A  DPS++AF+DLI Q V R+S A
Sbjct  1    MEEKLIQRLESAVTRLEALS---FSGGSAAAASGDDAPLDPSVLAFQDLIGQYVARVSRA  57

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVLD TKIV++AF+AQK+L+IK K  +KPD  GL EFLKPLNEVI + + LTEG
Sbjct  58   AEKIGGQVLDITKIVEEAFAAQKDLIIKVKQHKKPDNAGLVEFLKPLNEVITKANKLTEG  117

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLK+A DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  118  RRSDFFNHLKSAADSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  166



>ref|XP_011037533.1| PREDICTED: cyclase-associated protein 1-like [Populus euphratica]
Length=466

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 140/170 (82%), Gaps = 4/170 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+E+L+ RLESAVARLE +S  GG   G+  +    A+A+DPSIVAFED +    GR+SS
Sbjct  1    MEERLMARLESAVARLEAISLRGGSVAGSGGD---DASATDPSIVAFEDFMGTYFGRVSS  57

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            A EKIGGQVL+ TKI++ A + QKELLIK K  QKPD+ GL+EFLKPLNEVI++ +S+TE
Sbjct  58   AGEKIGGQVLEVTKILEQALNMQKELLIKIKQSQKPDLAGLAEFLKPLNEVILKANSMTE  117

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLKAA DS TALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  118  GRRSDFFNHLKAAADSSTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  167



>ref|XP_010447072.1| PREDICTED: cyclase-associated protein 1 isoform X2 [Camelina 
sativa]
Length=475

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 143/174 (82%), Gaps = 6/174 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFG-----HGTSREVDVSAAASDPSIVAFEDLISQCVG  273
            M+E LI+RLE+AV RLE +S+ G G      G    +D   A+SDPSI+A++DLISQCVG
Sbjct  1    MEEDLIKRLEAAVTRLEGISSNGGGVVSVSRGGDFSIDDDVASSDPSILAYDDLISQCVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
            R  +AAEKIGG VLD TK+V +AF++QKELL++ K  Q PD+ GL+ FLKPLN+V M+ +
Sbjct  61   RALTAAEKIGGVVLDVTKVVAEAFASQKELLVRIKQTQ-PDLAGLAGFLKPLNDVTMKAN  119

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            ++TEG+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  120  AMTEGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  173



>ref|XP_011092784.1| PREDICTED: cyclase-associated protein 1-like [Sesamum indicum]
Length=467

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 133/174 (76%), Gaps = 10/174 (6%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASD-----PSIVAFEDLISQCVG  273
            MDE LI RLESAV RLE +S GGF     R+V V+ AA D     PSIVAF DLISQCV 
Sbjct  1    MDENLITRLESAVTRLEAMSAGGF-----RQVGVADAAGDASTMDPSIVAFGDLISQCVN  55

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
            R+ SAAEKIGG VLD +KI++ AF  QKELL+K K  QKPDM GL EFLKPLNEV    S
Sbjct  56   RVVSAAEKIGGHVLDISKIIEKAFRVQKELLVKIKHTQKPDMAGLVEFLKPLNEVTAEAS  115

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            +LTEG+RSDFF+HLK   DSL+ALAWIAYTGK+CGMSMP AHVEESW  AEFY+
Sbjct  116  ALTEGKRSDFFHHLKTGADSLSALAWIAYTGKNCGMSMPTAHVEESWHTAEFYS  169



>gb|EYU42620.1| hypothetical protein MIMGU_mgv1a021022mg [Erythranthe guttata]
Length=456

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MD  LI RLESAV RLE LS GGF H  + EV   A A+DPSIVAF+DLISQ V  ++ A
Sbjct  1    MDGSLITRLESAVTRLEALSAGGFLHVGAAEVSRDAGAADPSIVAFDDLISQHVNGVTIA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQV D +KI+++AF  Q++LL+K K  QKPDM GL EFLKPLNEVI + S+L EG
Sbjct  61   AEKIGGQVFDVSKIIEEAFIVQRDLLVKIKQTQKPDMAGLGEFLKPLNEVITKASALAEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            RRSDFF+HLK A DSL+AL WIA+TGK+CGM+MPI+HVEESWQ AEFY
Sbjct  121  RRSDFFHHLKTAADSLSALVWIAFTGKNCGMNMPISHVEESWQTAEFY  168



>ref|XP_004148849.1| PREDICTED: cyclase-associated protein 1-like [Cucumis sativus]
 gb|KGN61790.1| hypothetical protein Csa_2G246530 [Cucumis sativus]
Length=478

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAVARLE LSTG F  G + E       +DPSI+AF+DL+ Q   R+ SA
Sbjct  1    MDEKLIQRLESAVARLEALSTG-FRPGGAPESG-EDVVTDPSILAFDDLMGQYFARVLSA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVL+ATKI+K+AFS Q+ELL+K K  QKPD+ GL+EFLKPLNEVIM+ ++LTEG
Sbjct  59   AEKIGGQVLEATKILKEAFSVQRELLVKVKQTQKPDLAGLAEFLKPLNEVIMKANALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAA DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  RRSDFFNHLKAAADSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  167



>ref|XP_003537875.1| PREDICTED: cyclase-associated protein 1-like [Glycine max]
Length=469

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGT-SREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            MDEKLIQRLESAV+RLE+LS G     T S   D   AA DPSIVAF DLI Q VGR+S 
Sbjct  1    MDEKLIQRLESAVSRLESLSAGFHPSATQSGGADAPDAALDPSIVAFADLIDQYVGRVSG  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAE IGGQVLD TK+V++AF+ QKELLIK +  QKP++ GLSEFLKPLNEVI + + LTE
Sbjct  61   AAEVIGGQVLDVTKLVQEAFNVQKELLIKLRQTQKPNLAGLSEFLKPLNEVITKATKLTE  120

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLKAA DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  121  GRRSDFFNHLKAAADSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYS  170



>emb|CDX76285.1| BnaA08g11150D [Brassica napus]
Length=466

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 9/175 (5%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVS-----AAASDPSIVAFEDLISQCVG  273
            M+E LI+RLE+A+ RLE    GG G   SR  D S     AAASDPSI+A++DLISQCVG
Sbjct  1    MEESLIKRLEAALTRLEG---GGGGVTLSRGGDFSSGANVAAASDPSILAYDDLISQCVG  57

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQ-KPDMKGLSEFLKPLNEVIMRG  450
            R+ +AAEKIGG VLD TKIV +AF+AQKELL++ K  Q KPDM GL+ FLKPLN+V M+ 
Sbjct  58   RILTAAEKIGGPVLDVTKIVAEAFAAQKELLVRIKQTQQKPDMAGLAGFLKPLNDVTMKA  117

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             ++T+G+R+D+FNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  118  DAMTQGKRNDYFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYS  172



>ref|XP_010548053.1| PREDICTED: cyclase-associated protein 1 [Tarenaya hassleriana]
Length=478

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 5/174 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSR-----EVDVSAAASDPSIVAFEDLISQCVG  273
            M E LI+RLE+AV RLE +S    G G        +     A+SDPSI+AFEDLIS+ V 
Sbjct  1    MAEDLIKRLEAAVTRLEVVSRNAGGGGGVSLSGGGDAVADVASSDPSILAFEDLISERVV  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
            R+ SAAEKIGGQVLD +KIV +AFSAQKELL++ K  QKPD+ GL+EFLKPLNEVIM+ +
Sbjct  61   RILSAAEKIGGQVLDGSKIVAEAFSAQKELLVRIKQTQKPDLAGLAEFLKPLNEVIMKAN  120

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            ++TEG+RSD FNHLKAA DSLTALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  AMTEGKRSDSFNHLKAACDSLTALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  174



>ref|XP_009804915.1| PREDICTED: cyclase-associated protein 1 [Nicotiana sylvestris]
Length=475

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            + M+EKLIQRLESAV RLE LS+ GF  G S     +  A DPSI+AF+DL S+ +G+++
Sbjct  1    MSMEEKLIQRLESAVTRLEALSSTGFRSGGSVGTGNATVALDPSIIAFDDLRSEFLGKVT  60

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
            SAAEKIGG+VLD TK+V+ AFSAQ+ELLIK K  +KPD  GL EFLKPLN+ I++ + +T
Sbjct  61   SAAEKIGGKVLDITKMVEKAFSAQRELLIKIKETKKPDNSGLVEFLKPLNDAIVKATRMT  120

Query  463  EGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            EG R DFFNHLK+A DSL+ALAWIAYTGKDCG+SMPIAHVEESWQMAEFYN
Sbjct  121  EG-RPDFFNHLKSAADSLSALAWIAYTGKDCGLSMPIAHVEESWQMAEFYN  170



>ref|XP_008457926.1| PREDICTED: cyclase-associated protein 1-like [Cucumis melo]
Length=478

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDEKLIQRLESAVARLE LSTG F  G + E       +DPSI+AF+DL+ Q   R+ SA
Sbjct  1    MDEKLIQRLESAVARLEALSTG-FRPGGAPESG-EDVVTDPSILAFDDLMGQYFARVLSA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGGQVL+ TKI+K+AFS Q+ELL+K K  QKPD+ GL+EFLKPLNEVIM+ ++LTEG
Sbjct  59   AEKIGGQVLEVTKILKEAFSVQRELLVKVKQTQKPDLAGLAEFLKPLNEVIMKANALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLKAA DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  119  RRSDFFNHLKAAADSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  167



>ref|XP_010263686.1| PREDICTED: cyclase-associated protein 1-like [Nelumbo nucifera]
Length=470

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EK+IQRLES VARLE LS G F   +S EV V A   DP I+A++DL++  +GR+S+A
Sbjct  1    MEEKMIQRLESVVARLEELSVG-FRPVSSSEVGVDARM-DPIILAYDDLMANFLGRVSAA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AE IGG+VL+ TK+V++AFS QKELL+K K  QKPD+ GL+EFLKPLNEVIM+ ++LTEG
Sbjct  59   AENIGGKVLEVTKVVEEAFSVQKELLVKAKQCQKPDIAGLAEFLKPLNEVIMKANALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             R DFFNHLK A DSLTALAWIAY+GKDCGMS+PIAHVEESWQMAEFYN
Sbjct  119  -RPDFFNHLKTAADSLTALAWIAYSGKDCGMSLPIAHVEESWQMAEFYN  166



>emb|CDY46244.1| BnaC03g66050D [Brassica napus]
Length=466

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 9/175 (5%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLS-TGGFGHGTSREVDVSA----AASDPSIVAFEDLISQCVG  273
            M+E LI+RLE+AV RLE LS TGG G   SR  D S+    AA DPSI+A++DLISQCVG
Sbjct  1    MEESLIKRLEAAVTRLEGLSSTGGGGVTLSRGGDFSSGGNVAAYDPSILAYDDLISQCVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQ-KPDMKGLSEFLKPLNEVIMRG  450
            R+ +AAEKIGG VLD TKIV +AF+AQKELLI+ K  Q KPDM G   FLKPLN+V M+ 
Sbjct  61   RILTAAEKIGGPVLDVTKIVAEAFAAQKELLIRIKQTQQKPDMAG---FLKPLNDVTMKA  117

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             ++T+GRR+D+FNHLKA +DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  118  DAMTQGRRNDYFNHLKATSDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYS  172



>ref|XP_010437609.1| PREDICTED: cyclase-associated protein 1-like [Camelina sativa]
Length=478

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 144/176 (82%), Gaps = 7/176 (4%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSR-------EVDVSAAASDPSIVAFEDLISQC  267
            M+E LI+RLE+AV RLE +S+ G G G           +D   A+SDPSI+A++DLISQC
Sbjct  1    MEEDLIKRLEAAVTRLEGISSNGGGGGVVSVSRGGDFSIDDDVASSDPSILAYDDLISQC  60

Query  268  VGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMR  447
            VGR  +A+EKIGG VLD TKIV +AF++QKELL++ K  QKPD+ GL+ FLKPLN+V M+
Sbjct  61   VGRALTASEKIGGVVLDVTKIVAEAFASQKELLVRIKQTQKPDLAGLAGFLKPLNDVTMK  120

Query  448  GSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             +++TEG+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  ANAMTEGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  176



>ref|XP_010432407.1| PREDICTED: cyclase-associated protein 1-like [Camelina sativa]
Length=478

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 143/176 (81%), Gaps = 7/176 (4%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSR-------EVDVSAAASDPSIVAFEDLISQC  267
            M+E LI+RLE+AV RLE +S+ G G G           +D   A+SDPSI+A++DLISQC
Sbjct  1    MEEDLIKRLEAAVTRLEGISSNGGGGGVVSVSRGGDFSIDGDVASSDPSILAYDDLISQC  60

Query  268  VGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMR  447
            VGR  SAAEKIGG V D TKIV +AF++QKELL++ K  QKPD+ GL+ FLKPLN+V M+
Sbjct  61   VGRALSAAEKIGGVVHDVTKIVAEAFASQKELLVRIKQTQKPDLAGLAGFLKPLNDVTMK  120

Query  448  GSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             +++TEG+RSDFFNHLKAA+DSL+ALAWIA+TGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  ANAMTEGKRSDFFNHLKAASDSLSALAWIAFTGKDCGMSMPIAHVEESWQMAEFYN  176



>ref|XP_009605961.1| PREDICTED: cyclase-associated protein 1 [Nicotiana tomentosiformis]
Length=475

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            + M+EKLIQRLESAV RLE LS  GF  G S          DPSI+AF+DL S+ +G+++
Sbjct  1    MSMEEKLIQRLESAVTRLEALSATGFHSGGSVGTGDDTVVLDPSIIAFDDLRSEFLGKVT  60

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
            SAAEKIGG+VLD TKIV+ AFS Q+ELLIK K  +KPD  GL EFLKPLN+ I++ + +T
Sbjct  61   SAAEKIGGKVLDITKIVEKAFSVQRELLIKIKETKKPDNSGLVEFLKPLNDAIVKATRMT  120

Query  463  EGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            EG R DFFNHLK+A DSL+ALAWIAYTGKDCG+SMPIAHVEE WQMAEFYN
Sbjct  121  EG-RPDFFNHLKSAADSLSALAWIAYTGKDCGLSMPIAHVEEGWQMAEFYN  170



>ref|XP_004150414.1| PREDICTED: cyclase-associated protein 1-like [Cucumis sativus]
 gb|KGN44349.1| hypothetical protein Csa_7G267970 [Cucumis sativus]
Length=474

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 142/172 (83%), Gaps = 6/172 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSA---AASDPSIVAFEDLISQCVGRL  279
            M+EKLIQRLESAV+RLE+LS  GF   ++R + +S+   AASDP I+AFEDL+   V ++
Sbjct  1    MEEKLIQRLESAVSRLESLSPAGF---STRGISLSSDDNAASDPPILAFEDLMRNYVRKV  57

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
            S AAEKIGG VL+AT+IV++AFS +K+L++  K  QKPD+ GL+ FLKPLNEVI++ ++L
Sbjct  58   SDAAEKIGGPVLEATRIVEEAFSVEKQLIVNVKQTQKPDLAGLAGFLKPLNEVILKANAL  117

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            T G+RS+FFNHLK   D+L+ALAWIAYTGKDCGMSMPIAHVEESWQ AEFY+
Sbjct  118  TAGKRSEFFNHLKTVADALSALAWIAYTGKDCGMSMPIAHVEESWQTAEFYS  169



>ref|XP_006365096.1| PREDICTED: adenylyl cyclase-associated protein-like [Solanum 
tuberosum]
Length=472

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 4/171 (2%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            + M+EKL+QRLESAV RLE LS  G   GT        A  DPSI+AF+DL SQ +G++S
Sbjct  1    MPMEEKLVQRLESAVMRLEALSATGGSVGTGD----GTAVLDPSIIAFDDLRSQFLGKVS  56

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
            SAAEKIGG VLD TKIV+ AF+AQ+ELLIK K  +KPD   L+EFLKPLN+VI++ + +T
Sbjct  57   SAAEKIGGHVLDITKIVEAAFAAQRELLIKIKETKKPDNSSLAEFLKPLNDVIVKATKMT  116

Query  463  EGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            EGRRSD+FN LK+A DSL+ALAWIAYTGKDCGM+MPIA+VEESWQMAEFY+
Sbjct  117  EGRRSDYFNQLKSAADSLSALAWIAYTGKDCGMTMPIAYVEESWQMAEFYS  167



>ref|XP_003541049.1| PREDICTED: cyclase-associated protein 1-like [Glycine max]
Length=469

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGT-SREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            MDEKLIQRLESAV RLE+LS+G     + S       AA DPS+VAF DLI Q VGR+S 
Sbjct  1    MDEKLIQRLESAVLRLESLSSGLHPSASQSGGAHAPDAALDPSVVAFADLIDQYVGRVSG  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAE IGGQVL  TK+V++AF+ QKELLIK K  QKP++ GLSEFLKPLNEVI + + LTE
Sbjct  61   AAEVIGGQVLGVTKLVQEAFNVQKELLIKLKQTQKPNLAGLSEFLKPLNEVITKATKLTE  120

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLKAA DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  121  GRRSDFFNHLKAAADSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYS  170



>ref|XP_007200993.1| hypothetical protein PRUPE_ppa005136mg [Prunus persica]
 gb|EMJ02192.1| hypothetical protein PRUPE_ppa005136mg [Prunus persica]
Length=475

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+EKLIQRLESAVARLE+LS  G     S          DPSI+A+EDLI Q +GR+S+A
Sbjct  1    MEEKLIQRLESAVARLESLSLSG--GAASAAASGDDGPLDPSILAYEDLIRQYLGRVSAA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            AEKIGG VLD TK+++ AF+ QK+LLI+ K  +KPD  GL+EFLKPL+EVI + ++LTEG
Sbjct  59   AEKIGGPVLDVTKVLQQAFAVQKDLLIQVKQTKKPDNAGLAEFLKPLHEVITKANALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSDFFNHLK+A DSL+ALAWIAYTGK+CGMSMPIAHVEESWQMAEFYN
Sbjct  119  RRSDFFNHLKSAVDSLSALAWIAYTGKECGMSMPIAHVEESWQMAEFYN  167



>ref|XP_004230883.1| PREDICTED: cyclase-associated protein 1 [Solanum lycopersicum]
 ref|XP_010315302.1| PREDICTED: cyclase-associated protein 1 [Solanum lycopersicum]
Length=472

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 137/171 (80%), Gaps = 4/171 (2%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            + M+EKL+QRLESAV RLE LS GG   GT        A  DPSI+AF+DL SQ +G++ 
Sbjct  1    MPMEEKLVQRLESAVMRLEALSAGGSSVGTGD----GTAVLDPSIIAFDDLRSQFLGKVL  56

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
             AAEKIGG VLD TKIV+ AF+AQ+ELLIK K  +KPD  GL+EFLKPLN+VI++ + +T
Sbjct  57   RAAEKIGGHVLDITKIVEAAFAAQRELLIKIKETKKPDNSGLTEFLKPLNDVIVKATKMT  116

Query  463  EGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            EGRRSD+FN LK+A DSL+ALAWIAYTGKDCGMSM IA+VE+SWQMAEFY+
Sbjct  117  EGRRSDYFNQLKSAADSLSALAWIAYTGKDCGMSMQIAYVEDSWQMAEFYS  167



>gb|KHN25370.1| Adenylyl cyclase-associated protein [Glycine soja]
Length=474

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 140/175 (80%), Gaps = 6/175 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGF------GHGTSREVDVSAAASDPSIVAFEDLISQCV  270
            MDEKLIQRLESAV RLE+LS+G        G   +   D   AA DPSIVAF DLI Q V
Sbjct  1    MDEKLIQRLESAVLRLESLSSGLHPSASQSGGAHAPGADAPDAALDPSIVAFADLIDQYV  60

Query  271  GRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRG  450
            GR+S AAE IGGQVL  TK+V++AF+ QKELLIK K  QKP++ GLSEFLKPLNEVI + 
Sbjct  61   GRVSGAAEVIGGQVLGVTKLVQEAFNVQKELLIKLKQTQKPNLAGLSEFLKPLNEVITKA  120

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            + LTEGRRSDFFNHLKAA DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  121  TKLTEGRRSDFFNHLKAAADSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYS  175



>ref|XP_008447035.1| PREDICTED: cyclase-associated protein 1 [Cucumis melo]
Length=474

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 139/172 (81%), Gaps = 6/172 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSA---AASDPSIVAFEDLISQCVGRL  279
            M+EKLIQRLESAV RLE LS  GF   ++R + +S    AAS+P I+AFEDL+   V ++
Sbjct  1    MEEKLIQRLESAVCRLEALSPAGF---STRGISLSNDDNAASEPPILAFEDLMRNYVRKV  57

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
            S AAEKIGG VL+AT+IV++AFS +K+LL+  K  QKPD+ GL+ FLKPLNEVI++ ++L
Sbjct  58   SDAAEKIGGPVLEATRIVEEAFSVEKQLLVDVKQTQKPDLAGLAGFLKPLNEVILKANTL  117

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            T G+RS+FFNHLK   D+L+ALAWIAYTGK+CGMSMPIAHVEESWQ AEFY+
Sbjct  118  TAGKRSEFFNHLKTVADALSALAWIAYTGKECGMSMPIAHVEESWQTAEFYS  169



>ref|XP_010107846.1| Adenylyl cyclase-associated protein 2 [Morus notabilis]
 gb|EXC17246.1| Adenylyl cyclase-associated protein 2 [Morus notabilis]
Length=627

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVD-VSAAASDPSIVAFEDLISQCVGRLSS  285
            M+EKLIQRLESAVARLE LS GGF  G S E    +AA  D SI+AF+DL  Q + R+S+
Sbjct  1    MEEKLIQRLESAVARLEALSAGGFRAGGSSESGGDNAAPVDHSILAFDDLTGQYLSRVSA  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGGQV + TKI++DAF+  +ELL+K K  QKPD+ GL+EFLKPLNEVI + ++LTE
Sbjct  61   AAEKIGGQVSEVTKILQDAFAVLRELLVKVKQTQKPDLAGLAEFLKPLNEVITKANALTE  120

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSD FNHLKAA DSL+ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  GRRSDIFNHLKAAADSLSALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  170



>ref|XP_010028583.1| PREDICTED: LOW QUALITY PROTEIN: cyclase-associated protein 1 
[Eucalyptus grandis]
Length=477

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTG-GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+EKL+QR E+AVARLE +S   G       +   + AA+DP+I+AF+DL++Q V R+SS
Sbjct  1    MEEKLVQRXEAAVARLEAVSAARGVPAAAGDDGGDALAATDPAILAFDDLMAQYVARVSS  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAEKIGG+VLD TK+V +AFSAQKELLI+ K  QKPD+ GL EFLKPLNEVIM+ ++LTE
Sbjct  61   AAEKIGGRVLDVTKVVGEAFSAQKELLIQIKQTQKPDLAGLGEFLKPLNEVIMKANALTE  120

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLKAA DSL ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  GRRSDFFNHLKAAADSLAALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  170



>ref|XP_009396021.1| PREDICTED: cyclase-associated protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M++ L+ RLESAVARLETL+  G     S       +A DP+I AFEDL++  +GR+S++
Sbjct  1    MEQALLTRLESAVARLETLAASGSAPLVSSRDLPDPSALDPAISAFEDLVADSLGRVSAS  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIGGQVLDATKI+++AF+A +ELL+K K  QKPD+ GL+ FLKPLN V+++ +SLTEG
Sbjct  61   AGKIGGQVLDATKILEEAFAALRELLVKAKRSQKPDLAGLAAFLKPLNNVMVKANSLTEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            +RSD+FNHLK   DSLTALAWI Y+GK+CGMSMPIAHVEESWQMAEFY
Sbjct  121  KRSDYFNHLKTVADSLTALAWIGYSGKNCGMSMPIAHVEESWQMAEFY  168



>ref|XP_010936278.1| PREDICTED: cyclase-associated protein 1 [Elaeis guineensis]
Length=476

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+++L+ RLE+AVARLE L+  G     +      AAA DP+I+A +DL+S  + R+S+A
Sbjct  1    MEKELLGRLEAAVARLEALAAVGSRSAVASIDLAEAAAIDPAILAIDDLMSGSLARVSTA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIGGQVL+ TKIV++AF  Q++LL+K K  QKPD+ GL EFLKPLNEVI + S+LTEG
Sbjct  61   AGKIGGQVLEVTKIVEEAFVVQRDLLVKAKQCQKPDIMGLQEFLKPLNEVIHKASALTEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRSD+FNHLKAA DSLTALAWIAY+GKDCGMS+P AH+EE WQMAEFYN
Sbjct  121  RRSDYFNHLKAAADSLTALAWIAYSGKDCGMSLPTAHIEECWQMAEFYN  169



>ref|XP_010690892.1| PREDICTED: cyclase-associated protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=470

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 138/171 (81%), Gaps = 8/171 (5%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSA--AASDPSIVAFEDLISQCVGRLS  282
            M+ +L++RLE AV+RLE +S+      +SR V+     AA DPSIVAF+DLI+  VGR+S
Sbjct  1    MEAQLVERLEKAVSRLEAISS------SSRSVEFCGDDAALDPSIVAFDDLIANSVGRVS  54

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
            +AAEKIG +VL+AT I+  AFSA ++LL+K K  QKPDM G+SEFLKPLNEV  + ++LT
Sbjct  55   AAAEKIGDEVLEATVILCVAFSALRDLLVKVKQTQKPDMAGMSEFLKPLNEVFTKANALT  114

Query  463  EGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            EG+RSDFFNH K+ +DSL ALAWIAYTGKDCGMSMPIAHVEESWQMAEFY+
Sbjct  115  EGKRSDFFNHQKSISDSLAALAWIAYTGKDCGMSMPIAHVEESWQMAEFYS  165



>ref|XP_010939270.1| PREDICTED: cyclase-associated protein 1-like [Elaeis guineensis]
Length=477

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAA-ASDPSIVAFEDLISQCVGRLSS  285
            M+++L++RLE+AVA LE L+           +D+  A A DP+I AF+DL+S  + R+S+
Sbjct  1    MEKELVERLETAVANLEVLA-AARSRSAVPSIDLDGAVALDPAISAFDDLMSGSLARVSA  59

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AA KIGG+VL+ATKIV++AF+ QK+LL+K K  QKPD+ GL EFLKPLNEVI++ S+LTE
Sbjct  60   AAGKIGGKVLEATKIVEEAFTVQKDLLVKAKQCQKPDIAGLQEFLKPLNEVILKASALTE  119

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GR+SD+FNHLKA  DSLTALAWIAY GKDCGMS+P+AHVEESWQMAEFYN
Sbjct  120  GRQSDYFNHLKAVADSLTALAWIAYLGKDCGMSLPVAHVEESWQMAEFYN  169



>ref|XP_007131840.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
 ref|XP_007131841.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
 gb|ESW03834.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
 gb|ESW03835.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
Length=472

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAAS-DPSIVAFEDLISQCVGRLSS  285
            MDEKL+QRLESAV+RLE+LS G     +      ++ A+ DPS+VAF DLI Q V R S 
Sbjct  1    MDEKLVQRLESAVSRLESLSAGFHPSASPASAVDASDAALDPSVVAFADLIDQYVTRFSR  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AAE IGGQVLD +K+V++AF  QKELLIK K  QKPD+ G  EFLKPLNEVI + + LTE
Sbjct  61   AAEAIGGQVLDVSKLVREAFDVQKELLIKLKLTQKPDLAGFGEFLKPLNEVITKANKLTE  120

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSDFFNHLKAA DSL+ALAWIAY GKDCGMSMPIAHVEESWQMAEFY+
Sbjct  121  GRRSDFFNHLKAAADSLSALAWIAYRGKDCGMSMPIAHVEESWQMAEFYS  170



>ref|XP_009419491.1| PREDICTED: cyclase-associated protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+++++ RLE+AVARLE L+  G     +   D +A A DP++VAF++L+ + +GRLS+A
Sbjct  1    MEKEIVARLEAAVARLEALAAAGSLAAPAGVPD-AALAVDPAVVAFDELVERSLGRLSAA  59

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A+KIGG+V +ATKI+ +AF+  KELL+K K  QKPD+ GL EFLKPLNEVI++ S+LTEG
Sbjct  60   ADKIGGKVQEATKILAEAFAVLKELLVKAKQCQKPDLAGLQEFLKPLNEVILKASALTEG  119

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            RRS+FFNHLK   DSLTALAW+AY+GKDCGM+MP +HVEESWQMAEFYN
Sbjct  120  RRSEFFNHLKTVADSLTALAWVAYSGKDCGMNMPTSHVEESWQMAEFYN  168



>gb|KHG11477.1| Adenylyl cyclase-associated [Gossypium arboreum]
Length=478

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 136/173 (79%), Gaps = 7/173 (4%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGG----FGHGTSREVDVSAAASDPSIVAFEDLISQCVGR  276
            M+ KL++RLE+AVARLE L+ GG     G   S   D+S   SDPSIVAFEDL+ Q   +
Sbjct  1    MEGKLVERLEAAVARLEALAAGGGISARGLPDSGGDDMS---SDPSIVAFEDLMDQFAAK  57

Query  277  LSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSS  456
            +S AAEKIGGQVLD +K++ +AFS +K+LL++ K  QKPDM GL+EFLKPLNEVIM+ +S
Sbjct  58   VSGAAEKIGGQVLDVSKLLLEAFSVEKKLLMEIKQTQKPDMAGLAEFLKPLNEVIMKVNS  117

Query  457  LTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            + E R S+F NH K+A +SL+ALAWIAYTGKDCGMSMPIAHVEESWQ AEFYN
Sbjct  118  MAEARGSEFINHFKSAAESLSALAWIAYTGKDCGMSMPIAHVEESWQAAEFYN  170



>ref|XP_009411142.1| PREDICTED: cyclase-associated protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+++L+ RLE+AVARLE L++ G     S     +AA  DP+I AF+++++  +GR+S+A
Sbjct  1    MEQQLLTRLEAAVARLEALASAGSAPSASSRDLTNAAPLDPAISAFDEMVANSLGRVSAA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIGGQV+DATK +++AF+  KELLI  K  QKPD+ GL EFLKPLN+VI++ +S+ EG
Sbjct  61   AGKIGGQVVDATKTIEEAFTVLKELLITAKQRQKPDVAGLPEFLKPLNDVILKANSMAEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            +RS++FNHLKAA+DSLTALAWIAY GKDCGMSMPIAHVEESWQMAEFYN
Sbjct  121  KRSEYFNHLKAASDSLTALAWIAYMGKDCGMSMPIAHVEESWQMAEFYN  169



>gb|KJB32500.1| hypothetical protein B456_005G243200 [Gossypium raimondii]
Length=478

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 135/173 (78%), Gaps = 7/173 (4%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGG----FGHGTSREVDVSAAASDPSIVAFEDLISQCVGR  276
            M+ KL++RLE+AVARLE L+ GG     G   S   D+S   SDPSIVAF+DL+ Q   +
Sbjct  1    MEGKLVERLEAAVARLEALAAGGGISARGLPDSGGDDMS---SDPSIVAFDDLMDQYAAK  57

Query  277  LSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSS  456
            +S AAEKIGGQVLD +K++  AFS +K+LL++ K  QKPDM GL+EFLKPLNEVIM+ +S
Sbjct  58   VSGAAEKIGGQVLDVSKLLLKAFSVEKKLLMEIKQTQKPDMAGLAEFLKPLNEVIMKVNS  117

Query  457  LTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            + E R S+F NH K+A +SL+ALAWIAYTGKDCGMSMPIAHVEESWQ AEFYN
Sbjct  118  MAEARGSEFINHFKSAAESLSALAWIAYTGKDCGMSMPIAHVEESWQAAEFYN  170



>ref|XP_008778137.1| PREDICTED: cyclase-associated protein 1-like [Phoenix dactylifera]
Length=178

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETL-STGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+++L+ RLE+AVARLE L + G    GTS ++  +AAA   +I A +DL+S  + R+S+
Sbjct  1    MEKELLGRLEAAVARLEALGAAGSRSAGTSFDLADAAAADP-AISAIDDLMSGPLARVSA  59

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AA KIGGQV + TKIV++AF+ QK+LL+K K  QKPD  GL EFLKPLNEVI++ S+LTE
Sbjct  60   AAGKIGGQVREVTKIVEEAFAVQKDLLVKAKQCQKPDAVGLQEFLKPLNEVILKASTLTE  119

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            GRRSD+FNHLKAA DSLTALAW AY+GKDCGMS+P AHVEE WQMAEFYN
Sbjct  120  GRRSDYFNHLKAAADSLTALAWTAYSGKDCGMSLPTAHVEECWQMAEFYN  169



>ref|XP_006856025.1| PREDICTED: cyclase-associated protein 1 [Amborella trichopoda]
 gb|ERN17492.1| hypothetical protein AMTR_s00059p00060020 [Amborella trichopoda]
Length=473

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 133/167 (80%), Gaps = 2/167 (1%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            E LIQRLE+AV+RLE ++ GGF   +  E   S + +D +I A+ +L+ + + R+ ++A+
Sbjct  2    ESLIQRLEAAVSRLEAVN-GGFRPASLPETS-SDSKTDQAIDAYSELMEKSLSRVLASAQ  59

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
            KIGGQVLDATK++++AFS Q+ LLI+ K  QKPD+  LSEFLKPLNEV+M+ ++LTEGRR
Sbjct  60   KIGGQVLDATKVLEEAFSVQRGLLIRIKQTQKPDVSALSEFLKPLNEVVMKANALTEGRR  119

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            SDFFNHLK   DSLTALAWIAY GKDCG S+P AHVEESWQMAEFYN
Sbjct  120  SDFFNHLKTIADSLTALAWIAYLGKDCGPSLPAAHVEESWQMAEFYN  166



>gb|EPS61598.1| adenylyl cyclase-associated protein [Genlisea aurea]
Length=472

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 125/168 (74%), Gaps = 2/168 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            MDE LI+RLE+AV RLE L       G+    D  + + DPSI+A+E LIS  +  + SA
Sbjct  1    MDESLIRRLEAAVVRLEALDLTTANRGSDAAED--SLSRDPSILAYEHLISHHLNNVISA  58

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
             E IGGQVLD +  +++AF+ QK+LL+K K  QKPD  GL+EFLKPLN+V ++ S+LTEG
Sbjct  59   GEMIGGQVLDVSNAIQEAFNVQKDLLVKIKQSQKPDAAGLAEFLKPLNQVFVKVSALTEG  118

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            RRS FFNHLK   DSL AL WIAYTGKDCGMSMPI+HVEESWQMAEFY
Sbjct  119  RRSQFFNHLKTGADSLNALVWIAYTGKDCGMSMPISHVEESWQMAEFY  166



>ref|XP_008785664.1| PREDICTED: LOW QUALITY PROTEIN: cyclase-associated protein 1-like 
[Phoenix dactylifera]
Length=475

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 136/171 (80%), Gaps = 3/171 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAAS-DPSIVAFEDLISQCVGRLSS  285
            M+++L++RLE+AVARLE  +  G        +D+  AA  DP+I AF+DL+S  + R+S+
Sbjct  1    MEKELVERLEAAVARLEVHAAAG-SRSAVPSIDLDGAAFLDPAISAFDDLMSGSLARVSA  59

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AA KIGG+VL+ATKIV++AF+ QK+LL+K K  +KPD+ GL EFLKPLNE+I++ S+LTE
Sbjct  60   AAGKIGGKVLEATKIVEEAFAVQKDLLVKAKQCEKPDITGLQEFLKPLNELILKASALTE  119

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGM-SMPIAHVEESWQMAEFYN  615
            GRRSD+ NHLKAA DSLTALAWIAY GKDCG   +PIA+VEESWQM EFYN
Sbjct  120  GRRSDYXNHLKAAADSLTALAWIAYLGKDCGXHELPIAYVEESWQMTEFYN  170



>ref|XP_004981942.1| PREDICTED: adenylyl cyclase-associated protein-like [Setaria 
italica]
Length=486

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLE--TLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            M+  L++RLE+AVARLE    S         R++DV AAA DP IVA+++ +++ VGRL+
Sbjct  1    MEAALVERLEAAVARLEAAVASGASLALAAPRDLDVPAAA-DPVIVAYDEFVAEAVGRLN  59

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRGSSL  459
            +AAEKIGG+VLDATK++ +AF+  K+LL++ K +QKP  M     FLKPL +VI + +++
Sbjct  60   TAAEKIGGKVLDATKVLAEAFAVAKDLLVQAKQLQKPASMADAQGFLKPLGDVIAKATAM  119

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            TEGRR D+FNHLK+  DSL ALAW+A+ GKDCGMS P AHVEESWQMAEFYN
Sbjct  120  TEGRRPDYFNHLKSVADSLPALAWVAFLGKDCGMSFPTAHVEESWQMAEFYN  171



>ref|NP_001051112.2| Os03g0722600 [Oryza sativa Japonica Group]
 dbj|BAF13026.2| Os03g0722600 [Oryza sativa Japonica Group]
Length=342

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLET-LSTGGFGHGTSREVDVSAAA----SDPSIVAFEDLISQCVG  273
            M++ L++RLE+AVARLE  +++G       R++     A    SDP+IVA+++ ++  VG
Sbjct  1    MEKALVERLEAAVARLEAAVASGASLSAAPRDLGDGLDAAAAASDPAIVAYDEFVAGAVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRG  450
            RL++AAEKIGG+VLDATK++ +AF+  K+ L++ K +QKP  M    +F KPLN+VI + 
Sbjct  61   RLTAAAEKIGGKVLDATKVLAEAFAVSKDRLVQAKQLQKPASMADAQDFFKPLNDVIAKA  120

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             ++TEGRR D+FNH+K+  DSLTALAW+ + GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  IAMTEGRRPDYFNHIKSVADSLTALAWVGFLGKDCGMSFPTAHVEESWQMAEFYN  175



>ref|XP_008665331.1| PREDICTED: cyclase-associated protein 1-like [Zea mays]
 tpg|DAA51084.1| TPA: hypothetical protein ZEAMMB73_069661 [Zea mays]
Length=488

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 128/172 (74%), Gaps = 3/172 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGT--SREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            M+  L++RLE+AVARLE     G    +   R++D   A  DP+IVA+ + +++ VGRL+
Sbjct  1    MEAALVERLEAAVARLEAAVASGASLASAAPRDLDAPEARLDPAIVAYHEFVAEAVGRLT  60

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRGSSL  459
            +AAEKIGG+VLDATK++ +AF+  K+LL++ K +QKP  M     F KPL++VI + +++
Sbjct  61   AAAEKIGGKVLDATKVLAEAFAVAKDLLVQAKQLQKPASMADAQGFFKPLSDVIAKATAM  120

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            TEGRR D+FNHLK+  DSL ALAW+A+ GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  TEGRRPDYFNHLKSVADSLPALAWVAFLGKDCGMSFPTAHVEESWQMAEFYN  172



>ref|XP_008643463.1| PREDICTED: uncharacterized protein LOC100279338 isoform X1 [Zea 
mays]
 gb|AFW67774.1| adenylyl cyclase-associated protein [Zea mays]
Length=488

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 128/172 (74%), Gaps = 3/172 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGG--FGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            M+  L++RLE+AVARLE     G        R+ D   A SDP+I+A+++ +++ VGRL+
Sbjct  1    MEVALVERLEAAVARLEAAVASGASLASTAPRDFDALEARSDPAIMAYDEFVAEAVGRLT  60

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRGSSL  459
            +AAEKIGG+VLDATK++ +AF+  K++L++ K  QKP  M     F+KPL++V+ + +++
Sbjct  61   AAAEKIGGKVLDATKVLAEAFAVAKDMLVQAKQHQKPASMADAQGFVKPLSDVMAKATAM  120

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            TEGRR D+FNHLK+  DSL ALAW+A+ GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  TEGRRPDYFNHLKSVADSLPALAWVAFLGKDCGMSFPTAHVEESWQMAEFYN  172



>ref|XP_006650514.1| PREDICTED: cyclase-associated protein 1-like [Oryza brachyantha]
Length=491

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 130/174 (75%), Gaps = 5/174 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLET-LSTGGFGHGTSREV---DVSAAASDPSIVAFEDLISQCVGR  276
            M++ L++RLE+AVARLE  +++G       R++    + AAASDP+IVA+++ ++  VGR
Sbjct  1    MEKALVERLEAAVARLEAAVASGASLSAAPRDLLGDGLEAAASDPAIVAYDEFVAGAVGR  60

Query  277  LSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRGS  453
            L++A EKIGG+VLD TK++ +AF   K+ L++ K +QKP  M    +F KPLN+VI +  
Sbjct  61   LTAAGEKIGGKVLDVTKVLAEAFDVAKDRLVQAKQLQKPASMADAQDFFKPLNDVIAKAI  120

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            ++TEGRR D+FNH+K+  DSLTALAW+ + GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  AMTEGRRPDYFNHIKSVADSLTALAWVGFLGKDCGMSFPTAHVEESWQMAEFYN  174



>gb|ABF98601.1| cyclase-associated protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01193.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLET-LSTGGFGHGTSREVDVSAAA----SDPSIVAFEDLISQCVG  273
            M++ L++RLE+AVARLE  +++G       R++     A    SDP+IVA+++ ++  VG
Sbjct  1    MEKALVERLEAAVARLEAAVASGASLSAAPRDLGDGLDAAAAASDPAIVAYDEFVAGAVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRG  450
            RL++AAEKIGG+VLDATK++ +AF+  K+ L++ K +QKP  M    +F KPLN+VI + 
Sbjct  61   RLTAAAEKIGGKVLDATKVLAEAFAVSKDRLVQAKQLQKPASMADAQDFFKPLNDVIAKA  120

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             ++TEGRR D+FNH+K+  DSLTALAW+ + GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  IAMTEGRRPDYFNHIKSVADSLTALAWVGFLGKDCGMSFPTAHVEESWQMAEFYN  175



>gb|AAX95693.1| CAP protein [Oryza sativa Japonica Group]
Length=500

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLET-LSTGGFGHGTSREVDVSAAA----SDPSIVAFEDLISQCVG  273
            M++ L++RLE+AVARLE  +++G       R++     A    SDP+IVA+++ ++  VG
Sbjct  1    MEKALVERLEAAVARLEAAVASGASLSAAPRDLGDGLDAAAAASDPAIVAYDEFVAGAVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRG  450
            RL++AAEKIGG+VLDATK++ +AF+  K+ L++ K +QKP  M    +F KPLN+VI + 
Sbjct  61   RLTAAAEKIGGKVLDATKVLAEAFAVSKDRLVQAKQLQKPASMADAQDFFKPLNDVIAKA  120

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             ++TEGRR D+FNH+K+  DSLTALAW+ + GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  IAMTEGRRPDYFNHIKSVADSLTALAWVGFLGKDCGMSFPTAHVEESWQMAEFYN  175



>gb|KCW55347.1| hypothetical protein EUGRSUZ_I01265 [Eucalyptus grandis]
Length=427

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  256  ISQCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNE  435
            ++Q V R+SSAAEKIGG+VLD TK+V +AFSAQKELLI+ K  QKPD+ GL EFLKPLNE
Sbjct  1    MAQYVARVSSAAEKIGGRVLDVTKVVGEAFSAQKELLIQIKQTQKPDLAGLGEFLKPLNE  60

Query  436  VIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            VIM+ ++LTEGRRSDFFNHLKAA DSL ALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN
Sbjct  61   VIMKANALTEGRRSDFFNHLKAAADSLAALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  120



>ref|XP_003560473.1| PREDICTED: cyclase-associated protein 1 [Brachypodium distachyon]
Length=487

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGT-SREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M++ L++RLE+AVARLE  +  G    +  R+      ASDP+IVA+++ ++Q +GRL++
Sbjct  1    MEKALVERLEAAVARLEAAAASGASFSSAPRDFGEVPGASDPAIVAYDEFVAQAIGRLTA  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMRGSSLT  462
            AAEKIGG+VLDATK++ +AF+  K+LLI+ K +QKP  M    +F KPLN+VI +  ++T
Sbjct  61   AAEKIGGKVLDATKVLAEAFTVAKDLLIQAKQLQKPASMANAQDFFKPLNDVIGKAIAMT  120

Query  463  EGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            EGRR D+FNH+K+  DSL ALAW+A+ GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  EGRRPDYFNHMKSVADSLAALAWVAFLGKDCGMSFPTAHVEESWQMAEFYN  171



>gb|EAZ07173.1| hypothetical protein OsI_29418 [Oryza sativa Indica Group]
Length=464

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSR---EVDVSAAASDPSIVAFEDLISQCVGRL  279
            MDE L+ RLE+AV+RLE L+             +VD  A+A DP+I+AF++L++  VGR+
Sbjct  1    MDEALVGRLEAAVSRLEALNGAAGATARGGYGGQVD-HASAHDPAILAFDELVAGAVGRV  59

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
            S+AA KIG +V + T++++ AF   K+LL++TK  QKP +  ++ F+ PLNE I+  +SL
Sbjct  60   SAAAGKIGAEVAEVTRVLEKAFLVGKDLLVRTKQTQKPTVDSIAVFMGPLNETILEANSL  119

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             EG RS   NHLKA   SL ALAWI YTGK CGM +PIAHVEESWQMAEFY+
Sbjct  120  AEGTRSSHGNHLKAVAGSLAALAWIGYTGKGCGMPLPIAHVEESWQMAEFYS  171



>ref|XP_006659462.1| PREDICTED: cyclase-associated protein 1-like [Oryza brachyantha]
Length=466

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSR-EVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            M+E L+ RLE+AV+RLE L+  G   G    +VD +AA  DP+++AFE+L++  VGR+S+
Sbjct  1    MEESLVGRLEAAVSRLEALNGAGTVSGGGGGQVDHAAAQQDPAVLAFEELVAGAVGRVSA  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
            AA KIG +V D T++++ AF   K+LL++TK   KP M  ++ F+ PLNE I+  ++L E
Sbjct  61   AAGKIGAEVADVTRVMEKAFLVGKDLLVRTKETPKPTMDSMAAFMGPLNEAILEANALAE  120

Query  466  GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            G RS   NHLKAA  SL+ALAWI YTGKDCGM +PIAHVEESWQMAEFY+
Sbjct  121  GTRSSHGNHLKAAAGSLSALAWIGYTGKDCGMPLPIAHVEESWQMAEFYS  170



>ref|XP_010235186.1| PREDICTED: cyclase-associated protein 1-like [Brachypodium distachyon]
Length=465

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 121/169 (72%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M+  L+ RLE+AV+RLE L  G       R +    AA DP+I+AF+DL++  VGR+S+A
Sbjct  1    MEASLVGRLEAAVSRLEALGAGAHPSAVPRGLADHEAAQDPAILAFDDLVADAVGRVSAA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIG +V + T +++ AFS  K+LL++TK  QKP  + ++ F+ PLNE++M  ++L EG
Sbjct  61   AGKIGAEVAEVTNVLEKAFSVGKDLLVRTKQTQKPTAEAMAVFMAPLNEIVMEANALAEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             RS+  NHLKAA  SL ALAWI YTGK CGM +PIAHVEESWQMAEFY+
Sbjct  121  TRSNHANHLKAAAGSLAALAWIGYTGKGCGMLLPIAHVEESWQMAEFYS  169



>ref|XP_002444442.1| hypothetical protein SORBIDRAFT_07g022030 [Sorghum bicolor]
 gb|EES13937.1| hypothetical protein SORBIDRAFT_07g022030 [Sorghum bicolor]
Length=459

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 123/169 (73%), Gaps = 4/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M E LI RLE+AV+RLE LS G  G G S   D +A+A DP+IVAF+DL++  +GR+S+A
Sbjct  2    MGEALIGRLEAAVSRLEALSGGARG-GLS---DTTASAQDPAIVAFDDLVASALGRVSAA  57

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIG  V + T++V+ AF   K+LL++T   QKP M+ ++ F+ PLNE I+  ++L EG
Sbjct  58   AGKIGTDVAEVTRLVEKAFLVGKDLLVRTNQTQKPTMESVTMFMGPLNETILEANALAEG  117

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             RS + NHLKAA  SL ALAWI YTGK CGM +PIA VEESWQMAEFY+
Sbjct  118  TRSIYANHLKAAAGSLAALAWIGYTGKGCGMPLPIAQVEESWQMAEFYS  166



>ref|XP_004973587.1| PREDICTED: adenylyl cyclase-associated protein-like [Setaria 
italica]
Length=462

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 122/169 (72%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M E LI RLE+AV+RLE L+ G       R +  +A+A DP+I+AF+DL++  +GR+S+A
Sbjct  1    MGEALIGRLEAAVSRLEVLTAGVHPSIAPRGLPDNASAQDPAILAFDDLVASALGRVSAA  60

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIG +V + T++V+ AF   K+LL++TK  QKP M+ ++ F+ PLNE I+  ++L EG
Sbjct  61   AGKIGAEVAEVTRLVEKAFLVAKDLLVRTKQTQKPTMESMATFIGPLNETILEANTLAEG  120

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             RS   NHLKAA  SL ALAWI YTGK CGM +P+A VEESWQMAEFY+
Sbjct  121  TRSSHANHLKAAAGSLAALAWIGYTGKGCGMPLPMAQVEESWQMAEFYS  169



>ref|XP_008664624.1| PREDICTED: cyclase-associated protein 1-like [Zea mays]
 tpg|DAA48845.1| TPA: hypothetical protein ZEAMMB73_354941 [Zea mays]
Length=458

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 120/169 (71%), Gaps = 4/169 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSA  288
            M E LI RLE+AV+RLE LS G  G G S     ++A  DP+IVAF+DLI+  +GR+S+A
Sbjct  1    MGEALIGRLEAAVSRLEALSAGARG-GLSY---TASAQEDPAIVAFDDLIASALGRVSAA  56

Query  289  AEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEG  468
            A KIG  V + T++V++AF   K+LL +T   QKP M+ ++ F+ PLNE I+  ++L E 
Sbjct  57   AGKIGADVAEVTRLVENAFLVGKDLLARTSQTQKPTMESVTTFMGPLNEAILEANALVER  116

Query  469  RRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
              S + NHLKAA  SL ALAWI YTGK CGM +PIAHVEESWQMAEFY+
Sbjct  117  TSSIYANHLKAAAGSLAALAWIGYTGKGCGMPLPIAHVEESWQMAEFYS  165



>ref|NP_001061934.1| Os08g0447900 [Oryza sativa Japonica Group]
 dbj|BAD09441.1| putative adenylyl cyclase associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD09824.1| putative adenylyl cyclase associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF23848.1| Os08g0447900 [Oryza sativa Japonica Group]
 dbj|BAG92501.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68786.1| hypothetical protein OsJ_27511 [Oryza sativa Japonica Group]
Length=464

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 122/172 (71%), Gaps = 4/172 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGTSR---EVDVSAAASDPSIVAFEDLISQCVGRL  279
            MDE L+ RLE+AV+RLE L+             +VD  A+A DP+I+AF++L++  VGR+
Sbjct  1    MDEALVGRLEAAVSRLEALNGAAGATARGGYGGQVD-HASAHDPAILAFDELVAGAVGRV  59

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
            S+AA KIG +V + T++++ AF   K+LL++TK  QKP +  ++ F+ PLNE I+  +SL
Sbjct  60   SAAAGKIGAEVAEVTRVLEKAFLVGKDLLVRTKQTQKPTVDSIAVFMGPLNETILEANSL  119

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             EG RS   NHLKAA  SL ALAWI YTGK CGM +PIAHVEESWQMAEFY+
Sbjct  120  AEGTRSSHGNHLKAAAGSLAALAWIGYTGKGCGMPLPIAHVEESWQMAEFYS  171



>gb|EEC76093.1| hypothetical protein OsI_13337 [Oryza sativa Indica Group]
Length=471

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 118/174 (68%), Gaps = 25/174 (14%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLET-LSTGGFGHGTSREVDVSAAA----SDPSIVAFEDLISQCVG  273
            M++ L++RLE+AVARLE  +++G       R++     A    SDP+IVA+++ ++  VG
Sbjct  1    MEKALVERLEAAVARLEAAVASGASLSAAPRDLGDGLDAAAAASDPAIVAYDEFVAGAVG  60

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
            RL++AAEKIGG+VLDATK++ +AF+  K+ L++ K +Q+                 +R  
Sbjct  61   RLTAAAEKIGGKVLDATKVLAEAFAVSKDRLVQAKQLQQ-----------------LR--  101

Query  454  SLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
              TEGRR D+FNH+K+  DSLTALAW+ + GKDCGMS P AHVEESWQMAEFYN
Sbjct  102  -CTEGRRPDYFNHIKSVADSLTALAWVGFLGKDCGMSFPTAHVEESWQMAEFYN  154



>ref|XP_002987315.1| hypothetical protein SELMODRAFT_269241 [Selaginella moellendorffii]
 gb|EFJ11630.1| hypothetical protein SELMODRAFT_269241 [Selaginella moellendorffii]
Length=491

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 117/175 (67%), Gaps = 9/175 (5%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLST----GGFGHGTSREVDVS----AAASDPSIVAFEDLISQCV  270
            E  + RLE+AV RLE L +    GG G  + R  D +     +A  PS+ AFE+L+S  V
Sbjct  6    EAAVSRLEAAVGRLEALESRLAAGGGGVKSERFPDAANLELESAGAPSVAAFEELVSASV  65

Query  271  GRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRG  450
            GR+ +AAEKIGGQVL+A+K++K+AF  +++++      ++P M+ L + + PL  ++M+ 
Sbjct  66   GRVMAAAEKIGGQVLEASKLIKEAFEEERKIVRAISQCKEPSMEELQKLVHPLALLLMKA  125

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             SLTEGRR+D FN++K   +SL +L+W+ YT K  GM  PI+ VEESWQ AEFYN
Sbjct  126  HSLTEGRRTDAFNNVKVIAESLQSLSWVVYT-KQSGMPKPISQVEESWQSAEFYN  179



>ref|XP_002976329.1| hypothetical protein SELMODRAFT_175612 [Selaginella moellendorffii]
 gb|EFJ22589.1| hypothetical protein SELMODRAFT_175612 [Selaginella moellendorffii]
Length=501

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 117/175 (67%), Gaps = 9/175 (5%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLST----GGFGHGTSREVDVS----AAASDPSIVAFEDLISQCV  270
            E  + RLE+AV RLE L +    GG G  + R  D +     +A  PS+ AFE+L+S  V
Sbjct  6    EAAVSRLEAAVGRLEALESRLAAGGGGVKSERFPDAANLELESAGAPSVAAFEELVSASV  65

Query  271  GRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRG  450
            GR+ +AAEKIGGQVL+A+K++K+AF  +++++      ++P M+ L + + PL  ++M+ 
Sbjct  66   GRVMAAAEKIGGQVLEASKLIKEAFEEERKIVRAISQCKEPSMEELQKLVHPLALLLMKA  125

Query  451  SSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
             SLTEGRR+D FN++K   +SL +L+W+ YT K  GM  PI+ VEESWQ AEFYN
Sbjct  126  HSLTEGRRTDAFNNIKVIAESLQSLSWVVYT-KQSGMPKPISQVEESWQSAEFYN  179



>gb|KDO49088.1| hypothetical protein CISIN_1g016407mg [Citrus sinensis]
Length=390

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +1

Query  382  IQKPDMKGLSEFLKPLNEVIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGM  561
            +QKPD+ GL+EFLKPLNEVIM+ +++TEGRRSDFFNHLK+A DSLTALAWIAYTGKDCGM
Sbjct  2    LQKPDLVGLAEFLKPLNEVIMKANAMTEGRRSDFFNHLKSAADSLTALAWIAYTGKDCGM  61

Query  562  SMPIAHVEESWQMAEFYN  615
            SMPIAHVEESWQMAEFY+
Sbjct  62   SMPIAHVEESWQMAEFYS  79



>ref|XP_001773273.1| predicted protein [Physcomitrella patens]
 gb|EDQ61963.1| predicted protein [Physcomitrella patens]
Length=512

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 110/179 (61%), Gaps = 12/179 (7%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDP------------SIVAFEDLI  258
            E ++ RLE AV+RLETL +        R +      +DP            S+ AF++L+
Sbjct  7    EAVVVRLEQAVSRLETLGSRATSSSADRGISSLVGFADPGASQPAGSASHLSVEAFDELV  66

Query  259  SQCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEV  438
               VGR+ +AA+KIGG VL  +++++ AF A+K ++      ++PD   L + ++PL + 
Sbjct  67   QARVGRVLAAADKIGGGVLQTSQVLQRAFDAEKAIVRAISQCKRPDPAALQKVVQPLVDA  126

Query  439  IMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
            + +   LTEG+R++ FNH KA  +SL AL+W+ Y GKDCGMS+P  HVEESWQ AE+YN
Sbjct  127  LTKAHGLTEGKRTEAFNHQKAVAESLLALSWVCYAGKDCGMSLPGPHVEESWQSAEYYN  185



>ref|XP_008236881.1| PREDICTED: cyclase-associated protein 1 [Prunus mume]
Length=743

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  QKPDMKGLSEFLKPLNEVIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMS  564
            +KPD  GL+EFLKPLNEVI + ++LTEGRRSDFFNHLK+A DSL+ALAWIAYTGK+CGMS
Sbjct  359  KKPDNAGLAEFLKPLNEVITKANALTEGRRSDFFNHLKSAVDSLSALAWIAYTGKECGMS  418

Query  565  MPIAHVEESWQMAEFYN  615
            MPIAHVEESWQMAEFYN
Sbjct  419  MPIAHVEESWQMAEFYN  435



>ref|XP_008450201.1| PREDICTED: cyclase-associated protein 1-like [Cucumis melo]
Length=203

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  385  QKPDMKGLSEFLKPLNEVIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMS  564
            +KPD+ GL+EFLK LNEV M+ ++LT GRRSDFFNHLKA  DSL+ALAWIA+T KDCGMS
Sbjct  64   KKPDLAGLAEFLKQLNEVTMKANALTGGRRSDFFNHLKATADSLSALAWIAFTEKDCGMS  123

Query  565  MPIAHVEESWQMAEFYN  615
            MPIAHV+ESWQMAEFYN
Sbjct  124  MPIAHVQESWQMAEFYN  140



>gb|EEE59831.1| hypothetical protein OsJ_12395 [Oryza sativa Japonica Group]
Length=493

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 107/176 (61%), Gaps = 7/176 (4%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLET-LSTGGFGHGTSREVDVSAAA----SDPSIVAFEDLISQCVG  273
            M++ L++RLE+AVARLE  +++G       R++     A    SDP+IVA+++   +   
Sbjct  1    MEKALVERLEAAVARLEAAVASGASLSAAPRDLGDGLDAAAAASDPAIVAYDEFRRRGRR  60

Query  274  RLSSAAEKIG-GQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMR  447
                   +   G+     +     +   ++ L++   +QKP  M    +F KPLN+VI +
Sbjct  61   PPHRPRPRGSEGRSSTQPRSSPSLWPFSRDRLVQANKLQKPASMADAQDFFKPLNDVIAK  120

Query  448  GSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFYN  615
              ++TEGRR D+FNH+K+  DSLTALAW+ + GKDCGMS P AHVEESWQMAEFYN
Sbjct  121  AIAMTEGRRPDYFNHIKSVADSLTALAWVGFLGKDCGMSFPTAHVEESWQMAEFYN  176



>ref|XP_010690893.1| PREDICTED: cyclase-associated protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  397  MKGLSEFLKPLNEVIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIA  576
            M G+SEFLKPLNEV  + ++LTEG+RSDFFNH K+ +DSL ALAWIAYTGKDCGMSMPIA
Sbjct  1    MAGMSEFLKPLNEVFTKANALTEGKRSDFFNHQKSISDSLAALAWIAYTGKDCGMSMPIA  60

Query  577  HVEESWQMAEFYN  615
            HVEESWQMAEFY+
Sbjct  61   HVEESWQMAEFYS  73



>ref|XP_003057213.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58858.1| predicted protein [Micromonas pusilla CCMP1545]
Length=510

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 102/175 (58%), Gaps = 9/175 (5%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAAS--------DPSIVAFEDLISQCV  270
            E ++ RLE+  ARLE    G      +     + A +         PS+ +++ L+S  +
Sbjct  8    ESVVARLEAVAARLEKQGVGVGVGAGAVAAPPAPAPAPAPAPGEIPPSVASYDALLSGAL  67

Query  271  GRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP-DMKGLSEFLKPLNEVIMR  447
              ++SAA  +G ++ DA K+ +DAF+  +++L      ++P D+  L   + P+ E +M+
Sbjct  68   KTMTSAASPLGAEITDAVKLFEDAFAKLRDVLAVVAACKRPTDVDALQTLIAPVGERMMK  127

Query  448  GSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             ++ TEGRR+D FNHLK   +S+  LA++AY G D GMS+P+ HV E+WQ AEFY
Sbjct  128  LAATTEGRRTDAFNHLKVIAESVQCLAFVAYQGPDMGMSLPMPHVAEAWQSAEFY  182



>ref|XP_002505939.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67197.1| predicted protein [Micromonas sp. RCC299]
Length=458

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 99/171 (58%), Gaps = 5/171 (3%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVD----VSAAASDPSIVAFEDLISQCVGRLS  282
            E L+ RLE+  ARLE  +       T+         +A    PS+ AF+ LI+  +  L 
Sbjct  2    ESLVARLEAVAARLEAQAGAPAAAKTTASTPGAKTDAAGGVAPSVAAFDALIAGPLAELV  61

Query  283  SAAEKIG-GQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
            +A   +G  ++ DAT +  DAF+A++ ++      +KP+M  L   L P+ +++ R  + 
Sbjct  62   AATSALGDAEIADATALFADAFNAERTVIECIASCRKPEMDALQSLLAPVGDLMTRVGAK  121

Query  460  TEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            +EG+R+D FNHLKA  ++   L+++AYTG + GMS+P  HV E+WQ AEFY
Sbjct  122  SEGKRTDAFNHLKALAEAAQCLSFVAYTGPETGMSLPGPHVTETWQSAEFY  172



>ref|NP_001145831.1| adenylyl cyclase-associated protein [Zea mays]
 gb|ACL52671.1| unknown [Zea mays]
Length=389

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  415  FLKPLNEVIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESW  594
            F+KPL++V+ + +++TEGRR D+FNHLK+  DSL ALAW+A+ GKDCGMS P AHVEESW
Sbjct  7    FVKPLSDVMAKATAMTEGRRPDYFNHLKSVADSLPALAWVAFLGKDCGMSFPTAHVEESW  66

Query  595  QMAEFYN  615
            QMAEFYN
Sbjct  67   QMAEFYN  73



>gb|EMT04895.1| Adenylyl cyclase-associated protein [Aegilops tauschii]
Length=413

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  397  MKGLSEFLKPLNEVIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIA  576
            M    +FLKPLN+ I + +++TEGRR D+FNH+K+  DSL ALAW+A+ GK CGMS P A
Sbjct  1    MANAQDFLKPLNDTIAKATAMTEGRRPDYFNHMKSVADSLHALAWVAFLGKGCGMSFPTA  60

Query  577  HVEESWQMAEFYN  615
            HVEESWQMAEFYN
Sbjct  61   HVEESWQMAEFYN  73



>gb|EMS59857.1| Adenylyl cyclase-associated protein [Triticum urartu]
Length=380

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  397  MKGLSEFLKPLNEVIMRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIA  576
            M    +FLKPLN+ I + +++TEGRR D+FNH+K+  DSL ALAW+A+ GK CGMS P A
Sbjct  1    MAKAQDFLKPLNDTIAKATAMTEGRRPDYFNHMKSVADSLHALAWVAFLGKGCGMSFPTA  60

Query  577  HVEESWQMAEFYN  615
            HVEESWQMAEFYN
Sbjct  61   HVEESWQMAEFYN  73



>gb|AFW67775.1| hypothetical protein ZEAMMB73_403811 [Zea mays]
Length=112

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGG--FGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            M+  L++RLE+AVARLE     G        R+ D   A SDP+I+A+++ +++ VGRL+
Sbjct  1    MEVALVERLEAAVARLEAAVASGASLASTAPRDFDALEARSDPAIMAYDEFVAEAVGRLT  60

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKP  393
            +AAEKIGG+VLDATK++ +AF+  K++L++ K  Q P
Sbjct  61   AAAEKIGGKVLDATKVLAEAFAVAKDMLVQAKQHQVP  97



>ref|XP_005842875.1| hypothetical protein CHLNCDRAFT_142506 [Chlorella variabilis]
 gb|EFN50763.1| hypothetical protein CHLNCDRAFT_142506 [Chlorella variabilis]
Length=517

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 94/177 (53%), Gaps = 11/177 (6%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVA-----------FEDLIS  261
            E +  RLE   ARL ++   G    T R    +  A   ++ A           +  L+S
Sbjct  10   ESITSRLEETEARLASIVPTGTSSFTPRPTAAAPGAPAAALPAAAAGPGAALADYRQLLS  69

Query  262  QCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVI  441
              + + ++AAE +GGQVL+AT I+ + F  +  ++      +KPD   L + L+P+ E +
Sbjct  70   TQLAKAAAAAEGVGGQVLEATHILVEGFQREAAVIEAMGVCKKPDNGELQQLLQPVGEQM  129

Query  442  MRGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            +    L  G RS + NH K  ++++ AL+W+AYTG +CG+ +P  HVE++   A+FY
Sbjct  130  VAAGDLASGPRSPYQNHYKLVSEAMQALSWVAYTGPNCGIHLPPQHVEDALSAADFY  186



>ref|XP_005650031.1| hypothetical protein COCSUDRAFT_46736 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25487.1| hypothetical protein COCSUDRAFT_46736 [Coccomyxa subellipsoidea 
C-169]
Length=376

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 1/116 (1%)
 Frame = +1

Query  268  VGRLSSAAEKI-GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIM  444
            V RL S A ++   +V  A+ +V  AF A++ ++      ++PDM GL + ++P+   I 
Sbjct  11   VARLESVAARLEATEVHKASTVVDRAFKAERVVVEAIAQCKQPDMGGLQKLVEPVGVEIS  70

Query  445  RGSSLTEGRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
                LT+GRRS  FN+ KA  ++L AL+W+ Y+G  CGM  P  HVE   Q AEF+
Sbjct  71   AADKLTQGRRSAAFNYSKAVAEALPALSWVVYSGPSCGMDPPPKHVENHLQSAEFW  126



>ref|XP_008845283.1| PREDICTED: adenylyl cyclase-associated protein 2 [Nannospalax 
galili]
 ref|XP_008845284.1| PREDICTED: adenylyl cyclase-associated protein 2 [Nannospalax 
galili]
Length=476

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS G  G  G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLEGLSAGSHGPPGDCGEVNGVNGGVAPSVEAFDKLMNGMVAEFLKNSRV  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    S  E  R 
Sbjct  67   LAGDVETHAEMVHGAFQAQRAFLLVASQYQQPQENEVTALLKPISEKIQEIQSFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            SD FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SDMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004383037.1| PREDICTED: adenylyl cyclase-associated protein 2 [Trichechus 
manatus latirostris]
Length=476

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+   A   PS+ AF+ L++  V      +  
Sbjct  7    LMERLEQAVVRLELLSAGSHRPPGDCGEVNDVNAGVAPSVEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASRYQQPQENDVATLLKPISEKIQEIQTFREQNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            SD FNHL A ++S+ AL WIA + K      P  +V+E  + A FY
Sbjct  127  SDMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNEAATFY  166



>emb|CDQ65132.1| unnamed protein product [Oncorhynchus mykiss]
Length=472

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 93/165 (56%), Gaps = 7/165 (4%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV+RLE +S GG G G++      +      + A++ +I+  VG+  + +++I
Sbjct  7    LVQRLEVAVSRLEAVSGGGGGGGSAGGSTGGSGVVAAYVEAYDAIITGSVGQYMTLSQQI  66

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V     ++K AFS Q++LL+   G QKP    L+  L P+++VI +  +  E  R S
Sbjct  67   GGDVQKHADMMKQAFSCQRQLLVTASGSQKPSDASLTALLTPVSKVIQQVQTFREQNRSS  126

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V+E    A+FY
Sbjct  127  PLFNHLSAISESVPALGWVAMAPK------PGPYVKEMQDAAQFY  165



>ref|XP_004323891.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Tursiops truncatus]
Length=176

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG-GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE+LS G     G   E++  +    PS+ AF+ L++  V      +  
Sbjct  7    LMERLEQAVGRLESLSAGLHRPPGDCGEINGVSGGVAPSVEAFDKLVNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>gb|ABM92205.1| CAP, adenylate cyclase-associated protein, 2 (yeast) [synthetic 
construct]
Length=477

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G  REV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCREVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_008056860.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Tarsius 
syrichta]
Length=476

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 86/166 (52%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G  R+V+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAETHRPPGNCRDVNGVNGGVAPSVEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++ FLKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAAFLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_008329363.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cynoglossus 
semilaevis]
Length=472

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 89/165 (54%), Gaps = 15/165 (9%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLE +   G     +   +         + AF+++I+  V    S ++KI
Sbjct  7    LVQRLEVAVGRLEAIGGQGGAASGAAAAEY--------VDAFDEIINGPVAEYLSLSQKI  58

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-S  477
            GG V     ++K AFSAQK+LL+     QKP    ++  L+P++++I + ++  E +R S
Sbjct  59   GGDVQKHADMMKQAFSAQKQLLVVASSSQKPSDATMTSLLQPMSKIIQQVTNFREVQRTS  118

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             FFNHL A ++S+ AL W+A   K C       +V+E    A FY
Sbjct  119  PFFNHLSAISESVPALGWVAMAPKPC------PYVKEMQDAAMFY  157



>ref|XP_008992170.1| PREDICTED: adenylyl cyclase-associated protein 2 [Callithrix 
jacchus]
Length=477

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G  REV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGDCREVNGVNGGVAPSVEAFDKLMNSMVAEFLKNSRM  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_002463964.1| hypothetical protein SORBIDRAFT_01g009760 [Sorghum bicolor]
 gb|EER90962.1| hypothetical protein SORBIDRAFT_01g009760 [Sorghum bicolor]
Length=409

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 80/124 (65%), Gaps = 13/124 (10%)
 Frame = +1

Query  109  MDEKLIQRLESAVARLETLSTGGFGHGT--SREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            M+  L++RLE+AVARLE     G    +   R++D   A SDP+IVA+++ +++ VGRL+
Sbjct  1    MEAALVERLEAAVARLEAAVASGASIASAAPRDLDAPDAQSDPAIVAYDEFVAEAVGRLT  60

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQ--------KPDMKGLSEFLKPLNEV  438
            +AAEKIGG+VLDATK++ +AF+  K+LL++ K +Q         PD     E+ K L ++
Sbjct  61   AAAEKIGGKVLDATKVLAEAFAVAKDLLVQAKQLQVLVEYRNKDPDH---VEWAKALKDL  117

Query  439  IMRG  450
             M G
Sbjct  118  YMPG  121



>ref|XP_004693343.1| PREDICTED: adenylyl cyclase-associated protein 2 [Condylura cristata]
Length=431

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            LI+RLE AV RLE L+ G     G   E++       PS+ AF+ L++  V      ++ 
Sbjct  7    LIERLERAVCRLELLAVGSHQPPGNCGEINGVIGGVAPSVEAFDKLMNSMVAEFLKKSKV  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V+ AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVQSAFQAQRAFLLMASQYQQPQENDVAVLLKPISEKIQEIQTFREKNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SEMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005964470.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Pantholops 
hodgsonii]
Length=486

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+     + PS+ AF+ LI+  V    + +  
Sbjct  7    LMERLERAVGRLELLSAGSHRPPGDCGEVNGVNGGAAPSVEAFDKLINSIVAEFLNKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_003496059.1| PREDICTED: adenylyl cyclase-associated protein 2 [Cricetulus 
griseus]
 ref|XP_007621410.1| PREDICTED: adenylyl cyclase-associated protein 2 [Cricetulus 
griseus]
Length=476

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G  G  G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLECAVNRLEQLSAGPCGPPGDCGEVNGVNGGVAPSVEAFDKLVNSMVAEFLKKSRV  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LSGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENEVAVLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005355164.1| PREDICTED: adenylyl cyclase-associated protein 2 [Microtus ochrogaster]
Length=476

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS G  G  G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LMERLECAVSRLEQLSAGSRGPPGDCGEVNGVNGGVAPSVEAFDKLVNSMVAEFLRNSRV  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENEVAVLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_010732388.1| PREDICTED: adenylyl cyclase-associated protein 1 [Larimichthys 
crocea]
Length=470

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 87/165 (53%), Gaps = 12/165 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLE ++  G G G S    VSA      + AF++++S  V    S ++KI
Sbjct  7    LVQRLEVAVGRLEAMTVSGGGGGDSAGGAVSAY-----VEAFDEIVSGAVAEYLSLSQKI  61

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG+V     ++K  F+ Q+ LL+     QKP    L+  L+P+++ I +     E  R S
Sbjct  62   GGEVQKHADMMKQVFAIQRALLVTASSSQKPSDAVLTTLLQPVSKAIQQVQGFREQNRTS  121

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K C       +V+E    A FY
Sbjct  122  PLFNHLSAVSESVPALGWVAMAPKPC------PYVKEMQDAAMFY  160



>ref|XP_003927371.1| PREDICTED: adenylyl cyclase-associated protein 2 [Saimiri boliviensis 
boliviensis]
Length=477

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G  REV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGDCREVNGVNGGVAPSVEAFDKLMNGMVAEFLKNSRM  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_011956643.1| PREDICTED: adenylyl cyclase-associated protein 2 [Ovis aries]
 ref|XP_011971237.1| PREDICTED: adenylyl cyclase-associated protein 2 [Ovis aries 
musimon]
Length=486

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVGRLELLSAGSHRPPGDCGEVNGVNGGVAPSVEAFDKLMNGMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++ FLKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAAFLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_003468803.1| PREDICTED: adenylyl cyclase-associated protein 2 [Cavia porcellus]
Length=476

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 86/171 (50%), Gaps = 18/171 (11%)
 Frame = +1

Query  121  LIQRLESAVARLETLS------TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            L++RLE AV+RLE LS       GGFG     EV+       PS+ AF+ L++  V    
Sbjct  7    LVERLEHAVSRLEQLSAESQQPPGGFG-----EVNGVNGGVAPSVEAFDKLMNGMVAEFL  61

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  62   RNSRILAGDVETHAEMVHGAFQAQRAFLVMASRYQQPQENEVAALLKPISEKIQEIQTFR  121

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  122  ERNRGSNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_003416506.1| PREDICTED: adenylyl cyclase-associated protein 2 [Loxodonta africana]
 ref|XP_010594497.1| PREDICTED: adenylyl cyclase-associated protein 2 [Loxodonta africana]
Length=477

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L+QRLE AV RLE LS G     G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LMQRLEQAVVRLELLSAGSHRPPGDCGEVNGVNGGVTPSVEAFDKLMNGMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQEHDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_008975022.1| PREDICTED: adenylyl cyclase-associated protein 2 [Pan paniscus]
Length=477

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_001376362.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Monodelphis 
domestica]
 ref|XP_007487968.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Monodelphis 
domestica]
Length=477

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE+L +G  G HG    V+       PS+ AF+ L++  V      ++ 
Sbjct  7    LLERLEKAVIRLESLFSGSTGPHGECGAVNGVNGGVAPSVEAFDKLMNGMVAEFLRNSKI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVEAHAEMVHSAFQAQRAFLLLASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SQMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_001170453.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Pan 
troglodytes]
 ref|XP_009448834.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Pan 
troglodytes]
Length=477

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006198680.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Vicugna 
pacos]
Length=486

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVGRLELLSAGSHRPPGDCGEVNGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIHEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SEMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004043357.1| PREDICTED: adenylyl cyclase-associated protein 2 [Gorilla gorilla 
gorilla]
Length=477

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|NP_006357.1| adenylyl cyclase-associated protein 2 [Homo sapiens]
 sp|P40123.1|CAP2_HUMAN RecName: Full=Adenylyl cyclase-associated protein 2; Short=CAP 
2 [Homo sapiens]
 gb|AAA20587.1| CAP2 [Homo sapiens]
 gb|AAH08481.1| CAP, adenylate cyclase-associated protein, 2 (yeast) [Homo sapiens]
 emb|CAG33303.1| CAP2 [Homo sapiens]
 gb|AAX42098.1| CAP adenylate cyclase-associated protein 2 [synthetic construct]
 gb|EAW55380.1| CAP, adenylate cyclase-associated protein, 2 (yeast) [Homo sapiens]
 gb|ABM84679.1| CAP, adenylate cyclase-associated protein, 2 (yeast) [synthetic 
construct]
 dbj|BAG35280.1| unnamed protein product [Homo sapiens]
 gb|AIC55789.1| CAP2, partial [synthetic construct]
Length=477

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>gb|AAX29556.1| adenylate cyclase-associated protein 2 [synthetic construct]
Length=478

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_010943988.1| PREDICTED: adenylyl cyclase-associated protein 2 [Camelus bactrianus]
 ref|XP_010943989.1| PREDICTED: adenylyl cyclase-associated protein 2 [Camelus bactrianus]
 ref|XP_010978401.1| PREDICTED: adenylyl cyclase-associated protein 2 [Camelus dromedarius]
 ref|XP_010978402.1| PREDICTED: adenylyl cyclase-associated protein 2 [Camelus dromedarius]
Length=486

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVGRLELLSAGSHRPPGDCGEVNGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIHEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SEMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006631262.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X1 [Lepisosteus oculatus]
Length=476

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 88/170 (52%), Gaps = 21/170 (12%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVA-----FEDLISQCVGRLSS  285
            L+QRLE AV RLE ++ G  G         S  A D   V      F+ L+S  V +  S
Sbjct  7    LVQRLEVAVGRLEAVA-GSQGD--------SPGAGDAGAVVQFVQEFDALVSGTVAQYCS  57

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
             +++IGG V    +++K AF+AQ+++L+     QKP    L+  L+P++ VI +  S  E
Sbjct  58   LSQQIGGDVQKHAEMIKQAFAAQRQILVIASRCQKPSDATLTSLLQPVSSVIEQVQSFRE  117

Query  466  -GRRSDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  118  KNRSSPLFNHLSAVSESVPALGWVAMAPK------PGPYVKEMQDAAMFY  161



>ref|NP_446326.1| adenylyl cyclase-associated protein 2 [Rattus norvegicus]
 ref|XP_006253815.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Rattus 
norvegicus]
 ref|XP_006253816.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Rattus 
norvegicus]
 sp|P52481.1|CAP2_RAT RecName: Full=Adenylyl cyclase-associated protein 2; Short=CAP 
2 [Rattus norvegicus]
 gb|AAA92298.1| CAP2 protein [Rattus norvegicus]
 gb|EDL98163.1| CAP, adenylate cyclase-associated protein, 2 (yeast), isoform 
CRA_a [Rattus norvegicus]
 gb|EDL98164.1| CAP, adenylate cyclase-associated protein, 2 (yeast), isoform 
CRA_a [Rattus norvegicus]
Length=477

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 87/167 (52%), Gaps = 9/167 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVD-VSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            L+QRLE AV+RLE LS+G     G   EV+ +S     PS+ AF+ LI+  V      + 
Sbjct  7    LMQRLEFAVSRLERLSSGLHEPPGGCGEVNSLSRGIVAPSVEAFDKLINSMVAEFLKNSR  66

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
             + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R
Sbjct  67   VLAGDVETHAEMVHGAFQAQRAFLLMVSQHQQPQENEVAVLLKPISEKIQEIQTFRERNR  126

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             SD FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  GSDMFNHLSAVSESIAALGWIAVSPK------PGPYVKEMNDAATFY  167



>ref|XP_006631263.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X2 [Lepisosteus oculatus]
Length=475

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 87/165 (53%), Gaps = 12/165 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLE ++ G  G           A +   +  F+ L+S  V +  S +++I
Sbjct  7    LVQRLEVAVGRLEAVA-GSQGDSPG----AGDAGAGTFVQEFDALVSGTVAQYCSLSQQI  61

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V    +++K AF+AQ+++L+     QKP    L+  L+P++ VI +  S  E  R S
Sbjct  62   GGDVQKHAEMIKQAFAAQRQILVIASRCQKPSDATLTSLLQPVSSVIEQVQSFREKNRSS  121

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  122  PLFNHLSAVSESVPALGWVAMAPK------PGPYVKEMQDAAMFY  160



>ref|XP_003760201.1| PREDICTED: adenylyl cyclase-associated protein 2 [Sarcophilus 
harrisii]
Length=450

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFG-HGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE+L +G  G HG    V+       PS+ AF+ L++  V      ++ 
Sbjct  7    LLERLEKAVIRLESLFSGTSGSHGECGTVNGVNGGVAPSVEAFDKLMNGMVAEFLRNSKI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVEAHAEMVHSAFQAQRAFLLLASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SQMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|NP_001253461.1| adenylyl cyclase-associated protein 2 [Macaca mulatta]
 ref|XP_005554022.1| PREDICTED: adenylyl cyclase-associated protein 2 [Macaca fascicularis]
 ref|XP_011740926.1| PREDICTED: adenylyl cyclase-associated protein 2 [Macaca nemestrina]
Length=477

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+  +    PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_011818136.1| PREDICTED: adenylyl cyclase-associated protein 2 [Colobus angolensis 
palliatus]
 ref|XP_011818137.1| PREDICTED: adenylyl cyclase-associated protein 2 [Colobus angolensis 
palliatus]
Length=477

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 86/168 (51%), Gaps = 12/168 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH---GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAA  291
            L++RLE AV+RLE+LS     H   G   EV+  +    PS+ AF+ L++  V      +
Sbjct  7    LVERLERAVSRLESLS--AVSHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEFLKNS  64

Query  292  EKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGR  471
              + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  
Sbjct  65   RILAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERN  124

Query  472  R-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  125  RGSNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_011886786.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Cercocebus 
atys]
 ref|XP_011886787.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Cercocebus 
atys]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+  +    PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>gb|EHH17975.1| Adenylyl cyclase-associated protein 2 [Macaca mulatta]
 gb|EHH52738.1| Adenylyl cyclase-associated protein 2 [Macaca fascicularis]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+  +    PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005814142.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Xiphophorus 
maculatus]
Length=430

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 88/165 (53%), Gaps = 12/165 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE+AV RLE +S    G   S    V+     P + A++D+I   V +  + +++I
Sbjct  8    LVQRLEAAVGRLEVVSGPPGGAAGSAGGAVA-----PFVEAYDDIIRGPVAQYVALSQQI  62

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V     ++K AFS+Q++LL      QKP    L+  L+P+++ I +  +  E  R S
Sbjct  63   GGDVQKHADMMKQAFSSQRQLLAAASSSQKPSDPVLTALLQPVSKAIQQVQAFREQNRTS  122

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  123  PLFNHLSAVSESVPALGWVAMAPK------PGPYVKEMQDAAMFY  161



>ref|XP_003788423.1| PREDICTED: adenylyl cyclase-associated protein 2 [Otolemur garnettii]
Length=458

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 85/168 (51%), Gaps = 8/168 (5%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAA  291
            ++L+QRLE AV+RLE LS       G   EV+       PS+ AF+ L++  V      +
Sbjct  5    QELLQRLEQAVSRLEVLSAESHRPPGDCGEVNGVNGGVAPSVEAFDKLMNGMVAEFLKNS  64

Query  292  EKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGR  471
              + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  
Sbjct  65   RILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENEVATLLKPISEKIQEIQTFRERN  124

Query  472  R-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  125  RGSNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_009202749.1| PREDICTED: RNA-binding protein 24 isoform X1 [Papio anubis]
Length=528

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+  +    PS+ AF+ L++  V      +  
Sbjct  123  LVERLERAVSRLESLSAESHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEFLKNSRI  182

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  183  LAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  242

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  243  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  282



>ref|XP_010898586.1| PREDICTED: adenylyl cyclase-associated protein 1 [Esox lucius]
Length=470

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 89/165 (54%), Gaps = 12/165 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLET++  G   G      VSA      + A++ +I+  V +  + +++I
Sbjct  7    LVQRLEVAVGRLETVAGSGGSSGGGSPGVVSA-----YVEAYDGIITGAVAQYLTLSQQI  61

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V     ++K AFS Q++LL+     QKP    L+  L P+++VI +  +  E  R S
Sbjct  62   GGDVQKHADMMKQAFSCQRQLLVTASCSQKPSDAALTALLAPVSKVIQQVQTFREQNRSS  121

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V+E    A+FY
Sbjct  122  PLFNHLSAVSESVPALGWVAMAPK------PGPYVKEMQDAAQFY  160



>ref|XP_006194351.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Camelus 
ferus]
Length=486

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVGRLELLSAGSRRPPGDCGEVNGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIHEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SEMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004761336.1| PREDICTED: adenylyl cyclase-associated protein 2 [Mustela putorius 
furo]
 ref|XP_004788046.1| PREDICTED: adenylyl cyclase-associated protein 2 [Mustela putorius 
furo]
Length=497

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE  V RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  27   LMERLERVVGRLELLSAGSHRPPGDCGEINGVIGGVAPSVEAFDKLMNNMVAEFLKKSRI  86

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P  K ++  LKP++E I    +  E  R 
Sbjct  87   LAGDVETQAEMVHSAFQAQRAFLLMASQFQQPQEKDVAALLKPISEKIQEIQTFRERNRG  146

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  147  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  186



>gb|EDL41025.1| CAP, adenylate cyclase-associated protein, 2 (yeast), isoform 
CRA_a [Mus musculus]
Length=408

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 10/167 (6%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG--GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            L++RLE AV RLE LS G  G   G   EV+       PS+ AF+ LI+  V      + 
Sbjct  7    LMERLERAVIRLEQLSAGLDGPPRGCG-EVNGVNGGVAPSVEAFDKLINSMVAEFLKNSR  65

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
             + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R
Sbjct  66   VLAGDVETHAEMVHGAFQAQRAFLLMVSQYQQPQENEVAVLLKPISEKIQEIQTFRERNR  125

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  126  GSNMFNHLSAVSESIAALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004273591.1| PREDICTED: adenylyl cyclase-associated protein 2 [Orcinus orca]
Length=483

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG-GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE+LS G     G   E++  +    PS+ AF+ L++  V      +  
Sbjct  7    LMERLEQAVGRLESLSAGLHRPPGDCGEINGVSGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_007971800.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Chlorocebus 
sabaeus]
Length=477

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 85/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+  +    PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRTPGDCGEVNGVSGGVAPSVEAFDKLMNGMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005696896.1| PREDICTED: adenylyl cyclase-associated protein 2 [Capra hircus]
Length=486

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVGRLELLSAGSHRPPGDCGEVNGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>sp|Q5R5X8.1|CAP2_PONAB RecName: Full=Adenylyl cyclase-associated protein 2; Short=CAP 
2 [Pongo abelii]
 emb|CAH92838.1| hypothetical protein [Pongo abelii]
Length=477

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+       PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIGGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|NP_001125913.1| adenylyl cyclase-associated protein 2 [Pongo abelii]
 emb|CAH91555.1| hypothetical protein [Pongo abelii]
Length=477

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+       PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIGGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_010351029.1| PREDICTED: adenylyl cyclase-associated protein 2 [Rhinopithecus 
roxellana]
Length=477

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 84/166 (51%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGDCGEVNGVTGGVAPSVEAFDKLMNGMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>emb|CAI29662.1| hypothetical protein [Pongo abelii]
Length=477

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+       PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIGGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>gb|EDL41026.1| CAP, adenylate cyclase-associated protein, 2 (yeast), isoform 
CRA_b, partial [Mus musculus]
Length=477

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 10/167 (6%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG--GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            L++RLE AV RLE LS G  G   G   EV+       PS+ AF+ LI+  V      + 
Sbjct  8    LMERLERAVIRLEQLSAGLDGPPRGCG-EVNGVNGGVAPSVEAFDKLINSMVAEFLKNSR  66

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
             + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R
Sbjct  67   VLAGDVETHAEMVHGAFQAQRAFLLMVSQYQQPQENEVAVLLKPISEKIQEIQTFRERNR  126

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  GSNMFNHLSAVSESIAALGWIAVSPK------PGPYVKEMNDAATFY  167



>ref|XP_006972903.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=481

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS    G  G   EV+       PS+ AF+ L+   V      +  
Sbjct  12   LMERLECAVSRLEQLSAASRGPPGDCGEVNGVNGGVAPSVEAFDKLVISMVAEFLKNSRV  71

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  72   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENEVAVLLKPISEKIQEIQTFREKNRG  131

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  132  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  171



>ref|NP_080332.1| adenylyl cyclase-associated protein 2 [Mus musculus]
 sp|Q9CYT6.1|CAP2_MOUSE RecName: Full=Adenylyl cyclase-associated protein 2; Short=CAP 
2 [Mus musculus]
 dbj|BAB28795.1| unnamed protein product [Mus musculus]
 dbj|BAC28143.1| unnamed protein product [Mus musculus]
 dbj|BAC29104.1| unnamed protein product [Mus musculus]
 gb|AAH50752.2| CAP, adenylate cyclase-associated protein, 2 (yeast) [Mus musculus]
 gb|AAH57937.1| CAP, adenylate cyclase-associated protein, 2 (yeast) [Mus musculus]
Length=476

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 10/167 (6%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG--GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            L++RLE AV RLE LS G  G   G   EV+       PS+ AF+ LI+  V      + 
Sbjct  7    LMERLERAVIRLEQLSAGLDGPPRGCG-EVNGVNGGVAPSVEAFDKLINSMVAEFLKNSR  65

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
             + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R
Sbjct  66   VLAGDVETHAEMVHGAFQAQRAFLLMVSQYQQPQENEVAVLLKPISEKIQEIQTFRERNR  125

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  126  GSNMFNHLSAVSESIAALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006517009.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Mus 
musculus]
Length=506

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 84/167 (50%), Gaps = 10/167 (6%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG--GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            L++RLE AV RLE LS G  G   G   EV+       PS+ AF+ LI+  V      + 
Sbjct  37   LMERLERAVIRLEQLSAGLDGPPRGCG-EVNGVNGGVAPSVEAFDKLINSMVAEFLKNSR  95

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
             + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R
Sbjct  96   VLAGDVETHAEMVHGAFQAQRAFLLMVSQYQQPQENEVAVLLKPISEKIQEIQTFRERNR  155

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  156  GSNMFNHLSAVSESIAALGWIAVSPK------PGPYVKEMNDAATFY  196



>ref|XP_006972902.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Peromyscus 
maniculatus bairdii]
Length=482

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS    G  G   EV+       PS+ AF+ L+   V      +  
Sbjct  13   LMERLECAVSRLEQLSAASRGPPGDCGEVNGVNGGVAPSVEAFDKLVISMVAEFLKNSRV  72

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  73   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENEVAVLLKPISEKIQEIQTFREKNRG  132

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  133  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  172



>ref|XP_005403463.1| PREDICTED: adenylyl cyclase-associated protein 2 [Chinchilla 
lanigera]
Length=476

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 86/171 (50%), Gaps = 18/171 (11%)
 Frame = +1

Query  121  LIQRLESAVARLETLS------TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            L++RLE AV+RLE LS       G FG     E++       PS+ AF+ L++  V    
Sbjct  7    LVERLERAVSRLEQLSAESRRPPGNFG-----EINGVNGGVAPSVEAFDKLMNSMVAEFL  61

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              ++ + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  62   RNSKILAGDVETHAEMVHGAFQAQRAFLLMASQYQQPQENEVAALLKPISEKIQEIQTFR  121

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  122  ERNRGSNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>tpg|DAA16133.1| TPA: CAP, adenylate cyclase-associated protein, 2 [Bos taurus]
Length=486

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_007950881.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Orycteropus 
afer afer]
Length=479

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 87/172 (51%), Gaps = 14/172 (8%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTG-----GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRL  279
            + L++RLE AV RLE +S       G+G  +S+   ++ AA  P + AF+ L++  V   
Sbjct  5    QNLVERLEKAVGRLEAVSQASDMHRGYGDSSSKSKSIAGAA--PHVQAFDLLLAGPVAEY  62

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
               +++IGG V    ++V      ++ LL+     Q+P    LSE L P++E I    + 
Sbjct  63   LKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSELLAPISEQIQEVITF  122

Query  460  TEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             E  R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  123  REKNRGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKEMNDAAMFY  168



>ref|XP_006972904.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X3 [Peromyscus 
maniculatus bairdii]
Length=476

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS    G  G   EV+       PS+ AF+ L+   V      +  
Sbjct  7    LMERLECAVSRLEQLSAASRGPPGDCGEVNGVNGGVAPSVEAFDKLVISMVAEFLKNSRV  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENEVAVLLKPISEKIQEIQTFREKNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>emb|CDQ79594.1| unnamed protein product [Oncorhynchus mykiss]
Length=463

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 87/165 (53%), Gaps = 13/165 (8%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV+RLE +S               +      + A++ +I+  VG+  + +++I
Sbjct  7    LVQRLEVAVSRLEAVSG------DGGGSAGGSGVVAAYVEAYDAIITGSVGQYMTLSQQI  60

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V     ++K AFS Q++LL+ +   QKP    L+  L P+++VI +  +  E  R S
Sbjct  61   GGDVQKHADMMKQAFSCQRQLLVTSSCSQKPSDASLTALLAPVSKVIQQVQTFREQNRSS  120

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V+E    A+FY
Sbjct  121  PLFNHLSAVSESVPALGWVAMAPK------PGPYVKEMQDAAQFY  159



>ref|NP_001092449.1| adenylyl cyclase-associated protein 2 [Bos taurus]
 gb|AAI42455.1| CAP2 protein [Bos taurus]
Length=486

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006072568.1| PREDICTED: adenylyl cyclase-associated protein 2 [Bubalus bubalis]
Length=486

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005898287.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Bos 
mutus]
 ref|XP_010847100.1| PREDICTED: adenylyl cyclase-associated protein 2 [Bison bison 
bison]
 gb|ELR54625.1| Adenylyl cyclase-associated protein 2 [Bos mutus]
Length=486

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004593187.1| PREDICTED: adenylyl cyclase-associated protein 2 [Ochotona princeps]
Length=477

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS    G  G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LMERLEQAVSRLEQLSAECHGPPGHCGEVNGVNGGVAPSVEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLVLASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SAMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_010816777.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Bos 
taurus]
Length=492

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  13   LMERLERAVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  72

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  73   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  132

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  133  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  172



>ref|XP_007129231.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Physeter 
catodon]
Length=501

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG-GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++  +    PS+ AF+ L++  V      +  
Sbjct  25   LMERLEQAVGRLELLSAGLHRPPGDCGEINGVSGGVTPSVEAFDKLMNSMVAEFLKNSRI  84

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  85   LAGDVETHAEMVHGAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  144

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  145  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  184



>ref|XP_003263591.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform 1 [Nomascus 
leucogenys]
Length=477

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+       PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGDCGEVNGVIGGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_007129232.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Physeter 
catodon]
Length=483

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG-GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++  +    PS+ AF+ L++  V      +  
Sbjct  7    LMERLEQAVGRLELLSAGLHRPPGDCGEINGVSGGVTPSVEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHGAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005329199.1| PREDICTED: adenylyl cyclase-associated protein 2 [Ictidomys tridecemlineatus]
Length=485

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 84/173 (49%), Gaps = 8/173 (5%)
 Frame = +1

Query  100  RIEMDEKLIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGR  276
            R+E  + L++RLE AV RLE LS       G   EV+       PS+ AF+ L+   V  
Sbjct  9    RMEDMQGLVERLERAVCRLEQLSAESHKPPGNCGEVNGVHGGVAPSVEAFDKLMDSVVAE  68

Query  277  LSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSS  456
                +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +
Sbjct  69   FLKNSRILAGDVDTHAEMVHGAFQAQRAFLLMASQYQQPQENEVAALLKPISEKIQEIQT  128

Query  457  LTEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              E  R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  129  FRERNRGSSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  175



>ref|XP_004548966.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Maylandia 
zebra]
Length=472

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 86/165 (52%), Gaps = 12/165 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLE +S  G   G S    VSA      +  F+D+I   +    S ++KI
Sbjct  7    LVQRLEVAVGRLEAMSGPGGSAGGSDGGAVSA-----HVEGFDDIIKGPLAEYLSLSQKI  61

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V    +++K  F+ +++LLI     QKP    L+  L+P++ VI +  +  E  R S
Sbjct  62   GGDVQKHAEMMKQGFTTERQLLITASTSQKPSDAVLTTLLQPVSSVIQQVQAFREQNRSS  121

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  122  PLFNHLSAVSESVPALGWVAMAPK------PGPYVKEMQDAATFY  160



>ref|XP_007197231.1| PREDICTED: adenylyl cyclase-associated protein 2 [Balaenoptera 
acutorostrata scammoni]
Length=486

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTG-GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   E++  +    PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVGRLELLSAGLHRPPGDCGEINGVSGGVAPSVEAFDRLMNSTVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASHYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|NP_001133556.1| Adenylyl cyclase-associated protein 1 [Salmo salar]
 gb|ACI33472.1| Adenylyl cyclase-associated protein 1 [Salmo salar]
Length=467

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 89/165 (54%), Gaps = 13/165 (8%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLE +S  G G      V  +       + A++ +I+  VG+  + +++I
Sbjct  7    LVQRLEVAVGRLEAVSGDGGGSAGGDGVVAAY------VEAYDGIITGSVGQYMTLSQQI  60

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V     ++K AFS Q++LL+ +   QKP    L+  L P+++VI +  +  E  R S
Sbjct  61   GGDVQKHADMMKQAFSCQRQLLVTSSCSQKPSDASLTALLAPVSKVIQQVQTFREQNRSS  120

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V+E    A+FY
Sbjct  121  PLFNHLSAVSESVPALGWVAMAPK------PGPYVKEMQDAAQFY  159



>ref|XP_004847694.1| PREDICTED: adenylyl cyclase-associated protein 2 [Heterocephalus 
glaber]
Length=476

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 85/171 (50%), Gaps = 18/171 (11%)
 Frame = +1

Query  121  LIQRLESAVARLETLS------TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            L++RLE AV+RLE LS       GG G     EV+       PS+ AF+ L++  V    
Sbjct  7    LVERLERAVSRLEQLSAESHRPPGGCG-----EVNGVNGGVAPSVEAFDKLMNSMVAEFL  61

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  62   RNSRILAGDVETHAEMVHGAFQAQRSFLLMASQYQQPQENEVAALLKPISEKIQEIQTFR  121

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  122  ERNRGSNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_007950151.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Orycteropus 
afer afer]
Length=477

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS       G   EV+       PSI AF+ L++  V      +  
Sbjct  7    LMERLEQAVVRLELLSAESHRPPGDCGEVNGVNGGVAPSIEAFDKLMNSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005964471.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Pantholops 
hodgsonii]
Length=419

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 74/141 (52%), Gaps = 2/141 (1%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+     + PS+ AF+ LI+  V    + +  
Sbjct  4    LMERLERAVGRLELLSAGSHRPPGDCGEVNGVNGGAAPSVEAFDKLINSIVAEFLNKSRI  63

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  64   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  123

Query  475  SDFFNHLKAATDSLTALAWIA  537
            S  FNHL A ++S+ AL WIA
Sbjct  124  STMFNHLSAVSESIPALGWIA  144



>gb|EPQ11934.1| Adenylyl cyclase-associated protein 2 [Myotis brandtii]
Length=541

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 90/186 (48%), Gaps = 17/186 (9%)
 Frame = +1

Query  67   EKFREGVNP*LRIEMDEKLIQRLESAVARLETLSTGGFGH---GTSREVDVSAAASDPSI  237
            EK R G     ++E  + L++RLE AV RLE LS     H   G   E++       PS+
Sbjct  58   EKLRFG-----KMEAMQGLVERLEQAVGRLELLS--AVSHRPPGDCGEINGVNGGVAPSV  110

Query  238  VAFEDLISQCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEF  417
             AF+ L++  V      +  + G V    ++V  AF AQ+  L+     Q+P    ++  
Sbjct  111  EAFDKLMNSTVAEFLKKSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAAL  170

Query  418  LKPLNEVIMRGSSLTEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESW  594
            LKP++E I    +  E  R S  FNHL A ++S+ AL WIA + K      P  +V+E  
Sbjct  171  LKPISEKIQEIQTFRERNRGSTMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMN  224

Query  595  QMAEFY  612
              A FY
Sbjct  225  DAATFY  230



>gb|ELQ40478.1| adenylyl cyclase-associated protein [Magnaporthe oryzae Y34]
Length=506

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 88/193 (46%), Gaps = 35/193 (18%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF--------------------GHGTSREVDVSAAASDP---  231
            LI+RLE+A  RLE +++                         G S       AA DP   
Sbjct  12   LIKRLEAATLRLEDIASSTIDLPQAVPSLSTTQPTPSATPAPGASAPTSTPPAAQDPLPE  71

Query  232  SIVAFEDLISQCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKG--  405
            SI  F+  I++ V   ++ + KIGG V +  K++   F  Q++ L+ T   +KPDM G  
Sbjct  72   SIEDFDLFITESVNNYANLSGKIGGPVAEQAKLLSKGFQLQRQFLLMTTKAKKPDMNGSD  131

Query  406  ---LSEFLKPLNEVIMRGSSLTEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPI  573
                 + LKP++EVIM    + +  R S+FFNHL    +++  LAW+    K      P 
Sbjct  132  QSLWQDLLKPMSEVIMSVQGIKDANRGSEFFNHLSTTAEAVMVLAWVTVEPK------PF  185

Query  574  AHVEESWQMAEFY  612
             HV+     A+ +
Sbjct  186  KHVDVCMDSAQLF  198



>ref|XP_010621211.1| PREDICTED: adenylyl cyclase-associated protein 2 [Fukomys damarensis]
 gb|KFO33819.1| Adenylyl cyclase-associated protein 2 [Fukomys damarensis]
Length=472

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 85/171 (50%), Gaps = 18/171 (11%)
 Frame = +1

Query  121  LIQRLESAVARLETLST------GGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            L++RLE AV+RLE LS       GG G     EV+  +    PS+ AF+ L++  V    
Sbjct  7    LVERLERAVSRLEHLSAESHRLPGGCG-----EVNGVSGGVAPSVEAFDKLMNSMVAEFL  61

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  62   RNSRTLAGDVETHAEMVHGAFQAQRAFLLMASQYQQPQENEVAALLKPISEKIQEIQTFR  121

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  122  ERNRGSTMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_003714719.1| adenylyl cyclase-associated protein [Magnaporthe oryzae 70-15]
 gb|EHA54912.1| adenylyl cyclase-associated protein [Magnaporthe oryzae 70-15]
 gb|ELQ64750.1| adenylyl cyclase-associated protein [Magnaporthe oryzae P131]
Length=533

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 88/193 (46%), Gaps = 35/193 (18%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF--------------------GHGTSREVDVSAAASDP---  231
            LI+RLE+A  RLE +++                         G S       AA DP   
Sbjct  12   LIKRLEAATLRLEDIASSTIDLPQAVPSLSTTQPTPSATPAPGASAPTSTPPAAQDPLPE  71

Query  232  SIVAFEDLISQCVGRLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKG--  405
            SI  F+  I++ V   ++ + KIGG V +  K++   F  Q++ L+ T   +KPDM G  
Sbjct  72   SIEDFDLFITESVNNYANLSGKIGGPVAEQAKLLSKGFQLQRQFLLMTTKAKKPDMNGSD  131

Query  406  ---LSEFLKPLNEVIMRGSSLTEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPI  573
                 + LKP++EVIM    + +  R S+FFNHL    +++  LAW+    K      P 
Sbjct  132  QSLWQDLLKPMSEVIMSVQGIKDANRGSEFFNHLSTTAEAVMVLAWVTVEPK------PF  185

Query  574  AHVEESWQMAEFY  612
             HV+     A+ +
Sbjct  186  KHVDVCMDSAQLF  198



>ref|XP_008691010.1| PREDICTED: adenylyl cyclase-associated protein 2 [Ursus maritimus]
Length=475

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 81/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE  V RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERVVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRTFLVMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_007655721.1| PREDICTED: LOW QUALITY PROTEIN: adenylyl cyclase-associated protein 
1 [Ornithorhynchus anatinus]
Length=416

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 82/167 (49%), Gaps = 9/167 (5%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            + L++RLE AV RLE +S    GHG   +      A  P + AF+ L++  V      ++
Sbjct  5    QHLVERLEKAVGRLEAVSQAPGGHGGCGDAVPKGVA--PFVQAFDSLLAGPVAEYMRISK  62

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
            +IGG V    ++V      ++ LL+     Q+P    LS+ L P++E I    +  E  R
Sbjct  63   EIGGDVQKHAEMVHTGLKTERALLVMASQCQQPSGNKLSDLLGPISEQIQGVQNFREKNR  122

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  123  GSRLFNHLSAVSESIPALGWVAMAPK------PGPYVKEMNDAAMFY  163



>ref|XP_005656149.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X6 [Sus scrofa]
 ref|XP_005656150.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X7 [Sus scrofa]
Length=174

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 84/172 (49%), Gaps = 19/172 (11%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTG-----GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRL  279
            + L++RLE AV RLE +S       G+G       D +A  + P + AF+ L++  V   
Sbjct  5    QNLVERLERAVGRLEAVSHASDTHCGYG-------DSAAKGAAPYVQAFDSLLAGPVAEY  57

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
               +++IGG V    ++V      ++ LL+     Q+P    LSE L P++E I    + 
Sbjct  58   LKISKEIGGDVQKHAEMVHTGLKLEQALLVTASQCQQPVGNKLSELLAPISEQIQEVITF  117

Query  460  TEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             E  R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  118  REKNRGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKEMNDAAMFY  163



>ref|XP_003969232.1| PREDICTED: adenylyl cyclase-associated protein 1 [Takifugu rubripes]
Length=462

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 87/165 (53%), Gaps = 14/165 (8%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV+RLE++S  G   G S  V V        + AF+++I   V +  S ++KI
Sbjct  7    LVQRLEVAVSRLESVSGSGGSAGESAAVSVY-------VEAFDEIIQGPVAQYVSLSQKI  59

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V     ++K  FS+Q++LL+     QKP     +  L+P++++I +  S  E  R S
Sbjct  60   GGDVQKHADMIKQGFSSQRQLLLTASTSQKPSDAVFTSLLQPMSKIIQQVQSFREQNRTS  119

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+  L W+A   K      P  +V +    A FY
Sbjct  120  ALFNHLSAVSESVPGLGWVAMAPK------PGPYVRDMQDAAMFY  158



>ref|XP_010593550.1| PREDICTED: adenylyl cyclase-associated protein 1 [Loxodonta africana]
 ref|XP_010593551.1| PREDICTED: adenylyl cyclase-associated protein 1 [Loxodonta africana]
 ref|XP_010593552.1| PREDICTED: adenylyl cyclase-associated protein 1 [Loxodonta africana]
Length=457

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 18/172 (10%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTG-----GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRL  279
            + L++RLE AV RLE +S       G+G   S+      A + P + AF+ L++  V   
Sbjct  5    QNLVERLERAVGRLEAVSHASDMHCGYGDSPSK------AGAAPYVQAFDSLLASPVAEY  58

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
               +++IGG V    ++V      ++ LL+     Q+P    LSE L P++E I   ++ 
Sbjct  59   LKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSELLAPISEQIQEVTTF  118

Query  460  TEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             E  R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  119  REKNRGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKEMNDAAMFY  164



>ref|XP_009579928.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Fulmarus glacialis]
Length=177

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 86/170 (51%), Gaps = 15/170 (9%)
 Frame = +1

Query  121  LIQRLESAVARLETL-----STGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            L++RLE AV RLE+L      +GG  +     V+ S A   P + AF+ L++  V     
Sbjct  7    LMERLEKAVTRLESLFSDSHRSGGMEYDAINGVNGSIA---PYVEAFDKLVNGSVAEFLR  63

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
             ++ + G V    ++V+ AF AQ+  L+     Q+P    ++  LKP++E I    +  E
Sbjct  64   YSKILEGDVKTHAEMVRAAFQAQRSFLVLASQCQEPQENEVAMLLKPISEKIQEIQNFRE  123

Query  466  GRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  124  RNRGSKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  167



>gb|EFB21042.1| hypothetical protein PANDA_016728, partial [Ailuropoda melanoleuca]
Length=474

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 80/166 (48%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE  V RLE LS G     G   E++       PS+ AF+ L+   V      +  
Sbjct  7    LMERLERVVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMDSMVAEFLKKSRV  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLVMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004667990.1| PREDICTED: adenylyl cyclase-associated protein 2 [Jaculus jaculus]
Length=472

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 83/166 (50%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  7    LVERLEHAVSRLELLSAGSHRSPGDCGEINGVIEGVAPSVEAFDKLMNGMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVQTHAEMVHGAFQAQRAFLLMASQYQQPQENEVAALLKPISEKIQDIQAFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL W+A + K      P  +V+E    A FY
Sbjct  127  SSMFNHLSAVSESIPALGWVAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004882922.1| PREDICTED: adenylyl cyclase-associated protein 2 [Heterocephalus 
glaber]
 gb|EHB01844.1| Adenylyl cyclase-associated protein 2 [Heterocephalus glaber]
Length=476

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 85/171 (50%), Gaps = 18/171 (11%)
 Frame = +1

Query  121  LIQRLESAVARLETLS------TGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            L++RLE AV+RLE LS       GG G     EV+       PS+ AF+ L++  V    
Sbjct  7    LVERLERAVSRLEQLSAESHRPPGGCG-----EVNGVNGGVAPSVEAFDKLMNGMVAEFL  61

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  62   RNSRILAGDVETHAEMVHGAFQAQRSFLLMASQYQQPQENEVAALLKPISEKIQEIQTFR  121

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  122  ERNRGSNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006091808.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Myotis 
lucifugus]
Length=477

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 85/174 (49%), Gaps = 12/174 (7%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGH---GTSREVDVSAAASDPSIVAFEDLISQCVG  273
            +E  + L++RLE AV RLE LS     H   G   E++       PS+ AF+ L++  V 
Sbjct  1    MEAMQGLVERLEQAVGRLELLS--AVSHRPPGNCGEINGVNGGVAPSVEAFDKLMNSTVA  58

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
                 +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    
Sbjct  59   EFLKKSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQ  118

Query  454  SLTEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            +  E  R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  119  TFRERNRGSTMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_002927031.1| PREDICTED: adenylyl cyclase-associated protein 2 [Ailuropoda 
melanoleuca]
Length=475

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 80/166 (48%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE  V RLE LS G     G   E++       PS+ AF+ L+   V      +  
Sbjct  7    LMERLERVVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMDSMVAEFLKKSRV  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLVMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006764135.1| PREDICTED: adenylyl cyclase-associated protein 2 [Myotis davidii]
Length=477

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 85/174 (49%), Gaps = 12/174 (7%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGH---GTSREVDVSAAASDPSIVAFEDLISQCVG  273
            +E  + L++RLE AV RLE LS     H   G   E++       PS+ AF+ L++  V 
Sbjct  1    MEAMQGLVERLEQAVGRLELLS--AVSHRPPGNCGEINGVNGGVAPSVEAFDKLMNSTVA  58

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
                 +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    
Sbjct  59   EFLKKSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQ  118

Query  454  SLTEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            +  E  R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  119  TFRERNRGSTMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005656145.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X2 [Sus scrofa]
 ref|XP_005656146.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X3 [Sus scrofa]
 ref|XP_005656147.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X4 [Sus scrofa]
 ref|XP_005656148.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X5 [Sus scrofa]
Length=175

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 84/170 (49%), Gaps = 14/170 (8%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGG---FGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            + L++RLE AV RLE +S       G+G S     + A + P + AF+ L++  V     
Sbjct  5    QNLVERLERAVGRLEAVSHASDTHCGYGDS----AAKAGAAPYVQAFDSLLAGPVAEYLK  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
             +++IGG V    ++V      ++ LL+     Q+P    LSE L P++E I    +  E
Sbjct  61   ISKEIGGDVQKHAEMVHTGLKLEQALLVTASQCQQPVGNKLSELLAPISEQIQEVITFRE  120

Query  466  GRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  121  KNRGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKEMNDAAMFY  164



>ref|XP_006888731.1| PREDICTED: adenylyl cyclase-associated protein 2 [Elephantulus 
edwardii]
Length=473

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 81/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLST-GGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS       G   EV+  +    PSI AF+ L+   V      +  
Sbjct  7    LMERLERAVVRLEELSAESQRSTGDCGEVNGVSGGVAPSIEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>emb|CAI46134.1| hypothetical protein [Homo sapiens]
Length=394

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 75/143 (52%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYT  543
            S+ FNHL A ++S+ AL WIA +
Sbjct  127  SNMFNHLSAVSESIPALGWIAVS  149



>ref|XP_004704997.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Echinops 
telfairi]
Length=474

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 81/167 (49%), Gaps = 9/167 (5%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            + L++RLE AV RLE +S G   H          AA  P + AF+ L++  V      ++
Sbjct  5    QNLVERLEKAVGRLEAVSQGSDMHRGXXXXXXXGAA--PHVQAFDSLLAGLVAEYLKISK  62

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
            +IGG V    ++V      ++ LL+     Q+P    LSE L P++E I    +  E  R
Sbjct  63   EIGGDVQKHAEMVHTGLQLERALLVTASQCQQPAGNKLSELLTPISEQIQEVITFREKNR  122

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  123  GSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKELTDAAMFY  163



>ref|XP_004665349.1| PREDICTED: adenylyl cyclase-associated protein 1 [Jaculus jaculus]
Length=474

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 85/172 (49%), Gaps = 19/172 (11%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTG-----GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRL  279
            + L++RLE AV RLE +S       G+G       D S+  + P + AF+ L++  V   
Sbjct  5    QTLVERLERAVGRLEAVSHTSDMHCGYG-------DSSSKGAVPYVQAFDSLLANPVAEY  57

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
               +++IGG V    ++V      ++ LL+     Q+P    LS+ L P++E I    + 
Sbjct  58   LKMSQEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVITF  117

Query  460  TEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             E  R S  FNHL A ++S+ AL W+A TGK      P   V+E    A FY
Sbjct  118  REKNRGSKLFNHLSAVSESVQALGWVALTGK------PGPFVKEMTDAAMFY  163



>ref|XP_003765456.1| PREDICTED: adenylyl cyclase-associated protein 1 [Sarcophilus 
harrisii]
Length=475

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 81/167 (49%), Gaps = 8/167 (5%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            + L++RLE AV RLE +S     HG   +       + P + AF+ L++  V      ++
Sbjct  5    QNLVERLEKAVGRLEAVSHSSGMHGGCGDSSPKGGVA-PYVEAFDSLLAGPVAEYLKISK  63

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
            +IGG V    ++V      ++ LL+     Q+PD   LS  L P++E I    +  E  R
Sbjct  64   EIGGDVQKHAEMVHTGLKIERSLLVTASQCQQPDGNKLSSLLTPISEQIQEVQTFREKNR  123

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  124  GSKLFNHLSAVSESIPALGWVAMAPK------PGPYVKEMNDAAMFY  164



>ref|XP_006165585.1| PREDICTED: adenylyl cyclase-associated protein 2 [Tupaia chinensis]
Length=476

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS       G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERAVSRLELLSAASHRPPGDCGEVNGVNGGVAPSVEAFDKLMNNMVAVFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_004406084.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform 1 [Odobenus 
rosmarus divergens]
Length=477

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 81/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE  V RLE LS G     G   E++       PS+ AF+ L++  V      +  
Sbjct  7    LMERLERVVGRLELLSAGSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRTFLLMASQYQQPQENDVAVLLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  SKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006867667.1| PREDICTED: adenylyl cyclase-associated protein 1 [Chrysochloris 
asiatica]
Length=388

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 83/170 (49%), Gaps = 14/170 (8%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGG---FGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            + L++RLE AV RLE +S       GHG S     S A   P + AF+ L++  V     
Sbjct  5    QNLVERLEKAVGRLEAVSQVSDMHRGHGDSS----SKAGVAPHVQAFDSLLAGPVAEYLK  60

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
             +++IGG V    ++V      ++ LL+     Q+P    LSE L P++E I    +  E
Sbjct  61   ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPTSNKLSELLTPISEQIQEVITFRE  120

Query  466  GRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  121  KNRGSKLFNHLSAISESIQALGWVAMAPK------PGPYVKELNDAATFY  164



>ref|XP_005873097.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Myotis 
brandtii]
Length=477

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 85/174 (49%), Gaps = 12/174 (7%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGH---GTSREVDVSAAASDPSIVAFEDLISQCVG  273
            +E  + L++RLE AV RLE LS     H   G   E++       PS+ AF+ L++  V 
Sbjct  1    MEAMQGLVERLEQAVGRLELLS--AVSHRPPGDCGEINGVNGGVAPSVEAFDKLMNSTVA  58

Query  274  RLSSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGS  453
                 +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    
Sbjct  59   EFLKKSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQ  118

Query  454  SLTEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            +  E  R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  119  TFRERNRGSTMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_009968334.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Tyto alba]
Length=177

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 86/170 (51%), Gaps = 15/170 (9%)
 Frame = +1

Query  121  LIQRLESAVARLETL-----STGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            L++RLE AV RLE+L      +GG  +     V+ S A   P + AF+ L++  V     
Sbjct  7    LMERLEKAVTRLESLFSDSHRSGGMEYDAINGVNGSIA---PYVEAFDRLLNGSVAEFLR  63

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
             ++ + G V    ++V+ AF AQ+  L+     Q+P    ++  LKP++E I    +  E
Sbjct  64   YSKILEGDVKTHAEMVRAAFQAQRSFLVLASQCQEPQENEVAMLLKPISEKIQEIQNFRE  123

Query  466  GRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  124  RNRGSKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  167



>dbj|BAH11460.1| unnamed protein product [Homo sapiens]
Length=413

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 2/141 (1%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE+LS       G   EV+   A   PS+ AF+ L+   V      +  
Sbjct  7    LVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIA  537
            S+ FNHL A ++S+ AL WIA
Sbjct  127  SNMFNHLSAVSESIPALGWIA  147



>gb|ELR49684.1| Adenylyl cyclase-associated protein 1 [Bos mutus]
Length=476

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 83/168 (49%), Gaps = 10/168 (6%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGG---FGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAA  291
            L++RLE  V RLE +S       G+G S   D +A  + P + AF+ L++  V      +
Sbjct  7    LVERLERVVGRLEAVSHASDTHCGYGDSAAKDSAAKGTTPYVQAFDSLLAGPVAEYLKIS  66

Query  292  EKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGR  471
            ++IGG V    ++V      ++ LL+     Q+P    LS+ L P++E I    +  E  
Sbjct  67   KEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVVTFREKN  126

Query  472  R-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  127  RGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKEMNDAAMFY  168



>ref|XP_009863973.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Apaloderma vittatum]
Length=177

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 86/170 (51%), Gaps = 15/170 (9%)
 Frame = +1

Query  121  LIQRLESAVARLETL-----STGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            L++RLE AV RLE+L      +GG        V+ S A   P + AF+ L++  V     
Sbjct  7    LMERLEKAVTRLESLFSDSHRSGGMDCDAINGVNGSVA---PYVEAFDRLLNGSVAEFLR  63

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
             ++ + G V    ++V+ AF AQ+  L+     Q+P    ++  LKP++E I    +  E
Sbjct  64   YSKILEGDVKTHAEMVRAAFQAQRSFLVLASQCQEPQENEVAMLLKPISEKIQEIQTFRE  123

Query  466  GRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  124  RNRGSEMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  167



>ref|XP_006198682.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X3 [Vicugna 
pacos]
Length=422

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 73/141 (52%), Gaps = 2/141 (1%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV RLE LS G     G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LVERLERAVGRLELLSAGSHRPPGDCGEVNGVNGGVAPSVEAFDKLMNSMVAEFLKKSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIHEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIA  537
            S+ FNHL A ++S+ AL WIA
Sbjct  127  SEMFNHLSAVSESIPALGWIA  147



>ref|XP_006861078.1| PREDICTED: adenylyl cyclase-associated protein 2 [Chrysochloris 
asiatica]
Length=472

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 85/171 (50%), Gaps = 18/171 (11%)
 Frame = +1

Query  121  LIQRLESAVARLETL------STGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            L++RLE A+ RLE L      ++G FG     +V+       PS+ AF+ L++  V    
Sbjct  7    LMERLERAIVRLELLFAESHRTSGDFG-----DVNGVNGGVAPSVEAFDKLMNSMVAEFL  61

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  62   KNSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVTALLKPISEKIQEIQTFR  121

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S+ FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  122  ERNRGSNMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005494743.1| PREDICTED: adenylyl cyclase-associated protein 1 [Zonotrichia 
albicollis]
Length=471

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 83/167 (50%), Gaps = 12/167 (7%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            E+L++RLE AV RLE +  G    G     DVSA      + AF+ L++  V   +  + 
Sbjct  10   ERLVERLEKAVERLENVCQGPGMCG-----DVSAKGVAQYVQAFDALLAGPVAEYTKISR  64

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
            ++GG V    ++V     +++ LL+     Q+P     SE LKP++E I    +  E  R
Sbjct  65   EVGGDVQKHAEMVHAGLMSERALLVVASQHQQPAENAFSELLKPISEQIQAVQNFREKNR  124

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  125  GSKLFNHLSAVSESIPALGWVAMAPK------PGPYVKEMTDAAMFY  165



>ref|XP_004704996.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Echinops 
telfairi]
Length=475

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 82/168 (49%), Gaps = 10/168 (6%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGH-GTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAA  291
            + L++RLE AV RLE +S G   H G         AA  P + AF+ L++  V      +
Sbjct  5    QNLVERLEKAVGRLEAVSQGSDMHRGXXXXXXXXGAA--PHVQAFDSLLAGLVAEYLKIS  62

Query  292  EKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGR  471
            ++IGG V    ++V      ++ LL+     Q+P    LSE L P++E I    +  E  
Sbjct  63   KEIGGDVQKHAEMVHTGLQLERALLVTASQCQQPAGNKLSELLTPISEQIQEVITFREKN  122

Query  472  R-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  123  RGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKELTDAAMFY  164



>ref|XP_005993962.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Latimeria 
chalumnae]
 ref|XP_005993963.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Latimeria 
chalumnae]
 ref|XP_005993964.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Latimeria 
chalumnae]
Length=469

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 82/165 (50%), Gaps = 10/165 (6%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L++RLE AV RLE ++  G  HG   E    AA   P + AF+  +S  V +    +++I
Sbjct  7    LVERLEKAVGRLELMAQSGGIHGGGSEAGGDAA---PYVEAFDAQLSGPVSQYLKLSKEI  63

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-S  477
            GG V    ++V +    Q+ +L+     QKP  K L E LKPL+  I +     E  R S
Sbjct  64   GGDVQVHAEMVSEGLKLQRCILVMASRCQKPGEKELMELLKPLSSKIQQVQDFRERNRGS  123

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P   V+E    A FY
Sbjct  124  KVFNHLSAISESVMALNWVAVAPK------PGPFVKEMMDAAMFY  162



>ref|XP_005656154.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X11 [Sus scrofa]
Length=172

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 21/172 (12%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTG-----GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRL  279
            + L++RLE AV RLE +S       G+G       D +A  + P + AF+ L++  V   
Sbjct  5    QNLVERLERAVGRLEAVSHASDTHCGYG-------DSAAKGAAPYVQAFDSLLAGPVAEY  57

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
               +++IGG V    ++V      ++ LL+     Q+P+   LSE L P++E I    + 
Sbjct  58   LKISKEIGGDVQKHAEMVHTGLKLEQALLVTASQCQQPN--KLSELLAPISEQIQEVITF  115

Query  460  TEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             E  R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  116  REKNRGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKEMNDAAMFY  161



>ref|XP_008588043.1| PREDICTED: adenylyl cyclase-associated protein 2 [Galeopterus 
variegatus]
Length=474

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 84/168 (50%), Gaps = 12/168 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSR---EVDVSAAASDPSIVAFEDLISQCVGRLSSAA  291
            L++R+E AV+RLE+LS     H   R   EV+       PS+ AF+ L++  V      +
Sbjct  7    LLERMERAVSRLESLSAES--HRPPRHCGEVNGVNGGVAPSVEAFDKLMNGMVAEFLKNS  64

Query  292  EKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGR  471
              + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  
Sbjct  65   RILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERN  124

Query  472  R-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  125  RGSSMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_005739752.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Pundamilia 
nyererei]
Length=472

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 86/165 (52%), Gaps = 12/165 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLE +S  G   G S    VSA      +  F+++I   +    S ++KI
Sbjct  7    LVQRLEVAVGRLEAMSGPGGSAGGSDGGAVSA-----HVEGFDEIIKGPLAEYLSLSQKI  61

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V    +++K  F+ +++LLI     QKP    L+  L+P++ VI +  +  E  R S
Sbjct  62   GGDVQKHAEMMKQGFTTERQLLITASTSQKPSDAVLTTLLQPVSSVIQQVQAFREQNRSS  121

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +++E    A FY
Sbjct  122  PLFNHLSAVSESVPALGWVAMAPK------PGPYIKEMQDAATFY  160



>ref|XP_002720911.1| PREDICTED: adenylyl cyclase-associated protein 2 [Oryctolagus 
cuniculus]
Length=476

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 82/166 (49%), Gaps = 8/166 (5%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGF-GHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEK  297
            L++RLE AV+RLE LS       G   EV+       PS+ AF+ L++  V      +  
Sbjct  7    LMERLEHAVSRLEQLSAESHRPPGDCGEVNGVNGGVAPSVEAFDKLMNGMVAEFLKNSRI  66

Query  298  IGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR-  474
            + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  E  R 
Sbjct  67   LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFRERNRG  126

Query  475  SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  127  STMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  166



>ref|XP_006091809.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Myotis 
lucifugus]
Length=475

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 84/171 (49%), Gaps = 8/171 (5%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            +E  + L++RLE AV RLE L++    +        S   + PS+ AF+ L++  V    
Sbjct  1    MEAMQGLVERLEQAVGRLELLTSCSLNYQGITTCPSSKGVA-PSVEAFDKLMNSTVAEFL  59

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  60   KKSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFR  119

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  120  ERNRGSTMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  164



>ref|XP_005873098.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Myotis 
brandtii]
Length=475

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 84/171 (49%), Gaps = 8/171 (5%)
 Frame = +1

Query  103  IEMDEKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLS  282
            +E  + L++RLE AV RLE L++    +        S   + PS+ AF+ L++  V    
Sbjct  1    MEAMQGLVERLEQAVGRLELLTSCSLNYQGITTCPSSKGVA-PSVEAFDKLMNSTVAEFL  59

Query  283  SAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLT  462
              +  + G V    ++V  AF AQ+  L+     Q+P    ++  LKP++E I    +  
Sbjct  60   KKSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEIQTFR  119

Query  463  EGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            E  R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  120  ERNRGSTMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  164



>ref|XP_002196792.2| PREDICTED: adenylyl cyclase-associated protein 1 [Taeniopygia 
guttata]
Length=465

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 12/167 (7%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            E+L++RLE AV RLET+  G    G     D  A      + AF+ L++  V   +  + 
Sbjct  2    ERLVERLEKAVERLETVCQGPGMCG-----DAPAKGVAQYVQAFDALLAGPVAEFTKISR  56

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
            ++GG V    ++V +   +++ LL+     Q+P     SE LKP++E I    +  E  R
Sbjct  57   EVGGDVQKHAEMVHEGLMSERALLVVASQHQQPAENVFSELLKPISEQIQAVQNFREKNR  116

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  117  GSKLFNHLSAVSESIPALGWVAMAPK------PGPYVKEMTDAAMFY  157



>ref|XP_005058254.1| PREDICTED: adenylyl cyclase-associated protein 1 [Ficedula albicollis]
Length=482

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 82/167 (49%), Gaps = 12/167 (7%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAE  294
            E L++RLE AV RLET+  G    G     D SA      + AF+ L++  V   S  + 
Sbjct  17   EGLVERLEKAVERLETVCQGPGMCG-----DASAKGVAQYVQAFDALLAGPVAEYSKISR  71

Query  295  KIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGRR  474
            ++GG V    ++V     +++ LL+     Q+P     SE LKP++E I    +  E  R
Sbjct  72   EVGGDVQKHAEMVHAGLMSERALLVVASQHQQPAENAFSELLKPISEQIQAVQNFREKNR  131

Query  475  -SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  132  GSKLFNHLSAVSESIPALGWVAMAPK------PGPYVKEMTDAAMFY  172



>emb|CAF92650.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=495

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 86/165 (52%), Gaps = 14/165 (8%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSSAAEKI  300
            L+QRLE AV RLE++S               +AA    + AF++++   V +  S ++KI
Sbjct  7    LVQRLEVAVTRLESVSG-------PGGSSGESAAVSVYVEAFDEIVQGSVAQYISLSQKI  59

Query  301  GGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE-GRRS  477
            GG V     ++K  FS Q++LL+K    QKP     +  L+P+++VI +  S  E  R S
Sbjct  60   GGDVQKHADMMKQGFSNQRQLLLKASTSQKPSDAVFTTLLQPISKVIQQVQSFREQNRTS  119

Query  478  DFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              FNHL A ++S+ AL W+A   K      P  +V++    A FY
Sbjct  120  PLFNHLSAVSESVPALGWVAMAPK------PGPYVKDMQDAAMFY  158



>ref|XP_010305303.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Balearica regulorum gibbericeps]
Length=235

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 84/168 (50%), Gaps = 11/168 (7%)
 Frame = +1

Query  121  LIQRLESAVARLETLSTGGFGHGTSREVDVSAAASD---PSIVAFEDLISQCVGRLSSAA  291
            L++RLE AV RLE+L +   G G   E D     +    P + AF+ L++  V      +
Sbjct  7    LMERLEKAVTRLESLFSDSHGSG-GMECDAINGVNGSIAPYVEAFDRLLNGSVAEFLRYS  65

Query  292  EKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTEGR  471
            + + G V    ++V+ AF AQ+  L+     Q+P    ++  LKP++E I    +  E  
Sbjct  66   KILEGDVKTHAEMVRAAFQAQRSFLVLASQCQEPQENDVAMLLKPISEKIQEIQNFRERN  125

Query  472  R-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
            R S  FNHL A ++S+ AL WIA + K      P  +V+E    A FY
Sbjct  126  RGSKMFNHLSAVSESIPALGWIAVSPK------PGPYVKEMNDAATFY  167



>ref|XP_005353362.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Microtus 
ochrogaster]
 ref|XP_005353363.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Microtus 
ochrogaster]
 ref|XP_005353364.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Microtus 
ochrogaster]
Length=474

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 84/170 (49%), Gaps = 15/170 (9%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTGG---FGHGTSREVDVSAAASDPSIVAFEDLISQCVGRLSS  285
            + L++RLE AV RLE +S       G+G     D S+  + P + AF+ L++  V     
Sbjct  5    QNLVERLERAVGRLEAVSHSSDMHCGYG-----DSSSKGAVPYVQAFDSLLANPVAEYLK  59

Query  286  AAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSLTE  465
             +++IGG V    ++V      ++ LL+     Q+P    LS+ L P++E I    +  E
Sbjct  60   MSKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVITFRE  119

Query  466  GRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
              R S FFNHL A ++S+ AL W+A   K      P   V+E    A FY
Sbjct  120  KNRGSKFFNHLSAVSESIQALGWVALAAK------PGPFVKEMTDAAMFY  163



>ref|XP_003799026.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform 1 [Otolemur 
garnettii]
Length=475

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 86/172 (50%), Gaps = 18/172 (10%)
 Frame = +1

Query  115  EKLIQRLESAVARLETLSTG-----GFGHGTSREVDVSAAASDPSIVAFEDLISQCVGRL  279
            + L++RLE AV RLE +S       G+G  +S+      A + P + AF+ L++  VG  
Sbjct  5    QNLVERLERAVGRLEAVSHTSDMHCGYGDSSSK------AGAVPYVQAFDSLLAGPVGEY  58

Query  280  SSAAEKIGGQVLDATKIVKDAFSAQKELLIKTKGIQKPDMKGLSEFLKPLNEVIMRGSSL  459
               +++IGG V    ++V      ++ LL+     Q+P    LS+ L P++E I    + 
Sbjct  59   LKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVITF  118

Query  460  TEGRR-SDFFNHLKAATDSLTALAWIAYTGKDCGMSMPIAHVEESWQMAEFY  612
             E  R S  FNHL A ++S+ AL W+A   K      P  +V+E    A FY
Sbjct  119  REKNRGSKLFNHLSAVSESIQALGWVAMAPK------PGPYVKEMNDAAMFY  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889770574917