BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1739

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011037693.1|  PREDICTED: beta-glucosidase 46-like                249   2e-75   Populus euphratica
ref|XP_002305594.1|  glycosyl hydrolase family 1 family protein         248   3e-75   
ref|XP_011037697.1|  PREDICTED: beta-glucosidase 46-like                247   8e-75   Populus euphratica
gb|KEH36811.1|  glycoside hydrolase family 1 protein                    244   1e-74   Medicago truncatula
gb|KEH36810.1|  glycoside hydrolase family 1 protein                    243   2e-74   Medicago truncatula
ref|XP_007147744.1|  hypothetical protein PHAVU_006G151300g             246   2e-74   Phaseolus vulgaris [French bean]
gb|KEH36807.1|  glycoside hydrolase family 1 protein                    243   2e-74   Medicago truncatula
gb|KEH36809.1|  glycoside hydrolase family 1 protein                    244   4e-74   Medicago truncatula
ref|XP_002304950.2|  hypothetical protein POPTR_0004s01900g             244   5e-74   
gb|KEH36808.1|  glycoside hydrolase family 1 protein                    243   7e-74   Medicago truncatula
ref|XP_004486131.1|  PREDICTED: beta-glucosidase 47-like                243   1e-73   
ref|XP_007026020.1|  Beta glucosidase 46, putative                      244   2e-73   
gb|KJB67164.1|  hypothetical protein B456_010G178800                    243   2e-73   Gossypium raimondii
ref|XP_002305597.2|  glycosyl hydrolase family 1 family protein         243   2e-73   
gb|KEH36806.1|  glycoside hydrolase family 1 protein                    243   3e-73   Medicago truncatula
ref|XP_002264678.3|  PREDICTED: beta-glucosidase 46-like                243   3e-73   Vitis vinifera
ref|XP_010267720.1|  PREDICTED: beta-glucosidase 46 isoform X3          243   4e-73   Nelumbo nucifera [Indian lotus]
emb|CDO99725.1|  unnamed protein product                                242   5e-73   Coffea canephora [robusta coffee]
ref|XP_010533827.1|  PREDICTED: beta-glucosidase 46-like isoform X1     242   5e-73   Tarenaya hassleriana [spider flower]
emb|CBI23186.3|  unnamed protein product                                243   6e-73   Vitis vinifera
ref|XP_004293271.1|  PREDICTED: beta-glucosidase 47                     242   7e-73   Fragaria vesca subsp. vesca
gb|KHG29721.1|  Beta-glucosidase 46                                     241   3e-72   Gossypium arboreum [tree cotton]
gb|KHG29722.1|  Beta-glucosidase 46                                     241   3e-72   Gossypium arboreum [tree cotton]
gb|ACJ85625.1|  unknown                                                 231   4e-72   Medicago truncatula
ref|XP_010267719.1|  PREDICTED: beta-glucosidase 46 isoform X2          241   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_006383935.1|  hypothetical protein POPTR_0004s01890g             239   4e-72   
gb|KDP39384.1|  hypothetical protein JCGZ_01141                         239   5e-72   Jatropha curcas
ref|XP_012071272.1|  PREDICTED: beta-glucosidase 18-like                239   5e-72   Jatropha curcas
ref|XP_010057964.1|  PREDICTED: beta-glucosidase 46 isoform X3          240   5e-72   Eucalyptus grandis [rose gum]
ref|XP_010057961.1|  PREDICTED: beta-glucosidase 46 isoform X1          240   5e-72   Eucalyptus grandis [rose gum]
gb|KCW75357.1|  hypothetical protein EUGRSUZ_E04103                     240   5e-72   Eucalyptus grandis [rose gum]
gb|KHN33045.1|  Beta-glucosidase 47                                     240   6e-72   Glycine soja [wild soybean]
ref|XP_007153926.1|  hypothetical protein PHAVU_003G076700g             236   6e-72   Phaseolus vulgaris [French bean]
ref|XP_003529623.1|  PREDICTED: beta-glucosidase 46                     240   7e-72   Glycine max [soybeans]
gb|KJB67161.1|  hypothetical protein B456_010G178500                    239   1e-71   Gossypium raimondii
ref|XP_011652764.1|  PREDICTED: beta-glucosidase 47                     238   4e-71   Cucumis sativus [cucumbers]
ref|XP_002888064.1|  BGLU46                                             237   6e-71   
ref|XP_008364100.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    236   2e-70   
ref|XP_008441244.1|  PREDICTED: beta-glucosidase 47                     236   2e-70   Cucumis melo [Oriental melon]
ref|XP_009363745.1|  PREDICTED: beta-glucosidase 46-like isoform X1     235   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_003547247.2|  PREDICTED: beta-glucosidase 47-like                242   3e-70   Glycine max [soybeans]
ref|XP_006348202.1|  PREDICTED: beta-glucosidase 47-like                229   3e-70   
ref|XP_010267718.1|  PREDICTED: beta-glucosidase 46 isoform X1          241   3e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006468004.1|  PREDICTED: beta-glucosidase 46-like                236   3e-70   
ref|XP_006301036.1|  hypothetical protein CARUB_v10021428mg             234   4e-70   Capsella rubella
ref|XP_007211830.1|  hypothetical protein PRUPE_ppa004523mg             234   6e-70   
ref|XP_007153925.1|  hypothetical protein PHAVU_003G076700g             234   6e-70   Phaseolus vulgaris [French bean]
ref|XP_009774064.1|  PREDICTED: beta-glucosidase 18-like                234   9e-70   Nicotiana sylvestris
ref|XP_008384042.1|  PREDICTED: beta-glucosidase 46-like isoform X4     232   1e-69   
tpg|DAA36950.1|  TPA: hypothetical protein ZEAMMB73_322711              226   1e-69   
ref|XP_008384041.1|  PREDICTED: beta-glucosidase 46-like isoform X3     232   1e-69   
ref|XP_006468001.1|  PREDICTED: beta-glucosidase 47-like isoform X2     233   1e-69   
ref|XP_002304951.2|  glycosyl hydrolase family 1 family protein         233   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006468000.1|  PREDICTED: beta-glucosidase 47-like isoform X1     233   2e-69   
ref|XP_008384039.1|  PREDICTED: beta-glucosidase 47-like isoform X1     233   3e-69   
ref|XP_009770584.1|  PREDICTED: beta-glucosidase 18-like                233   3e-69   Nicotiana sylvestris
ref|XP_009803936.1|  PREDICTED: beta-glucosidase 18-like                232   4e-69   Nicotiana sylvestris
ref|XP_009617373.1|  PREDICTED: beta-glucosidase 18-like                232   4e-69   Nicotiana tomentosiformis
ref|XP_007026017.1|  Beta glucosidase 46 isoform 1                      232   5e-69   
ref|XP_011037696.1|  PREDICTED: beta-glucosidase 47-like                232   5e-69   Populus euphratica
emb|CDY25325.1|  BnaC01g29940D                                          231   7e-69   Brassica napus [oilseed rape]
ref|XP_007026019.1|  Beta glucosidase 46 isoform 3                      232   8e-69   
ref|XP_009105270.1|  PREDICTED: beta-glucosidase 46-like isoform X1     231   8e-69   Brassica rapa
emb|CDY55219.1|  BnaA01g36270D                                          231   8e-69   Brassica napus [oilseed rape]
ref|XP_002518516.1|  beta-glucosidase, putative                         231   9e-69   Ricinus communis
ref|XP_004234482.1|  PREDICTED: beta-glucosidase 46-like                231   9e-69   Solanum lycopersicum
gb|KEH36817.1|  glycoside hydrolase family 1 protein                    231   9e-69   Medicago truncatula
ref|XP_009624454.1|  PREDICTED: beta-glucosidase 18                     231   9e-69   
ref|XP_009608375.1|  PREDICTED: beta-glucosidase 18-like                231   1e-68   Nicotiana tomentosiformis
gb|AAC28502.1|  Similar to F4I1.26 putative beta-glucosidase gi|3...    231   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850968.1|  beta glucosidase 46                                   231   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105752.1|  PREDICTED: beta-glucosidase 45-like                230   2e-68   Brassica rapa
ref|XP_010418157.1|  PREDICTED: beta-glucosidase 46                     230   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_008224797.1|  PREDICTED: beta-glucosidase 47-like                230   3e-68   Prunus mume [ume]
gb|KJB81912.1|  hypothetical protein B456_013G167400                    224   3e-68   Gossypium raimondii
emb|CDY47163.1|  BnaA01g22890D                                          229   5e-68   Brassica napus [oilseed rape]
ref|XP_006348092.1|  PREDICTED: beta-glucosidase 47-like                229   8e-68   Solanum tuberosum [potatoes]
ref|XP_009794052.1|  PREDICTED: beta-glucosidase 18-like                229   1e-67   Nicotiana sylvestris
ref|XP_006348091.1|  PREDICTED: probable inactive beta-glucosidas...    228   1e-67   Solanum tuberosum [potatoes]
gb|KHG29723.1|  Beta-glucosidase 46                                     229   1e-67   Gossypium arboreum [tree cotton]
ref|XP_006343294.1|  PREDICTED: beta-glucosidase 47-like                228   1e-67   
ref|XP_008384043.1|  PREDICTED: beta-glucosidase 47-like                228   1e-67   
ref|XP_010473402.1|  PREDICTED: beta-glucosidase 46                     228   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010316602.1|  PREDICTED: beta-glucosidase 18-like isoform X1     228   2e-67   Solanum lycopersicum
ref|XP_010430205.1|  PREDICTED: beta-glucosidase 46-like isoform X2     228   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006300409.1|  hypothetical protein CARUB_v10021331mg             228   2e-67   Capsella rubella
ref|XP_009363823.1|  PREDICTED: beta-glucosidase 45-like isoform X2     227   2e-67   
gb|KJB69320.1|  hypothetical protein B456_011G016100                    232   2e-67   Gossypium raimondii
ref|XP_008669175.1|  PREDICTED: probable inactive beta-glucosidas...    228   2e-67   
ref|XP_003529622.1|  PREDICTED: beta-glucosidase 46                     228   3e-67   Glycine max [soybeans]
ref|XP_010430204.1|  PREDICTED: beta-glucosidase 46-like isoform X1     227   3e-67   Camelina sativa [gold-of-pleasure]
gb|AES92596.2|  glucose 6-phosphate/phosphate translocator 1            233   4e-67   Medicago truncatula
gb|KJB81913.1|  hypothetical protein B456_013G167400                    224   4e-67   Gossypium raimondii
ref|XP_010316605.1|  PREDICTED: beta-glucosidase 18 isoform X1          226   5e-67   Solanum lycopersicum
gb|KFK40643.1|  hypothetical protein AALP_AA2G023200                    225   6e-67   Arabis alpina [alpine rockcress]
emb|CDY25326.1|  BnaC01g29950D                                          230   6e-67   Brassica napus [oilseed rape]
ref|XP_003610399.1|  Glucose-6-phosphate/phosphate translocator         233   6e-67   
gb|KJB81914.1|  hypothetical protein B456_013G167400                    224   6e-67   Gossypium raimondii
gb|KHG07627.1|  Beta-glucosidase 18                                     219   8e-67   Gossypium arboreum [tree cotton]
ref|XP_010316604.1|  PREDICTED: beta-glucosidase 18-like                226   8e-67   Solanum lycopersicum
ref|XP_009397666.1|  PREDICTED: beta-glucosidase 18-like                225   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382650.1|  PREDICTED: beta-glucosidase 18-like                225   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008669176.1|  PREDICTED: probable inactive beta-glucosidas...    225   2e-66   
ref|XP_006391958.1|  hypothetical protein EUTSA_v10024134mg             225   2e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010418158.1|  PREDICTED: beta-glucosidase 45-like                225   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009413739.1|  PREDICTED: beta-glucosidase 18-like isoform X1     225   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK40644.1|  hypothetical protein AALP_AA2G023300                    225   2e-66   Arabis alpina [alpine rockcress]
ref|XP_008384040.1|  PREDICTED: beta-glucosidase 47-like isoform X2     224   2e-66   
ref|XP_012071274.1|  PREDICTED: beta-glucosidase 18-like                225   2e-66   
ref|XP_002448169.1|  hypothetical protein SORBIDRAFT_06g022410          224   3e-66   Sorghum bicolor [broomcorn]
ref|XP_010665547.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    226   3e-66   
ref|XP_008669177.1|  PREDICTED: probable inactive beta-glucosidas...    224   3e-66   Zea mays [maize]
ref|NP_001185287.1|  beta-glucosidase 45                                225   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176374.1|  beta-glucosidase 45                                   224   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976205.1|  PREDICTED: beta-glucosidase 18-like isoform X2     224   5e-66   Setaria italica
ref|XP_006348093.1|  PREDICTED: beta-glucosidase 18-like                224   7e-66   Solanum tuberosum [potatoes]
gb|KJB81911.1|  hypothetical protein B456_013G167400                    224   7e-66   Gossypium raimondii
ref|XP_010273571.1|  PREDICTED: beta-glucosidase 18-like                223   8e-66   Nelumbo nucifera [Indian lotus]
ref|XP_002448173.1|  hypothetical protein SORBIDRAFT_06g022450          223   1e-65   Sorghum bicolor [broomcorn]
sp|Q7XSK0.2|BGL18_ORYSJ  RecName: Full=Beta-glucosidase 18; Short...    223   1e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006302139.1|  hypothetical protein CARUB_v10020143mg             223   2e-65   Capsella rubella
ref|XP_004976202.1|  PREDICTED: probable inactive beta-glucosidas...    222   2e-65   Setaria italica
gb|KFK40642.1|  hypothetical protein AALP_AA2G023000                    222   3e-65   Arabis alpina [alpine rockcress]
ref|XP_010473401.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    222   5e-65   
gb|ABC55715.1|  beta-mannosidase 4                                      221   5e-65   Oncidium hybrid cultivar
ref|XP_010430203.1|  PREDICTED: beta-glucosidase 45-like                221   8e-65   Camelina sativa [gold-of-pleasure]
gb|KJB81916.1|  hypothetical protein B456_013G167400                    220   2e-64   Gossypium raimondii
gb|KFK40645.1|  hypothetical protein AALP_AA2G023400                    220   2e-64   Arabis alpina [alpine rockcress]
ref|XP_007021332.1|  Beta-glucosidase 45, putative                      222   2e-64   
ref|XP_002448174.1|  hypothetical protein SORBIDRAFT_06g022460          220   2e-64   
ref|XP_009630283.1|  PREDICTED: beta-glucosidase 18-like                219   4e-64   Nicotiana tomentosiformis
ref|XP_004976204.1|  PREDICTED: beta-glucosidase 18-like isoform X1     219   4e-64   Setaria italica
ref|XP_009772387.1|  PREDICTED: beta-glucosidase 18-like                219   6e-64   Nicotiana sylvestris
ref|XP_006348229.1|  PREDICTED: beta-glucosidase 18-like                219   8e-64   Solanum tuberosum [potatoes]
ref|XP_002448178.1|  hypothetical protein SORBIDRAFT_06g022500          218   9e-64   Sorghum bicolor [broomcorn]
ref|XP_009137214.1|  PREDICTED: beta-glucosidase 47-like                218   1e-63   Brassica rapa
ref|XP_006391959.1|  hypothetical protein EUTSA_v10023411mg             218   1e-63   Eutrema salsugineum [saltwater cress]
ref|NP_001053302.1|  Os04g0513100                                       218   2e-63   
ref|XP_006449069.1|  hypothetical protein CICLE_v10017801mg             218   2e-63   
gb|AFK44109.1|  unknown                                                 217   2e-63   Medicago truncatula
ref|XP_009605773.1|  PREDICTED: beta-glucosidase 18-like isoform X1     218   2e-63   Nicotiana tomentosiformis
ref|XP_003610400.1|  Beta-glucosidase                                   217   2e-63   
ref|XP_010245701.1|  PREDICTED: beta-glucosidase 18-like                217   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_007145856.1|  hypothetical protein PHAVU_007G273800g             217   3e-63   Phaseolus vulgaris [French bean]
ref|XP_002448179.1|  hypothetical protein SORBIDRAFT_06g022510          217   3e-63   
gb|KDO74146.1|  hypothetical protein CISIN_1g012716mg                   211   4e-63   Citrus sinensis [apfelsine]
ref|NP_001053303.1|  Os04g0513400                                       209   4e-63   
ref|XP_006413735.1|  hypothetical protein EUTSA_v10024896mg             216   6e-63   
ref|XP_010920356.1|  PREDICTED: beta-glucosidase 18-like                216   7e-63   Elaeis guineensis
ref|XP_010023758.1|  PREDICTED: beta-glucosidase 18-like                216   7e-63   
ref|XP_006413734.1|  hypothetical protein EUTSA_v10024896mg             216   7e-63   
ref|XP_004976207.1|  PREDICTED: beta-glucosidase 18-like                217   9e-63   Setaria italica
ref|XP_004976201.1|  PREDICTED: probable inactive beta-glucosidas...    214   9e-63   
ref|XP_006348230.1|  PREDICTED: beta-glucosidase 18-like                216   1e-62   Solanum tuberosum [potatoes]
ref|XP_011628484.1|  PREDICTED: beta-glucosidase 18                     215   1e-62   Amborella trichopoda
gb|EAZ31330.1|  hypothetical protein OsJ_15447                          216   1e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010449006.1|  PREDICTED: beta-glucosidase 47-like                215   1e-62   Camelina sativa [gold-of-pleasure]
gb|AFK46781.1|  unknown                                                 215   1e-62   Medicago truncatula
gb|ERN19524.1|  hypothetical protein AMTR_s00062p00043120               216   1e-62   Amborella trichopoda
ref|XP_009602726.1|  PREDICTED: beta-glucosidase 18-like                208   1e-62   Nicotiana tomentosiformis
ref|XP_009768487.1|  PREDICTED: beta-glucosidase 18-like                215   1e-62   Nicotiana sylvestris
ref|XP_008454703.1|  PREDICTED: beta-glucosidase 18-like                214   2e-62   
ref|XP_006285457.1|  hypothetical protein CARUB_v10006876mg             214   2e-62   
ref|XP_007153927.1|  hypothetical protein PHAVU_003G076800g             214   2e-62   Phaseolus vulgaris [French bean]
gb|KDO74144.1|  hypothetical protein CISIN_1g012716mg                   211   3e-62   Citrus sinensis [apfelsine]
gb|EMT09723.1|  Beta-glucosidase 6                                      214   3e-62   
ref|XP_006348385.1|  PREDICTED: beta-glucosidase 18-like                214   4e-62   
ref|XP_010434129.1|  PREDICTED: beta-glucosidase 47-like                214   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004976200.1|  PREDICTED: probable inactive beta-glucosidas...    214   5e-62   Setaria italica
ref|XP_010675613.1|  PREDICTED: beta-glucosidase 18-like                214   5e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011652391.1|  PREDICTED: beta-glucosidase 18 isoform X2          214   6e-62   Cucumis sativus [cucumbers]
ref|XP_011098340.1|  PREDICTED: beta-glucosidase 18-like                214   7e-62   Sesamum indicum [beniseed]
gb|KDO74143.1|  hypothetical protein CISIN_1g012716mg                   211   1e-61   Citrus sinensis [apfelsine]
ref|XP_010069050.1|  PREDICTED: beta-glucosidase 18-like                213   1e-61   Eucalyptus grandis [rose gum]
gb|KFK28775.1|  hypothetical protein AALP_AA7G045800                    212   1e-61   Arabis alpina [alpine rockcress]
ref|XP_009135219.1|  PREDICTED: beta-glucosidase 47 isoform X2          213   1e-61   Brassica rapa
ref|XP_006451937.1|  hypothetical protein CICLE_v10007996mg             213   1e-61   Citrus clementina [clementine]
ref|XP_004141366.1|  PREDICTED: beta-glucosidase 18-like                212   2e-61   Cucumis sativus [cucumbers]
ref|XP_008224799.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    212   2e-61   Prunus mume [ume]
ref|XP_010439426.1|  PREDICTED: beta-glucosidase 47-like                212   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_003581423.1|  PREDICTED: probable inactive beta-glucosidas...    212   2e-61   
gb|KGN59900.1|  hypothetical protein Csa_3G852490                       212   3e-61   Cucumis sativus [cucumbers]
ref|XP_002869865.1|  beta-glucosidase 47                                211   3e-61   Arabidopsis lyrata subsp. lyrata
gb|AID16401.1|  monolignol beta-glucosidase                             211   3e-61   synthetic construct
sp|Q7XSK2.2|BGL16_ORYSJ  RecName: Full=Beta-glucosidase 16; Short...    211   4e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006464711.1|  PREDICTED: beta-glucosidase 18-like isoform X2     211   4e-61   
ref|XP_007149593.1|  hypothetical protein PHAVU_005G082800g             211   4e-61   Phaseolus vulgaris [French bean]
ref|XP_010324440.1|  PREDICTED: beta-glucosidase 18-like                211   4e-61   
ref|XP_004487691.1|  PREDICTED: beta-glucosidase 18-like                211   4e-61   
emb|CDX94055.1|  BnaC07g36890D                                          211   5e-61   
ref|XP_010023760.1|  PREDICTED: beta-glucosidase 18-like isoform X2     210   5e-61   Eucalyptus grandis [rose gum]
emb|CAB36820.1|  beta-glucosidase-like protein                          211   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007149591.1|  hypothetical protein PHAVU_005G082800g             211   6e-61   Phaseolus vulgaris [French bean]
ref|XP_011652389.1|  PREDICTED: beta-glucosidase 18-like                211   6e-61   Cucumis sativus [cucumbers]
ref|XP_006464710.1|  PREDICTED: beta-glucosidase 18-like isoform X1     211   7e-61   Citrus sinensis [apfelsine]
gb|EMS59801.1|  putative inactive beta-glucosidase 14                   211   7e-61   Triticum urartu
gb|KGN59899.1|  hypothetical protein Csa_3G852480                       211   7e-61   Cucumis sativus [cucumbers]
ref|XP_010274443.1|  PREDICTED: beta-glucosidase 18-like                210   9e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009137215.1|  PREDICTED: beta-glucosidase 47-like                210   1e-60   Brassica rapa
ref|XP_008661573.1|  PREDICTED: beta-glucosidase isoform X1             210   1e-60   Zea mays [maize]
ref|XP_006370302.1|  hypothetical protein POPTR_0001s41440g             210   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_006652510.1|  PREDICTED: beta-glucosidase 16-like                210   1e-60   Oryza brachyantha
ref|XP_010644221.1|  PREDICTED: beta-glucosidase 18-like                210   1e-60   Vitis vinifera
ref|XP_009135212.1|  PREDICTED: beta-glucosidase 47 isoform X1          210   1e-60   Brassica rapa
ref|XP_011042497.1|  PREDICTED: beta-glucosidase 18-like isoform X2     209   1e-60   Populus euphratica
ref|XP_003541851.2|  PREDICTED: beta-glucosidase 18-like isoform X1     210   2e-60   Glycine max [soybeans]
ref|XP_010023759.1|  PREDICTED: beta-glucosidase 18-like isoform X1     209   2e-60   Eucalyptus grandis [rose gum]
ref|XP_008454668.1|  PREDICTED: beta-glucosidase 18-like                209   2e-60   
ref|XP_004244205.1|  PREDICTED: beta-glucosidase 18-like                210   2e-60   Solanum lycopersicum
ref|XP_006594785.1|  PREDICTED: beta-glucosidase 18-like isoform X2     210   2e-60   Glycine max [soybeans]
ref|NP_193907.2|  beta-glucosidase 47                                   209   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011042496.1|  PREDICTED: beta-glucosidase 18-like isoform X1     209   3e-60   Populus euphratica
ref|XP_006653596.1|  PREDICTED: beta-glucosidase 16-like                208   4e-60   
ref|XP_006653597.1|  PREDICTED: beta-glucosidase 16-like                207   4e-60   
emb|CDX79092.1|  BnaA01g11590D                                          207   4e-60   
ref|NP_001140717.1|  beta-glucosidase precursor                         208   5e-60   Zea mays [maize]
ref|XP_009762322.1|  PREDICTED: beta-glucosidase 18-like                209   5e-60   Nicotiana sylvestris
ref|XP_011098338.1|  PREDICTED: beta-glucosidase 18-like                209   5e-60   Sesamum indicum [beniseed]
gb|KEH38756.1|  glycoside hydrolase family 1 protein                    208   5e-60   Medicago truncatula
ref|XP_004508228.1|  PREDICTED: uncharacterized protein LOC101501316    214   6e-60   
ref|NP_001148165.1|  beta-glucosidase precursor                         208   6e-60   
ref|XP_009605771.1|  PREDICTED: beta-glucosidase 18-like isoform X1     208   9e-60   Nicotiana tomentosiformis
emb|CDP05879.1|  unnamed protein product                                208   1e-59   Coffea canephora [robusta coffee]
ref|XP_003580124.2|  PREDICTED: beta-glucosidase 16-like                208   1e-59   
ref|XP_010644220.1|  PREDICTED: beta-glucosidase 18 isoform X2          206   1e-59   Vitis vinifera
emb|CDP05877.1|  unnamed protein product                                200   2e-59   Coffea canephora [robusta coffee]
gb|KEH38762.1|  glycoside hydrolase family 1 protein                    204   2e-59   Medicago truncatula
ref|XP_008226673.1|  PREDICTED: beta-glucosidase 18-like isoform X2     207   2e-59   
gb|EMS46231.1|  Beta-glucosidase 16                                     206   3e-59   Triticum urartu
gb|EYU26405.1|  hypothetical protein MIMGU_mgv1a004080mg                207   3e-59   Erythranthe guttata [common monkey flower]
ref|XP_011098410.1|  PREDICTED: beta-glucosidase 18-like                204   4e-59   
gb|AIP98403.1|  beta-glucosidase                                        206   4e-59   Pinus sylvestris [Scotch pine]
ref|XP_002448177.1|  hypothetical protein SORBIDRAFT_06g022490          206   4e-59   Sorghum bicolor [broomcorn]
ref|XP_011098339.1|  PREDICTED: beta-glucosidase 18-like                207   4e-59   
ref|XP_010644219.1|  PREDICTED: beta-glucosidase 18 isoform X1          206   6e-59   Vitis vinifera
ref|XP_003541849.2|  PREDICTED: beta-glucosidase 18-like isoform X1     206   6e-59   Glycine max [soybeans]
dbj|BAJ93784.1|  predicted protein                                      205   7e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006594783.1|  PREDICTED: beta-glucosidase 18-like isoform X2     206   7e-59   Glycine max [soybeans]
ref|XP_008453064.1|  PREDICTED: beta-glucosidase 18-like                206   7e-59   
dbj|BAJ92008.1|  predicted protein                                      205   7e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008661459.1|  PREDICTED: hypothetical protein isoform X1         205   1e-58   
sp|Q9ZT64.1|CBG_PINCO  RecName: Full=Coniferin beta-glucosidase; ...    204   1e-58   Pinus contorta
ref|XP_007214434.1|  hypothetical protein PRUPE_ppa025660mg             203   2e-58   
gb|KEH38761.1|  glycoside hydrolase family 1 protein                    204   2e-58   Medicago truncatula
gb|KHN36807.1|  Beta-glucosidase 18                                     204   2e-58   Glycine soja [wild soybean]
gb|KHN28049.1|  Beta-glucosidase 18                                     204   3e-58   Glycine soja [wild soybean]
ref|XP_008226671.1|  PREDICTED: beta-glucosidase 18-like                204   3e-58   Prunus mume [ume]
ref|XP_004976203.1|  PREDICTED: beta-glucosidase 16-like                203   5e-58   Setaria italica
ref|NP_001167660.1|  beta-glucosidase precursor                         203   6e-58   
ref|XP_008226672.1|  PREDICTED: beta-glucosidase 18-like isoform X1     202   8e-58   
ref|XP_007149594.1|  hypothetical protein PHAVU_005G082900g             202   9e-58   Phaseolus vulgaris [French bean]
ref|XP_006594784.1|  PREDICTED: beta-glucosidase 18-like isoform X3     202   1e-57   Glycine max [soybeans]
ref|XP_011652390.1|  PREDICTED: beta-glucosidase 18 isoform X1          203   1e-57   Cucumis sativus [cucumbers]
ref|XP_006592906.1|  PREDICTED: beta-glucosidase 18-like                200   1e-57   Glycine max [soybeans]
gb|KHN28048.1|  Beta-glucosidase 18                                     202   2e-57   Glycine soja [wild soybean]
ref|XP_006593298.1|  PREDICTED: beta-glucosidase 18-like                202   2e-57   
emb|CDP05880.1|  unnamed protein product                                202   2e-57   Coffea canephora [robusta coffee]
ref|XP_009378508.1|  PREDICTED: beta-glucosidase 18-like                200   6e-57   
dbj|BAO04172.1|  hypothetical protein                                   200   7e-57   Delphinium grandiflorum
emb|CDX98704.1|  BnaA03g44890D                                          198   3e-56   
ref|XP_010675614.1|  PREDICTED: beta-glucosidase 18-like                197   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007214502.1|  hypothetical protein PRUPE_ppa017816mg             194   3e-55   
emb|CDP05539.1|  unnamed protein product                                196   3e-55   Coffea canephora [robusta coffee]
ref|XP_009378490.1|  PREDICTED: beta-glucosidase 18-like isoform X1     196   4e-55   Pyrus x bretschneideri [bai li]
ref|XP_008804255.1|  PREDICTED: beta-glucosidase 18-like                185   6e-55   
gb|EMS66653.1|  Beta-glucosidase 16                                     194   1e-54   Triticum urartu
ref|XP_008339824.1|  PREDICTED: beta-glucosidase 40                     192   6e-54   
tpg|DAA36952.1|  TPA: hypothetical protein ZEAMMB73_325029              191   6e-54   
gb|EAZ31332.1|  hypothetical protein OsJ_15449                          191   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             191   1e-53   Selaginella moellendorffii
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             191   2e-53   
dbj|BAO04176.1|  hypothetical protein                                   191   2e-53   Delphinium grandiflorum
ref|XP_008386133.1|  PREDICTED: beta-glucosidase 18-like isoform X2     191   2e-53   
emb|CDP05536.1|  unnamed protein product                                191   4e-53   Coffea canephora [robusta coffee]
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             190   4e-53   Prunus persica
ref|XP_010920354.1|  PREDICTED: beta-glucosidase 18-like                181   4e-53   
ref|XP_007045908.1|  Beta glucosidase 40 isoform 2                      187   6e-53   
ref|XP_010644313.1|  PREDICTED: putative beta-glucosidase 41            189   8e-53   Vitis vinifera
emb|CDP05535.1|  unnamed protein product                                189   9e-53   Coffea canephora [robusta coffee]
gb|EMS60351.1|  Beta-glucosidase 16                                     189   9e-53   
ref|XP_011094086.1|  PREDICTED: raucaffricine-O-beta-D-glucosidas...    188   2e-52   
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     188   2e-52   
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                187   3e-52   
ref|XP_012092790.1|  PREDICTED: beta-glucosidase 12-like                187   3e-52   
emb|CBI20471.3|  unnamed protein product                                188   4e-52   
gb|KFK28774.1|  hypothetical protein AALP_AA7G045600                    187   4e-52   
ref|XP_002448170.1|  hypothetical protein SORBIDRAFT_06g022420          190   4e-52   
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     187   5e-52   
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      187   5e-52   
ref|XP_011625439.1|  PREDICTED: beta-glucosidase 12                     187   5e-52   
ref|XP_003579958.1|  PREDICTED: beta-glucosidase 12-like                187   6e-52   
gb|EYU28848.1|  hypothetical protein MIMGU_mgv1a004935mg                186   7e-52   
dbj|BAJ93012.1|  predicted protein                                      186   9e-52   
ref|XP_008390041.1|  PREDICTED: beta-glucosidase 40-like                186   9e-52   
ref|XP_003597509.1|  Beta-glucosidase D2                                186   9e-52   
ref|XP_006652405.1|  PREDICTED: beta-glucosidase 12-like                186   9e-52   
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             186   1e-51   
ref|XP_003597482.1|  Beta-glucosidase D4                                186   1e-51   
ref|XP_007153535.1|  hypothetical protein PHAVU_003G043600g             184   1e-51   
ref|XP_010267845.1|  PREDICTED: putative beta-glucosidase 41 isof...    185   1e-51   
ref|XP_010267846.1|  PREDICTED: putative beta-glucosidase 41 isof...    185   2e-51   
gb|KJB80346.1|  hypothetical protein B456_013G093000                    183   2e-51   
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                186   2e-51   
gb|KCW51256.1|  hypothetical protein EUGRSUZ_J00833                     186   2e-51   
ref|XP_009135228.1|  PREDICTED: beta-glucosidase 47 isoform X3          185   2e-51   
ref|XP_003579957.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    185   2e-51   
ref|XP_002960920.1|  hypothetical protein SELMODRAFT_163822             185   2e-51   
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    185   2e-51   
ref|XP_008386132.1|  PREDICTED: beta-glucosidase 18-like isoform X1     186   2e-51   
ref|XP_002448027.1|  hypothetical protein SORBIDRAFT_06g019840          185   3e-51   
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     185   3e-51   
ref|XP_002448029.1|  hypothetical protein SORBIDRAFT_06g019860          184   5e-51   
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                184   6e-51   
ref|XP_010446113.1|  PREDICTED: putative beta-glucosidase 41            180   6e-51   
gb|KHN33321.1|  Non-cyanogenic beta-glucosidase                         183   6e-51   
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40                     184   6e-51   
gb|AES67734.2|  glycoside hydrolase family 1 protein                    183   7e-51   
emb|CDY68226.1|  BnaCnng58130D                                          182   7e-51   
gb|AHC04401.1|  beta-glucosidase 1                                      184   7e-51   
ref|XP_003597483.1|  Beta-glucosidase D4                                183   7e-51   
ref|XP_010521463.1|  PREDICTED: beta-glucosidase 40-like isoform X3     184   7e-51   
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     184   7e-51   
ref|XP_009415571.1|  PREDICTED: beta-glucosidase 24-like                184   7e-51   
ref|XP_007014814.1|  Beta-glucosidase 17 isoform 2                      184   8e-51   
ref|XP_002967091.1|  hypothetical protein SELMODRAFT_169039             183   8e-51   
ref|XP_007014813.1|  Beta-glucosidase 17 isoform 1                      184   9e-51   
ref|XP_002512097.1|  beta-glucosidase, putative                         183   9e-51   
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             183   1e-50   
ref|XP_009364764.1|  PREDICTED: beta-glucosidase 12-like                183   1e-50   
ref|XP_010066854.1|  PREDICTED: beta-glucosidase 40                     183   1e-50   
emb|CDP00417.1|  unnamed protein product                                184   1e-50   
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                183   1e-50   
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     183   1e-50   
ref|XP_010499028.1|  PREDICTED: beta-glucosidase 40                     183   1e-50   
gb|EEC80501.1|  hypothetical protein OsI_22753                          183   2e-50   
sp|Q5Z9Z0.1|BGL24_ORYSJ  RecName: Full=Beta-glucosidase 24; Short...    183   2e-50   
emb|CBI27264.3|  unnamed protein product                                184   2e-50   
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                182   2e-50   
emb|CDY20561.1|  BnaC07g12280D                                          182   2e-50   
ref|XP_004505421.1|  PREDICTED: putative beta-glucosidase 41-like       182   2e-50   
gb|KJB80347.1|  hypothetical protein B456_013G093000                    182   3e-50   
ref|XP_011627457.1|  PREDICTED: beta-glucosidase 22 isoform X2          182   3e-50   
gb|KEH30302.1|  glycoside hydrolase family 1 protein                    179   3e-50   
ref|XP_007207081.1|  hypothetical protein PRUPE_ppa024434mg             182   3e-50   
gb|KEH33175.1|  glycoside hydrolase family 1 protein                    182   3e-50   
sp|Q7XKV5.2|BGL11_ORYSJ  RecName: Full=Beta-glucosidase 11; Short...    182   4e-50   
ref|XP_010235534.1|  PREDICTED: beta-glucosidase 2-like isoform X2      181   4e-50   
ref|XP_002893397.1|  hypothetical protein ARALYDRAFT_472753             182   4e-50   
ref|XP_011094151.1|  PREDICTED: raucaffricine-O-beta-D-glucosidas...    182   4e-50   
ref|XP_009110017.1|  PREDICTED: beta-glucosidase 40-like                182   4e-50   
ref|XP_011625518.1|  PREDICTED: beta-glucosidase 12                     181   4e-50   
emb|CAH66811.1|  OSIGBa0135C13.6                                        182   4e-50   
ref|XP_007021152.1|  Beta glucosidase 41 isoform 3                      179   5e-50   
ref|NP_001268161.1|  beta-glucosidase precursor                         181   5e-50   
emb|CBI27265.3|  unnamed protein product                                182   5e-50   
ref|XP_006855558.1|  PREDICTED: beta-glucosidase 22 isoform X1          182   5e-50   
ref|XP_002513440.1|  beta-glucosidase, putative                         181   5e-50   
gb|ERN11634.1|  hypothetical protein AMTR_s00022p00201150               181   6e-50   
ref|XP_010092278.1|  Putative beta-glucosidase 41                       181   6e-50   
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                181   6e-50   
ref|XP_004136782.1|  PREDICTED: beta-glucosidase 24                     181   6e-50   
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                181   6e-50   
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                181   7e-50   
dbj|BAJ86265.1|  predicted protein                                      181   7e-50   
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          181   8e-50   
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             181   8e-50   
ref|XP_010235533.1|  PREDICTED: beta-glucosidase 2-like isoform X1      181   8e-50   
gb|ERN12766.1|  hypothetical protein AMTR_s00043p00189470               181   8e-50   
ref|XP_010448300.1|  PREDICTED: putative beta-glucosidase 41 isof...    181   9e-50   
emb|CAE54545.1|  OSJNBa0004N05.25                                       175   9e-50   
ref|XP_010448292.1|  PREDICTED: putative beta-glucosidase 41 isof...    181   1e-49   
ref|XP_009349367.1|  PREDICTED: beta-glucosidase 42-like                180   1e-49   
ref|XP_007211440.1|  hypothetical protein PRUPE_ppa007195mg             178   1e-49   
ref|XP_009395000.1|  PREDICTED: beta-glucosidase 12-like                181   1e-49   
ref|XP_009336228.1|  PREDICTED: beta-glucosidase 42-like                180   1e-49   
emb|CDM82516.1|  unnamed protein product                                180   1e-49   
ref|XP_006855559.1|  PREDICTED: beta-glucosidase 22                     181   1e-49   
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             180   1e-49   
ref|XP_009601591.1|  PREDICTED: beta-glucosidase 12-like                179   1e-49   
ref|XP_010910032.1|  PREDICTED: beta-glucosidase 25 isoform X4          178   1e-49   
ref|XP_008801184.1|  PREDICTED: beta-glucosidase 31-like                180   1e-49   
gb|AAM61600.1|  beta-glucosidase, putative                              180   1e-49   
gb|KFK24362.1|  hypothetical protein AALP_AAs73986U000100               178   1e-49   
ref|NP_173978.1|  beta glucosidase 40                                   180   2e-49   
ref|XP_007045905.1|  Beta glucosidase 40                                181   2e-49   
ref|XP_008671245.1|  PREDICTED: uncharacterized protein LOC103648573    182   2e-49   
dbj|BAO04178.1|  acyl-glucose-dependent anthocyanin glucosyltrans...    180   2e-49   
ref|XP_007021151.1|  Beta glucosidase 41 isoform 2                      178   2e-49   
ref|XP_007161525.1|  hypothetical protein PHAVU_001G076700g             180   2e-49   
ref|XP_010443033.1|  PREDICTED: putative beta-glucosidase 41            180   2e-49   
gb|EYU28850.1|  hypothetical protein MIMGU_mgv1a004939mg                179   2e-49   
ref|XP_006850051.2|  PREDICTED: beta-glucosidase 12                     179   2e-49   
gb|ACD65511.1|  beta-glucosidase D7                                     180   2e-49   
ref|XP_004957322.1|  PREDICTED: beta-glucosidase 32-like                180   3e-49   
ref|XP_012087445.1|  PREDICTED: beta-glucosidase 12-like                180   3e-49   
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41            180   3e-49   
gb|KCW51030.1|  hypothetical protein EUGRSUZ_J00645                     179   3e-49   
ref|XP_010249517.1|  PREDICTED: beta-glucosidase 13-like isoform X2     178   3e-49   
gb|ABK60303.2|  glycosylhydrolase family 1                              174   3e-49   
emb|CAN68643.1|  hypothetical protein VITISV_030810                     178   3e-49   
emb|CDX85027.1|  BnaC05g20280D                                          179   3e-49   
ref|XP_007147745.1|  hypothetical protein PHAVU_006G151400g             178   4e-49   
ref|XP_006597240.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    177   4e-49   
ref|XP_003620196.1|  Beta-glucosidase D2                                179   4e-49   
ref|XP_011027871.1|  PREDICTED: beta-glucosidase 24-like                179   4e-49   
gb|AES76414.2|  glycoside hydrolase family 1 protein                    179   4e-49   
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                179   4e-49   
gb|KEH30301.1|  glycoside hydrolase family 1 protein                    179   4e-49   
ref|XP_010109366.1|  Beta-glucosidase 40                                179   4e-49   
ref|WP_029713403.1|  energy transducer TonB                             178   4e-49   
gb|EPT01941.1|  hypothetical protein FOMPIDRAFT_89281                   179   4e-49   
gb|AES67732.2|  glycoside hydrolase family 1 protein                    179   4e-49   
ref|NP_001058388.1|  Os06g0683300                                       174   4e-49   
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     179   5e-49   
ref|XP_008443299.1|  PREDICTED: beta-glucosidase 24-like                179   5e-49   
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                179   5e-49   
ref|XP_010482861.1|  PREDICTED: putative beta-glucosidase 41 isof...    179   5e-49   
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  178   5e-49   
ref|XP_002866052.1|  glycosyl hydrolase family 1 protein                179   5e-49   
emb|CDO77449.1|  Glycoside Hydrolase Family 1 protein                   180   5e-49   
ref|NP_001063639.1|  Os09g0511700                                       173   6e-49   
gb|KDO74406.1|  hypothetical protein CISIN_1g015181mg                   177   6e-49   
ref|XP_011048253.1|  PREDICTED: putative beta-glucosidase 41 isof...    177   6e-49   
pdb|4ATD|A  Chain A, Crystal Structure Of Native Raucaffricine Gl...    179   6e-49   
ref|XP_004515054.1|  PREDICTED: beta-glucosidase 12-like isoform X2     179   6e-49   
ref|XP_004515053.1|  PREDICTED: beta-glucosidase 12-like isoform X1     179   6e-49   
gb|EYU28849.1|  hypothetical protein MIMGU_mgv1a004939mg                178   6e-49   
sp|Q9SPP9.1|RG1_RAUSE  RecName: Full=Raucaffricine-O-beta-D-gluco...    179   7e-49   
gb|KEH30282.1|  glycoside hydrolase family 1 protein                    178   7e-49   
tpg|DAA50880.1|  TPA: hypothetical protein ZEAMMB73_806821              172   7e-49   
emb|CDX98705.1|  BnaA03g44900D                                          171   7e-49   
ref|NP_001053067.1|  Os04g0474500                                       173   7e-49   
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 178   7e-49   
gb|EEE62263.1|  hypothetical protein OsJ_17050                          177   7e-49   
ref|XP_006851185.2|  PREDICTED: beta-glucosidase 25                     180   7e-49   
gb|AAK92581.1|AC074354_15  Putative beta-glucosidase                    178   7e-49   
ref|XP_006656039.1|  PREDICTED: beta-glucosidase 24-like                178   7e-49   
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      178   7e-49   
ref|XP_008045097.1|  beta-glucosidase 1B                                179   8e-49   
ref|XP_008226796.1|  PREDICTED: putative beta-glucosidase 41 isof...    178   8e-49   
ref|XP_006415932.1|  hypothetical protein EUTSA_v10007404mg             178   8e-49   
ref|XP_010258106.1|  PREDICTED: beta-glucosidase 6                      178   8e-49   
ref|NP_001064347.1|  Os10g0323500                                       178   8e-49   
ref|XP_008355908.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    175   8e-49   
gb|KDP28154.1|  hypothetical protein JCGZ_13925                         175   8e-49   
dbj|BAO04173.1|  hypothetical protein                                   178   9e-49   
ref|XP_009406319.1|  PREDICTED: beta-glucosidase 6-like                 178   9e-49   
ref|XP_009364758.1|  PREDICTED: beta-glucosidase 13-like                178   9e-49   
gb|KDO77125.1|  hypothetical protein CISIN_1g011145mg                   172   9e-49   
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                178   9e-49   
ref|XP_006370585.1|  linamarase family protein                          178   1e-48   
ref|XP_004295227.1|  PREDICTED: beta-glucosidase 13-like                178   1e-48   
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          177   1e-48   
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             178   1e-48   
gb|EWM28877.1|  lactase-phlorizin hydrolase                             180   1e-48   
gb|KGN47642.1|  hypothetical protein Csa_6G366400                       177   1e-48   
ref|XP_009364765.1|  PREDICTED: beta-glucosidase 13-like                178   1e-48   
ref|XP_010044986.1|  PREDICTED: beta-glucosidase 13-like                178   1e-48   
ref|XP_006448538.1|  hypothetical protein CICLE_v10015030mg             172   1e-48   
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    178   1e-48   
ref|XP_009346071.1|  PREDICTED: beta-glucosidase 42-like                177   1e-48   
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          177   1e-48   
ref|XP_009417732.1|  PREDICTED: beta-glucosidase 22-like                178   1e-48   
tpg|DAA44055.1|  TPA: hypothetical protein ZEAMMB73_095768              176   1e-48   
gb|KDO77129.1|  hypothetical protein CISIN_1g011145mg                   172   1e-48   
ref|XP_011657400.1|  PREDICTED: beta-glucosidase 40                     178   1e-48   
gb|EMT15328.1|  Non-cyanogenic beta-glucosidase                         178   1e-48   
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    177   1e-48   
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             177   1e-48   
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    177   1e-48   
ref|XP_007150405.1|  hypothetical protein PHAVU_005G150600g             177   2e-48   
gb|EEC66726.1|  hypothetical protein OsI_33062                          177   2e-48   
pdb|3U57|A  Chain A, Structures Of Alkaloid Biosynthetic Glucosid...    177   2e-48   
pdb|1HXJ|A  Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta...    177   2e-48   
gb|KDQ56758.1|  glycoside hydrolase family 1 protein                    176   2e-48   
ref|XP_012067760.1|  PREDICTED: beta-glucosidase 40                     177   2e-48   
ref|XP_003607794.1|  Beta-glucosidase                                   177   2e-48   
pdb|1E1E|A  Chain A, Crystal Structure Of A Monocot (Maize Zmglu1...    177   2e-48   
ref|XP_003546992.2|  PREDICTED: cyanogenic beta-glucosidase-like ...    177   2e-48   
emb|CDY61627.1|  BnaA08g19770D                                          177   2e-48   
ref|XP_010031677.1|  PREDICTED: beta-glucosidase 11-like isoform X2     178   2e-48   
ref|XP_008443298.1|  PREDICTED: beta-glucosidase 24-like                177   2e-48   
ref|XP_007131974.1|  hypothetical protein PHAVU_011G056100g             177   2e-48   
gb|KCW51028.1|  hypothetical protein EUGRSUZ_J00645                     178   2e-48   
gb|AFU61921.1|  beta-glucosidase 2                                      174   2e-48   
ref|NP_001105454.1|  4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4...    178   2e-48   
gb|EPS59761.1|  hypothetical protein M569_15044                         177   2e-48   
ref|XP_009346072.1|  PREDICTED: beta-glucosidase 42-like                177   2e-48   
ref|XP_008445464.1|  PREDICTED: beta-glucosidase 40                     177   3e-48   
sp|P49235.1|HGGL1_MAIZE  RecName: Full=4-hydroxy-7-methoxy-3-oxo-...    178   3e-48   
gb|AFW56668.1|  beta glucosidase1                                       178   3e-48   
ref|XP_003540541.1|  PREDICTED: beta-glucosidase 13-like                177   3e-48   
gb|ABF98425.1|  Glycosyl hydrolase family 1 protein, expressed          172   3e-48   
gb|AGS43007.1|  beta-D-glucoside glucohydrolase                         177   3e-48   
pdb|1H49|A  Chain A, Crystal Structure Of The Inactive Double Mut...    177   3e-48   
emb|CDY42461.1|  BnaA10g08370D                                          177   3e-48   
ref|XP_008231323.1|  PREDICTED: vicianin hydrolase-like isoform X1      177   3e-48   
ref|XP_008224309.1|  PREDICTED: beta-glucosidase 12-like                177   3e-48   
ref|XP_002514775.1|  beta-glucosidase, putative                         176   3e-48   
ref|XP_009119981.1|  PREDICTED: putative beta-glucosidase 41            177   3e-48   



>ref|XP_011037693.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=516

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLSDGKGLSNWD+ TH PG I+DGSNGD+AADQY LY ED DL+ SLGV+S++F
Sbjct  54   YQFEGSYLSDGKGLSNWDIHTHTPGKIIDGSNGDIAADQYHLYPEDTDLMDSLGVSSYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G+IN  GI YY  LIDSLLLKGI+PFVT+ HYD+P+EL++R+ GWLS
Sbjct  114  SISWARILPRGRFGDINKVGISYYNKLIDSLLLKGIQPFVTLVHYDIPEELEERYGGWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P  QE++ Y AD+CF + GD+VKYW TFNEPN+ +I +YR G +P
Sbjct  174  PRCQEDFGYYADICFKNFGDRVKYWTTFNEPNIQTIKSYRSGEYP  218



>ref|XP_002305594.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86105.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=504

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLSDGKGLSNWD+ TH PG I+DGSNGD+AADQY LY ED DL+ SLGV+S++F
Sbjct  42   YQFEGSYLSDGKGLSNWDMHTHTPGKIIDGSNGDIAADQYHLYPEDIDLMDSLGVSSYRF  101

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G+IN  GI YY  LIDSLLLKGI+PFVT+ HYD+P+EL++R+ GWLS
Sbjct  102  SISWARILPRGRFGDINKAGISYYNKLIDSLLLKGIQPFVTLVHYDIPEELEERYGGWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P  QE++ Y AD+CF + GD+VKYW TFNEPN+ +I +YR G +P
Sbjct  162  PRCQEDFGYYADICFKNFGDRVKYWTTFNEPNIQTIKSYRSGEYP  206



>ref|XP_011037697.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=515

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLSDGKGLSNWDV +H+PGNI+DGSNGD+A DQY  Y+ED DL+ASLGVNS++F
Sbjct  51   YQFEGAYLSDGKGLSNWDVHSHKPGNIIDGSNGDIAVDQYHRYREDIDLMASLGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N+ GI YY  LI++LLLKGI+PFV++ H+D+PQEL+DR+ G+LS
Sbjct  111  SMSWARILPKGRFGGVNMAGISYYNKLINALLLKGIQPFVSLTHFDVPQELEDRYGGFLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ Y AD+CF + GD+VKYW TFNEPN  +I  YR G +P
Sbjct  171  PKSQEDFRYYADICFKYFGDRVKYWATFNEPNFQAIYGYRAGEYP  215



>gb|KEH36811.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=425

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G ILDG+NGDVA D Y  Y+ED DL+   GVNS++F
Sbjct  53   YQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLMEHTGVNSYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQEL++R++ WLS
Sbjct  113  SLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQELEERYKSWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF + GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  173  PEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYP  217



>gb|KEH36810.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=420

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G ILDG+NGDVA D Y  Y+ED DL+   GVNS++F
Sbjct  53   YQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLMEHTGVNSYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQEL++R++ WLS
Sbjct  113  SLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQELEERYKSWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF + GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  173  PEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYP  217



>ref|XP_007147744.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
 gb|ESW19738.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
Length=521

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YLSDGKGL+NWDVFTH+PG ++DGSNGDVA D Y  YKED DL+  +GVNS++F
Sbjct  51   YQIEGAYLSDGKGLNNWDVFTHKPGAVIDGSNGDVADDHYHRYKEDVDLMDYIGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  LID+LL +GIEPFVTI+HYD+PQEL DR+ GWLS
Sbjct  111  SLSWARILPKGRFGKVNRAGIDYYNRLIDTLLSRGIEPFVTISHYDIPQELVDRYDGWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++ E++ Y AD+CF + GD+VKYWITFNEPN+  I  YR G WP
Sbjct  171  PKIAEDFKYYADICFKNFGDRVKYWITFNEPNVAFIRGYRIGIWP  215



>gb|KEH36807.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=411

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G ILDG+NGDVA D Y  Y+ED DL+   GVNS++F
Sbjct  53   YQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLMEHTGVNSYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQEL++R++ WLS
Sbjct  113  SLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQELEERYKSWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF + GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  173  PEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYP  217



>gb|KEH36809.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=471

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G ILDG+NGDVA D Y  Y+ED DL+   GVNS++F
Sbjct  53   YQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLMEHTGVNSYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQEL++R++ WLS
Sbjct  113  SLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQELEERYKSWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF + GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  173  PEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYP  217



>ref|XP_002304950.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
 gb|EEE85461.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
Length=501

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLSDGKGLSNWDV TH+PGNI+DGSNGD+A DQY  Y ED DL+ASLGVNS++F
Sbjct  37   YQFEGAYLSDGKGLSNWDVHTHKPGNIIDGSNGDIAVDQYHRYLEDIDLMASLGVNSYRF  96

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N+ GI YY  LI++LLLKGI+PFV++ H+D+PQEL+DR+ G+LS
Sbjct  97   SMSWARILPKGRFGGVNMAGISYYNKLINALLLKGIQPFVSLTHFDVPQELEDRYGGFLS  156

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ Y  D+CF + GD+VKYW TFNEPN  +I  YR G  P
Sbjct  157  PKSQEDFGYYVDICFKYFGDRVKYWATFNEPNFQAIYGYRVGECP  201



>gb|KEH36808.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=477

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G ILDG+NGDVA D Y  Y+ED DL+   GVNS++F
Sbjct  53   YQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLMEHTGVNSYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQEL++R++ WLS
Sbjct  113  SLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQELEERYKSWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF + GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  173  PEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYP  217



>ref|XP_004486131.1| PREDICTED: beta-glucosidase 47-like [Cicer arietinum]
Length=496

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG + SDGKGLSNWDVFTH+PG I+DG+NGDVA D Y  YKED DL+  +GVNS++F
Sbjct  31   YQFEGAFSSDGKGLSNWDVFTHKPGTIIDGTNGDVAVDHYHRYKEDVDLMEYIGVNSYRF  90

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N  GI YY  LID+LL +GIEPFVTI HYD+PQ L+DR+ GWLS
Sbjct  91   SLSWARILPKGRFGHLNRAGIDYYNRLIDALLNRGIEPFVTITHYDIPQALEDRYGGWLS  150

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QEE+ Y AD+CF + GD+VK+W+TFNEPN+  I  YR G +P
Sbjct  151  PKIQEEFRYYADICFKYFGDRVKHWVTFNEPNVAVICGYRTGVYP  195



>ref|XP_007026020.1| Beta glucosidase 46, putative [Theobroma cacao]
 gb|EOY28642.1| Beta glucosidase 46, putative [Theobroma cacao]
Length=529

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEGGYLSDGKGL+NWDV+TH+P N++DGSNGDVA D Y+ Y ED DL+ SLGVNS++F
Sbjct  54   YQYEGGYLSDGKGLNNWDVYTHKPENVIDGSNGDVAVDHYNRYMEDIDLMVSLGVNSYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG+ G +N  GI +Y  LID+LLLKGIEPFVT+ H DLPQE++DR+  WLS
Sbjct  114  SISWARILPKGKFGEVNPAGINFYNKLIDALLLKGIEPFVTLTHVDLPQEIEDRYGSWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE QE++AY A+VCF   GD+VKYW+TFNEPN      YR G +P
Sbjct  174  PESQEDFAYFAEVCFRSFGDRVKYWVTFNEPNYQVKFGYRTGTFP  218



>gb|KJB67164.1| hypothetical protein B456_010G178800 [Gossypium raimondii]
Length=516

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEGGYLSDGKGL+NWDV+TH+PG ++DGSNGDVA D Y  Y ED DL+ SLGVNS++F
Sbjct  54   YQYEGGYLSDGKGLNNWDVYTHRPGKVIDGSNGDVAVDHYHRYLEDIDLMESLGVNSYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +N+ GI +Y NLID+LLLKGI+PFVT+ H DLPQE++DR+  WLS
Sbjct  114  SISWARILPKGRFGYVNVAGIDFYNNLIDALLLKGIKPFVTLTHIDLPQEIEDRYGSWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE Q ++AY AD+CF   GD+VKYW+TFNEPN      YR G +P
Sbjct  174  PESQLDFAYFADICFKSFGDRVKYWVTFNEPNFQVKFGYREGTFP  218



>ref|XP_002305597.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86108.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLSDGKGLSNWDV TH+PGNI+DGSNGD+A DQY  Y ED +L+ASLGVNS++F
Sbjct  51   YQFEGAYLSDGKGLSNWDVHTHKPGNIIDGSNGDIAVDQYHRYLEDIELMASLGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N+ GI YY  LI++LLLKGI+PFV++ H+D+PQEL+DR+ G+LS
Sbjct  111  SMSWARILPKGRFGGVNMAGISYYNKLINALLLKGIQPFVSLTHFDVPQELEDRYGGFLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ Y  D+CF + GD+VKYW TFNEPN  +I  YR G  P
Sbjct  171  PKSQEDFGYYVDICFKYFGDRVKYWATFNEPNFQAIYGYRVGECP  215



>gb|KEH36806.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G ILDG+NGDVA D Y  Y+ED DL+   GVNS++F
Sbjct  53   YQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLMEHTGVNSYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQEL++R++ WLS
Sbjct  113  SLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQELEERYKSWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF + GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  173  PEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYP  217



>ref|XP_002264678.3| PREDICTED: beta-glucosidase 46-like [Vitis vinifera]
Length=530

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGL+NWDVF+H+PGNI DGS GD+A D Y  Y ED DL+ SLGVNS++F
Sbjct  62   YQFEGAFLNDGKGLNNWDVFSHEPGNIRDGSTGDIAVDHYHRYLEDIDLMVSLGVNSYRF  121

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GI YY  LID+L+LKG+EPFVT+ H+D+PQEL+D F GWLS
Sbjct  122  SISWARILPEGRFGEVNAAGIDYYNKLIDALVLKGLEPFVTLTHFDIPQELEDTFGGWLS  181

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QEE+ Y AD+CF   GD+VKYW+TFNEPN+   A YR G +P
Sbjct  182  PKLQEEFRYYADICFKTFGDRVKYWVTFNEPNIQVTAGYRSGSYP  226



>ref|XP_010267720.1| PREDICTED: beta-glucosidase 46 isoform X3 [Nelumbo nucifera]
Length=522

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVF+H+PGNI+DGSNGD+A D Y  Y ED +L+ SLGVNS++F
Sbjct  50   YQFEGAFLSDGKGLNNWDVFSHKPGNIVDGSNGDIAVDHYHRYLEDIELMQSLGVNSYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G  N +GI +Y NLI++LL KGIEPFVT+NHYD+PQEL+DR+  WLS
Sbjct  110  SISWARILPKGRFGERNRQGIDHYNNLINALLRKGIEPFVTLNHYDIPQELEDRYGAWLS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q+++ YLADVCF   GD+VKYW TFNEPN+ ++  YR G  P
Sbjct  170  PDIQDDFGYLADVCFEAFGDRVKYWTTFNEPNVVAVRGYRSGIHP  214



>emb|CDO99725.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGLSNWD+F+H+ GNILDGSNGD+A D Y  Y ED DL+  LGVNS++F
Sbjct  34   YQFEGAFLSDGKGLSNWDIFSHEAGNILDGSNGDIAVDHYHRYLEDLDLMEDLGVNSYRF  93

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR GN+N+ GIK+Y  LID+LL KGI PF ++ HYD+PQEL++R+  WLS
Sbjct  94   SISWARVLPKGRFGNVNMAGIKHYNKLIDALLDKGISPFASLTHYDIPQELEERYGAWLS  153

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q+++ Y AD+CF + GD+VKYW+TFNEPN+ +I  YR G +P
Sbjct  154  PKVQDDFRYYADICFKYFGDRVKYWVTFNEPNVVAIRGYRSGIYP  198



>ref|XP_010533827.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG YL++GKGL+NWDVFTH QPG ILDGSNGD+A DQY  + ED +L+ASLGVNS++
Sbjct  48   YQYEGAYLTEGKGLNNWDVFTHHQPGKILDGSNGDIAVDQYHRFLEDIELMASLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR G IN  GIKYY  LID+LL KGI+PFVT+NH D PQEL+DR+Q WL
Sbjct  108  FSISWARILPKGRFGGINYSGIKYYNRLIDALLSKGIQPFVTLNHLDYPQELEDRYQSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE++E++ YLAD CF + G +VK+WIT NEPN   + +YR G +P
Sbjct  168  SPEIREDFGYLADTCFRYFGHRVKHWITVNEPNQQIVLSYRKGIFP  213



>emb|CBI23186.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   243 bits (619),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGL+NWDVF+H+PGNI DGS GD+A D Y  Y ED DL+ SLGVNS++F
Sbjct  62   YQFEGAFLNDGKGLNNWDVFSHEPGNIRDGSTGDIAVDHYHRYLEDIDLMVSLGVNSYRF  121

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GI YY  LID+L+LKG+EPFVT+ H+D+PQEL+D F GWLS
Sbjct  122  SISWARILPEGRFGEVNAAGIDYYNKLIDALVLKGLEPFVTLTHFDIPQELEDTFGGWLS  181

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QEE+ Y AD+CF   GD+VKYW+TFNEPN+   A YR G +P
Sbjct  182  PKLQEEFRYYADICFKTFGDRVKYWVTFNEPNIQVTAGYRSGSYP  226



>ref|XP_004293271.1| PREDICTED: beta-glucosidase 47 [Fragaria vesca subsp. vesca]
Length=514

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGK L+NWDVF+H+PGNILDG+NGD+A DQY LY+ED DL+  +GVNS++F
Sbjct  47   YQFEGAFLNDGKSLNNWDVFSHKPGNILDGTNGDIAVDQYHLYQEDLDLMDYIGVNSYRF  106

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +N  GI +Y  LID+LLL+GI+PFVT+ HYD+PQEL+DR+  WLS
Sbjct  107  SISWARILPKGRFGKVNRAGIDHYNKLIDALLLRGIQPFVTLTHYDIPQELEDRYGAWLS  166

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +QE++ Y AD+CF   GD+VKYW TFNEPN+ +I  YR G +P
Sbjct  167  PLLQEDFRYYADICFKFFGDRVKYWSTFNEPNVLAIRGYRSGIYP  211



>gb|KHG29721.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=536

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGN-ILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEGGYL+DGKGL+NWDV++H+PGN I+DGSN D+A D Y  Y ED DL+ SLGVNS++
Sbjct  59   YQYEGGYLADGKGLNNWDVYSHKPGNLIVDGSNADIAVDHYHRYLEDIDLMHSLGVNSYR  118

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR G IN  GIK+Y NLID LLLKGIEPFVT+ H D PQEL+DR+  WL
Sbjct  119  FSISWARILPKGRFGEINEAGIKFYNNLIDGLLLKGIEPFVTLTHIDFPQELEDRYGSWL  178

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE QE++AY AD+CF   GD+VKYW+TFNEP+      YR G +P
Sbjct  179  SPESQEDFAYFADICFKSFGDRVKYWVTFNEPDFQVKYGYRLGTFP  224



>gb|KHG29722.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=561

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGN-ILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEGGYL+DGKGL+NWDV++H+PGN I+DGSN D+A D Y  Y ED DL+ SLGVNS++
Sbjct  59   YQYEGGYLADGKGLNNWDVYSHKPGNLIVDGSNADIAVDHYHRYLEDIDLMHSLGVNSYR  118

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR G IN  GIK+Y NLID LLLKGIEPFVT+ H D PQEL+DR+  WL
Sbjct  119  FSISWARILPKGRFGEINEAGIKFYNNLIDGLLLKGIEPFVTLTHIDFPQELEDRYGSWL  178

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE QE++AY AD+CF   GD+VKYW+TFNEP+      YR G +P
Sbjct  179  SPESQEDFAYFADICFKSFGDRVKYWVTFNEPDFQVKYGYRLGTFP  224



>gb|ACJ85625.1| unknown [Medicago truncatula]
Length=238

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YLSDGKGLSNWDVFTH+PG+  DGSNGDV  DQY  Y ED DL+ ++ VNS++F
Sbjct  42   YQYEGAYLSDGKGLSNWDVFTHKPGSTHDGSNGDVTVDQYHRYLEDVDLMEAIKVNSYRF  101

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +NL GI YY  LI +LLL+GI+PFVT+ H D PQEL+DR+ GWLS
Sbjct  102  SISWARILPKGRFGEVNLAGIDYYNRLIHALLLRGIQPFVTLFHLDFPQELEDRYGGWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++   AD+CF   GD+VKYW TFNEPN+     YR G  P
Sbjct  162  PQSQEDFVLFADICFKSFGDRVKYWTTFNEPNLQVSLGYRKGKHP  206



>ref|XP_010267719.1| PREDICTED: beta-glucosidase 46 isoform X2 [Nelumbo nucifera]
Length=544

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            Q+EG +LSDGKGL+NWDVF+H+PGNI+DGSNGD+A D Y  Y ED +L+ SLGVNS++FS
Sbjct  73   QFEGAFLSDGKGLNNWDVFSHKPGNIVDGSNGDIAVDHYHRYLEDIELMQSLGVNSYRFS  132

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            ISW+R+LPKGR G  N +GI +Y NLI++LL KGIEPFVT+NHYD+PQEL+DR+  WLSP
Sbjct  133  ISWARILPKGRFGERNRQGIDHYNNLINALLRKGIEPFVTLNHYDIPQELEDRYGAWLSP  192

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            ++Q+++ YLADVCF   GD+VKYW TFNEPN+ ++  YR G  P
Sbjct  193  DIQDDFGYLADVCFEAFGDRVKYWTTFNEPNVVAVRGYRSGIHP  236



>ref|XP_006383935.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
 gb|ERP61732.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
Length=503

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLSDGKGLSNWD+FTH  G I+DGSNGD+A DQY  + ED DL+ +LGVNS++F
Sbjct  51   YQFEGAYLSDGKGLSNWDIFTHTSGKIIDGSNGDIAVDQYHRFLEDIDLMETLGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G+IN  GI YY  LI++LLLKGI+PFVT+ HYD+PQEL++R+ GWLS
Sbjct  111  SISWARILPKGRFGDINRAGISYYNKLINALLLKGIQPFVTLTHYDMPQELEERYGGWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ Y  D+CF + GD+V YW+TFNEPN+  I  YR G  P
Sbjct  171  PKCQEDFGYYVDICFKYFGDRVNYWVTFNEPNLQVINGYRTGESP  215



>gb|KDP39384.1| hypothetical protein JCGZ_01141 [Jatropha curcas]
Length=488

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   KGLSNWDVF+H PG I DGSNGDVA D Y LY ED +L+ SLGVNS++F
Sbjct  25   YQVEGAYLEANKGLSNWDVFSHLPGKIKDGSNGDVADDHYHLYLEDIELMHSLGVNSYRF  84

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLPKGR GN+N  GI+YY NL D+LLLKGI+PFVT+NHYD+PQEL+DR+  WLS
Sbjct  85   SISWSRVLPKGRFGNVNAAGIEYYNNLTDALLLKGIQPFVTLNHYDVPQELEDRYGSWLS  144

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ + A+VCF   GD+VKYWIT NEPN+ + A+Y  G +P
Sbjct  145  PQIQEDFGHFAEVCFQAFGDRVKYWITLNEPNVMAQASYYSGQYP  189



>ref|XP_012071272.1| PREDICTED: beta-glucosidase 18-like [Jatropha curcas]
Length=502

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   KGLSNWDVF+H PG I DGSNGDVA D Y LY ED +L+ SLGVNS++F
Sbjct  39   YQVEGAYLEANKGLSNWDVFSHLPGKIKDGSNGDVADDHYHLYLEDIELMHSLGVNSYRF  98

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLPKGR GN+N  GI+YY NL D+LLLKGI+PFVT+NHYD+PQEL+DR+  WLS
Sbjct  99   SISWSRVLPKGRFGNVNAAGIEYYNNLTDALLLKGIQPFVTLNHYDVPQELEDRYGSWLS  158

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ + A+VCF   GD+VKYWIT NEPN+ + A+Y  G +P
Sbjct  159  PQIQEDFGHFAEVCFQAFGDRVKYWITLNEPNVMAQASYYSGQYP  203



>ref|XP_010057964.1| PREDICTED: beta-glucosidase 46 isoform X3 [Eucalyptus grandis]
Length=523

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG Y SDGKGL+NWDVF H+PGNI+DGS GD+A D Y  Y ED  L+ SLGVNS++F
Sbjct  49   YQFEGAYKSDGKGLNNWDVFAHEPGNIIDGSTGDIAVDHYHRYLEDIRLMESLGVNSYRF  108

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR   IN+ GI YY  LI+SLL KGI+PFVT+ H+D+PQEL+DR+ GWLS
Sbjct  109  SISWARILPKGRFAEINMAGIHYYNRLINSLLQKGIQPFVTLTHFDIPQELEDRYGGWLS  168

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ Y AD+CF + GD+VKYW+TFNEPN+ +   YR+G +P
Sbjct  169  PKSQEDFGYFADICFRYFGDRVKYWVTFNEPNIQATLAYRWGEFP  213



>ref|XP_010057961.1| PREDICTED: beta-glucosidase 46 isoform X1 [Eucalyptus grandis]
 ref|XP_010057963.1| PREDICTED: beta-glucosidase 46 isoform X2 [Eucalyptus grandis]
Length=524

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG Y SDGKGL+NWDVF H+PGNI+DGS GD+A D Y  Y ED  L+ SLGVNS++F
Sbjct  49   YQFEGAYKSDGKGLNNWDVFAHEPGNIIDGSTGDIAVDHYHRYLEDIRLMESLGVNSYRF  108

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR   IN+ GI YY  LI+SLL KGI+PFVT+ H+D+PQEL+DR+ GWLS
Sbjct  109  SISWARILPKGRFAEINMAGIHYYNRLINSLLQKGIQPFVTLTHFDIPQELEDRYGGWLS  168

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ Y AD+CF + GD+VKYW+TFNEPN+ +   YR+G +P
Sbjct  169  PKSQEDFGYFADICFRYFGDRVKYWVTFNEPNIQATLAYRWGEFP  213



>gb|KCW75357.1| hypothetical protein EUGRSUZ_E04103 [Eucalyptus grandis]
Length=524

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG Y SDGKGL+NWDVF H+PGNI+DGS GD+A D Y  Y ED  L+ SLGVNS++F
Sbjct  49   YQFEGAYKSDGKGLNNWDVFAHEPGNIIDGSTGDIAVDHYHRYLEDIRLMESLGVNSYRF  108

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR   IN+ GI YY  LI+SLL KGI+PFVT+ H+D+PQEL+DR+ GWLS
Sbjct  109  SISWARILPKGRFAEINMAGIHYYNRLINSLLQKGIQPFVTLTHFDIPQELEDRYGGWLS  168

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ Y AD+CF + GD+VKYW+TFNEPN+ +   YR+G +P
Sbjct  169  PKSQEDFGYFADICFRYFGDRVKYWVTFNEPNIQATLAYRWGEFP  213



>gb|KHN33045.1| Beta-glucosidase 47 [Glycine soja]
Length=525

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YL+DGKGL+NWDVFTH+PG I+DG+NGDVA D Y  Y+ED DL+  +GVNS++F
Sbjct  54   YQFEGAYLTDGKGLNNWDVFTHKPGTIMDGTNGDVAVDHYHRYQEDVDLMDYIGVNSYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  L+D+++ K IEPFVT++HYD+P EL++R+ GWLS
Sbjct  114  SLSWARILPKGRFGKVNWAGIDYYNQLVDTIVSKEIEPFVTMSHYDIPLELEERYGGWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y A++CF + GD+VKYW+TFNEPN+ +I  YR G WP
Sbjct  174  PEIQEDFKYYANICFKNFGDRVKYWVTFNEPNVATIRGYRTGMWP  218



>ref|XP_007153926.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
 gb|ESW25920.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
Length=382

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG Y SDGKGL+NWDVF+H+ G+I DGSNGDVA DQY  Y+ED DL+ ++ VNS++F
Sbjct  34   YQYEGAYSSDGKGLNNWDVFSHRIGSISDGSNGDVAVDQYHRYQEDIDLMEAMKVNSYRF  93

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LP+GR G +NL GI YY  LID+LLLKGI+PFVT+ H+D+PQEL+DR+  WLS
Sbjct  94   SVSWARILPEGRFGEVNLAGINYYNRLIDALLLKGIQPFVTLFHFDIPQELEDRYGAWLS  153

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ +LAD+CF   GD+VKYW+TFNEPN      YR G +P
Sbjct  154  PQSQEDFQFLADICFKSFGDRVKYWVTFNEPNYIIPLAYRVGQFP  198



>ref|XP_003529623.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03065.1| Beta-glucosidase 46 [Glycine soja]
Length=554

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YLSDGKG+SNWDVFTH+PG+I D SNGDVA DQY  Y ED DL+ ++ VNS++F
Sbjct  65   YQYEGAYLSDGKGISNWDVFTHKPGSISDESNGDVAVDQYHRYLEDIDLMEAIKVNSYRF  124

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +NL GI YY  LI++LLLKGI+PFVT+ H+D+PQEL+DR+ GWLS
Sbjct  125  SISWARILPKGRFGEVNLAGINYYNRLIEALLLKGIQPFVTLFHFDIPQELEDRYGGWLS  184

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++   AD+CF   GD+VKYW+TFNEPN      YR G +P
Sbjct  185  PQSQEDFQLFADICFKSFGDRVKYWVTFNEPNYLVPLAYRLGIFP  229



>gb|KJB67161.1| hypothetical protein B456_010G178500 [Gossypium raimondii]
Length=527

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+PGNI+DGSNGD   D Y LY+ED DL+  +GVNS++F
Sbjct  46   YQFEGAFLSDGKGLNNWDVFTHKPGNIMDGSNGDTTVDHYHLYQEDLDLMQDIGVNSYRF  105

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G++N  GI +Y  LI+SLLLKGI+PFV++ HYD+PQEL++R+  WLS
Sbjct  106  SISWARILPKGRFGSVNKAGIHHYNKLINSLLLKGIQPFVSLTHYDIPQELENRYGAWLS  165

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++QE++ Y AD+CF + GD+VKYW TFNEPN+  I  YR G +P
Sbjct  166  SQVQEDFKYHADICFKYFGDRVKYWTTFNEPNVAVIRGYRSGIYP  210



>ref|XP_011652764.1| PREDICTED: beta-glucosidase 47 [Cucumis sativus]
 gb|KGN64542.1| hypothetical protein Csa_1G064150 [Cucumis sativus]
Length=523

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGLSNWDVFTH+PG I DG+NGDVA DQY LY+ED DL+  +GVNS++F
Sbjct  52   YQFEGAFLSDGKGLSNWDVFTHEPGTIKDGTNGDVAVDQYHLYQEDLDLMEFIGVNSYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GI +Y  LIDSLL +GIEPFVT+ HYD+PQ+L+D++  WLS
Sbjct  112  SISWARILPEGRFGEVNRAGIDHYNKLIDSLLKRGIEPFVTLTHYDIPQKLEDKYGAWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +QE++ Y AD+CF   G++VKYW+TFNEPN+  I  YR G +P
Sbjct  172  PLVQEDFRYYADICFKSFGNRVKYWVTFNEPNVQVIRGYRKGTFP  216



>ref|XP_002888064.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64323.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            +QYEG +L+DGKGL+NWDVF H+ PG I+DGSNGD+A DQY  Y ED   ++ LGVNS++
Sbjct  48   FQYEGAFLNDGKGLNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQSMSFLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLP GR G IN +GIKYY NLID+L+ KGI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  LSISWSRVLPNGRFGGINYKGIKYYNNLIDALIRKGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EMQ+++AYLAD+CF H GD+VK+WIT NEPN   I  YR G +P
Sbjct  168  SSEMQKDFAYLADICFKHFGDRVKHWITINEPNQQIILAYRSGLFP  213



>ref|XP_008364100.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 47-like [Malus 
domestica]
Length=518

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGLSNWDVFTH+PG+I DG+NGD+A DQY LY ED DL+  +GVN+++F
Sbjct  51   YQFEGAFLTDGKGLSNWDVFTHKPGHISDGTNGDIADDQYHLYLEDLDLMNYIGVNTYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y   ID+LL +GI PFVT+ HYD+PQEL+DR+  WLS
Sbjct  111  SISWARVLPKGRFGKVNRAGINHYDKFIDALLRRGIHPFVTLTHYDIPQELEDRYGAWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  171  PQLQEDFVYYANTCFKFFGDRVKYWVTFNEPNVVVIRGYRSGMYP  215



>ref|XP_008441244.1| PREDICTED: beta-glucosidase 47 [Cucumis melo]
Length=522

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWD+FTH+PGNI DG+NGDVA DQY  Y+ED DL+  +GVNS++F
Sbjct  52   YQFEGAFLSDGKGLNNWDIFTHKPGNIKDGTNGDVAVDQYHRYQEDVDLMEFIGVNSYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GI +Y  LID+LL +GIEPFVT+ HYD+PQ+L+D++  WLS
Sbjct  112  SISWARILPQGRFGEVNNAGIDHYNKLIDALLERGIEPFVTLAHYDIPQKLEDKYGAWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +QE++ Y AD+CF   G++VKYW+TFNEPN+  I +YR G +P
Sbjct  172  PLVQEDFTYYADICFKSFGNRVKYWVTFNEPNVQVIRSYRKGTFP  216



>ref|XP_009363745.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Pyrus x bretschneideri]
Length=518

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGLSNWDVFTH+PG+I DG+NGD+A DQY LY ED DL+  +GVN+++F
Sbjct  51   YQFEGAFLTDGKGLSNWDVFTHKPGHISDGTNGDIADDQYHLYLEDLDLMNYIGVNTYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y   ID+LL +GI PFVT+ HYD+PQEL+DR+  WLS
Sbjct  111  SISWARVLPKGRFGKVNRAGINHYNKFIDALLRRGIHPFVTLTHYDIPQELEDRYGAWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  171  PQLQEDFLYYANTCFKFFGDRVKYWVTFNEPNVVVIRGYRSGVYP  215



>ref|XP_003547247.2| PREDICTED: beta-glucosidase 47-like [Glycine max]
Length=929

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YL+DGKGL+NWDVFTH+PG I+DG+NGDVA D Y  Y+ED DL+  +GVNS++F
Sbjct  458  YQFEGAYLTDGKGLNNWDVFTHKPGTIMDGTNGDVAVDHYHRYQEDVDLMDYIGVNSYRF  517

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G +N  GI YY  L+D+++ K IEPFVT++HYD+P EL++R+ GWLS
Sbjct  518  SLSWARILPKGRFGKVNWAGIDYYNQLVDTIVSKEIEPFVTMSHYDIPLELEERYGGWLS  577

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y A++CF + GD+VKYW+TFNEPN+ +I  YR G WP
Sbjct  578  PEIQEDFKYYANICFKNFGDRVKYWVTFNEPNVATIRGYRTGMWP  622



>ref|XP_006348202.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=315

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G+I DGSNGDVA D Y+ Y ED  L+  +GVNS++F
Sbjct  69   YQFEGAFLSDGKGLNNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDVKLMEDMGVNSYRF  128

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+PF+T+ HYD+PQEL++R+ GWLS
Sbjct  129  SISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPFITLTHYDIPQELEERYGGWLS  188

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              +Q++++Y AD+CF + GD+VKYW T NEP++ ++  YR G +P
Sbjct  189  SRIQDDFSYYADICFKYFGDRVKYWTTINEPHVMAVYGYRLGSYP  233



>ref|XP_010267718.1| PREDICTED: beta-glucosidase 46 isoform X1 [Nelumbo nucifera]
Length=857

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            Q+EG +LSDGKGL+NWDVF+H+PGNI+DGSNGD+A D Y  Y ED +L+ SLGVNS++FS
Sbjct  386  QFEGAFLSDGKGLNNWDVFSHKPGNIVDGSNGDIAVDHYHRYLEDIELMQSLGVNSYRFS  445

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            ISW+R+LPKGR G  N +GI +Y NLI++LL KGIEPFVT+NHYD+PQEL+DR+  WLSP
Sbjct  446  ISWARILPKGRFGERNRQGIDHYNNLINALLRKGIEPFVTLNHYDIPQELEDRYGAWLSP  505

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            ++Q+++ YLADVCF   GD+VKYW TFNEPN+ ++  YR G  P
Sbjct  506  DIQDDFGYLADVCFEAFGDRVKYWTTFNEPNVVAVRGYRSGIHP  549



>ref|XP_006468004.1| PREDICTED: beta-glucosidase 46-like [Citrus sinensis]
Length=558

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+S+GKGLSNWDVFTH PGNI DGS+GDVA D Y  Y ED DL+ SLGVNS++F
Sbjct  84   YQVEGAYVSEGKGLSNWDVFTHTPGNIDDGSSGDVAVDHYHRYLEDIDLMESLGVNSYRF  143

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G++N EGI +Y  LID+LLLKGI+PFVT+  +D PQE++D++  WLS
Sbjct  144  SISWARILPKGRFGDVNSEGINHYNKLIDALLLKGIQPFVTLTQFDSPQEIEDKYGAWLS  203

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE QE++ Y AD+CF   GD+VKYW T NEPNM    +YR G  P
Sbjct  204  PESQEDFGYFADICFKSFGDRVKYWFTINEPNMQVTLSYRLGCHP  248



>ref|XP_006301036.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
 gb|EOA33934.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
Length=520

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +LS+GKGL+NWD+FTH+ PG I D +NGD+A DQY  + ED DL+ SLGVNS++
Sbjct  54   YQYEGAFLSEGKGLNNWDIFTHEYPGKIRDENNGDMAVDQYHRFMEDIDLMTSLGVNSYR  113

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G+IN  GI YY  LID+L+ +GI+PFVT+NH+D PQEL++RFQ WL
Sbjct  114  FSISWSRVLPRGRFGSINYSGITYYNRLIDALISRGIKPFVTLNHFDYPQELENRFQSWL  173

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ+E+ YLAD CF H GD+VK WIT NEPN    ++Y  G +P
Sbjct  174  SPEMQKEFMYLADTCFKHFGDRVKLWITLNEPNQQITSSYLKGSFP  219



>ref|XP_007211830.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
 gb|EMJ13029.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
Length=505

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGL+NWDVFTH+PG+I DG+NGD+A DQY LY ED DL++ +GV+S++F
Sbjct  38   YQFEGAFLTDGKGLNNWDVFTHKPGHISDGTNGDIAVDQYHLYLEDLDLMSYIGVDSYRF  97

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+W+RVLPKGR G +N  GI +Y   ID+LL +GI+PFVT++HYD+PQEL+DR+  WLS
Sbjct  98   SIAWARVLPKGRFGKVNRAGIDHYNKFIDALLSRGIQPFVTLSHYDIPQELEDRYGAWLS  157

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  158  PKVQEDFKYYANTCFKLFGDRVKYWVTFNEPNVVVIRGYRSGIYP  202



>ref|XP_007153925.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
 gb|ESW25919.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
Length=517

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG Y SDGKGL+NWDVF+H+ G+I DGSNGDVA DQY  Y+ED DL+ ++ VNS++F
Sbjct  34   YQYEGAYSSDGKGLNNWDVFSHRIGSISDGSNGDVAVDQYHRYQEDIDLMEAMKVNSYRF  93

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LP+GR G +NL GI YY  LID+LLLKGI+PFVT+ H+D+PQEL+DR+  WLS
Sbjct  94   SVSWARILPEGRFGEVNLAGINYYNRLIDALLLKGIQPFVTLFHFDIPQELEDRYGAWLS  153

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++ +LAD+CF   GD+VKYW+TFNEPN      YR G +P
Sbjct  154  PQSQEDFQFLADICFKSFGDRVKYWVTFNEPNYIIPLAYRVGQFP  198



>ref|XP_009774064.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=509

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +LSDGKGLSNWDVFTH+ G++ DGSNGDVA D Y  Y ED  L+A +GVNS +F
Sbjct  45   YQYEGAFLSDGKGLSNWDVFTHEAGHVKDGSNGDVAVDHYHRYLEDIKLMADMGVNSFRF  104

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +N+ GI+YY  LID+LLLKGI+PFVT+ HYD+PQEL+DR+ GWL+
Sbjct  105  SISWARILPKGRFGKVNMAGIEYYSKLIDALLLKGIQPFVTLTHYDIPQELEDRYGGWLN  164

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q +++Y A++CF + GD+VKYWIT NE +  +I+ YR G +P
Sbjct  165  SQIQYDFSYFANICFKYFGDRVKYWITMNEASFVAISGYRDGSYP  209



>ref|XP_008384042.1| PREDICTED: beta-glucosidase 46-like isoform X4 [Malus domestica]
Length=462

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YL+DGK LSNWDVFTH+PG+I DG+NGD+A DQY LY ED DL+  +GVN+++F
Sbjct  31   YQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLMNYIGVNTYRF  90

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQEL+DR+  WLS
Sbjct  91   SISWARVLPKGRFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQELEDRYGAWLS  150

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q+++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  151  SQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYP  195



>tpg|DAA36950.1| TPA: hypothetical protein ZEAMMB73_322711, partial [Zea mays]
Length=278

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL D KGLSNWDVF+H PGNI DGSNGDVAAD Y  YK+D +++ S+G++S++F
Sbjct  39   YQVEGAYLDDSKGLSNWDVFSHVPGNIDDGSNGDVAADHYHRYKDDIEMMHSIGLSSYRF  98

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SWSR+LPKGR G +N  G+K+Y +LI+ LL KGI+PFVTINHYD+P+ELQ+R+  WL+
Sbjct  99   SLSWSRILPKGRFGGVNQAGVKFYNSLINGLLEKGIQPFVTINHYDIPEELQERYNSWLN  158

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y  ++CF   GD+VK+W+TFNEPN+     Y  G +P
Sbjct  159  PEIQEDFTYFVELCFKMFGDRVKHWVTFNEPNLIVKLAYSIGAFP  203



>ref|XP_008384041.1| PREDICTED: beta-glucosidase 46-like isoform X3 [Malus domestica]
Length=464

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YL+DGK LSNWDVFTH+PG+I DG+NGD+A DQY LY ED DL+  +GVN+++F
Sbjct  31   YQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLMNYIGVNTYRF  90

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQEL+DR+  WLS
Sbjct  91   SISWARVLPKGRFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQELEDRYGAWLS  150

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q+++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  151  SQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYP  195



>ref|XP_006468001.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Citrus sinensis]
Length=509

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +L+DGKGL+NWD FTH+PGNI+DGSNGDVA D Y  Y +D DL+  LGVNS++F
Sbjct  52   YQYEGAFLTDGKGLNNWDNFTHKPGNIMDGSNGDVAVDHYHRYLQDLDLMDYLGVNSYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G++N  GI +Y  LI++LLLKGI+PFVT+ HYD+PQEL DR+  WLS
Sbjct  112  SISWARVLPKGRFGDVNWAGIDHYNKLINALLLKGIQPFVTLTHYDIPQELADRYGPWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+QE++ Y AD+CF + GD+VKYW TFNEPN+  I  Y+ G +P
Sbjct  172  REVQEDFEYYADICFKYFGDRVKYWATFNEPNVVVIRGYQSGIYP  216



>ref|XP_002304951.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE85462.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLS GKGLSNWDVFTH+PG I+DG+NGD+A D Y  Y ED DL+  +GVNS++ 
Sbjct  51   YQFEGAYLSHGKGLSNWDVFTHKPGTIMDGTNGDIAVDHYHRYPEDLDLMEYIGVNSYRV  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G  N  GI +Y   I+ LL +GI+PFVT+ HYD+PQEL+DR+  WLS
Sbjct  111  SISWARILPKGRFGTANRAGINHYNKFINELLRRGIQPFVTLTHYDIPQELEDRYGAWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF   GD+VKYW TFNEPN+ +I  YR G +P
Sbjct  171  PEIQEDFKYYADICFKSFGDRVKYWTTFNEPNVAAIRGYRSGIFP  215



>ref|XP_006468000.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Citrus sinensis]
Length=519

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +L+DGKGL+NWD FTH+PGNI+DGSNGDVA D Y  Y +D DL+  LGVNS++F
Sbjct  52   YQYEGAFLTDGKGLNNWDNFTHKPGNIMDGSNGDVAVDHYHRYLQDLDLMDYLGVNSYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G++N  GI +Y  LI++LLLKGI+PFVT+ HYD+PQEL DR+  WLS
Sbjct  112  SISWARVLPKGRFGDVNWAGIDHYNKLINALLLKGIQPFVTLTHYDIPQELADRYGPWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+QE++ Y AD+CF + GD+VKYW TFNEPN+  I  Y+ G +P
Sbjct  172  REVQEDFEYYADICFKYFGDRVKYWATFNEPNVVVIRGYQSGIYP  216



>ref|XP_008384039.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Malus domestica]
Length=518

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YL+DGK LSNWDVFTH+PG+I DG+NGD+A DQY LY ED DL+  +GVN+++F
Sbjct  51   YQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLMNYIGVNTYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQEL+DR+  WLS
Sbjct  111  SISWARVLPKGRFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQELEDRYGAWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q+++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  171  SQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYP  215



>ref|XP_009770584.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=538

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G+I DGSNGD+A D Y+ Y+ED  L+  +GV+S +F
Sbjct  74   YQFEGAFLSDGKGLNNWDVFTHEVGHIADGSNGDIALDHYNRYREDIKLMEDMGVDSFRF  133

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP G +G+IN+ GI++Y  LI++L+ KGIEPFVT+ HYD+PQEL+DR+ GWLS
Sbjct  134  SISWARILPNGMYGDINIAGIQHYSKLINALIQKGIEPFVTLTHYDIPQELEDRYGGWLS  193

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q +++Y AD+CF + GD+VKYW+T NEPN+ ++  YR G +P
Sbjct  194  PKIQSDFSYYADICFKYFGDRVKYWVTMNEPNVMAVRGYRLGTFP  238



>ref|XP_009803936.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=517

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YLSDGKGLSNWDVFTH+ G+I +GSNGDVA D Y  Y ED  L+A +GVNS++F
Sbjct  54   YQYEGAYLSDGKGLSNWDVFTHEAGHIKEGSNGDVAVDHYHRYLEDIKLMADIGVNSYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G +N+ GI++Y  LID+LL KGI+PFVT+ H+D+PQELQDR+ GWLS
Sbjct  114  SISWARILPKGIFGEVNMAGIEFYSKLIDALLQKGIQPFVTLTHFDIPQELQDRYGGWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +++++++Y A++CF + GD+VKYW+T NE N  +IA YR G +P
Sbjct  174  SQIRDDFSYFANICFKYFGDRVKYWVTMNEANFMAIAGYRDGTYP  218



>ref|XP_009617373.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=531

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G+I DGSNGD+A D Y+ Y+ED  L+  +GVNS +F
Sbjct  66   YQFEGAFLSDGKGLNNWDVFTHEAGHIADGSNGDIALDHYNRYREDIKLMEDMGVNSFRF  125

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP G +G++NL GI++Y  LI++L+  GIEPFVT+ HYD+PQEL+DR+ GWLS
Sbjct  126  SISWARILPNGMYGDVNLAGIQHYNKLINALIQNGIEPFVTLTHYDIPQELEDRYGGWLS  185

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q E++  AD+CF + GD+VKYW+T NEPN+ ++  YR G +P
Sbjct  186  PKIQSEFSCYADICFKYFGDRVKYWVTMNEPNVMAVRGYRLGTFP  230



>ref|XP_007026017.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
 gb|EOY28639.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
Length=529

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNIL-DGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEGG++SDGKGL+NWDV++H+PGN++ DGSNGD+A D Y  Y ED DL+ SLGVNS++
Sbjct  53   YQYEGGFMSDGKGLNNWDVYSHKPGNMIADGSNGDIAVDHYHRYLEDIDLMHSLGVNSYR  112

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR G IN  GI +Y  LID+LLLKGI+P VT+ H D PQEL+DR+  WL
Sbjct  113  FSISWARILPKGRFGKINEAGINFYNKLIDALLLKGIKPLVTLTHVDFPQELEDRYGSWL  172

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE QE++AY AD+CF   GD+V+YW+TFNEP+      YR G +P
Sbjct  173  SPEWQEDFAYFADICFKSFGDRVQYWVTFNEPDFQVKFAYRTGIFP  218



>ref|XP_011037696.1| PREDICTED: beta-glucosidase 47-like [Populus euphratica]
Length=535

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLS GKGLSNWDVFTH+PG I+DG+NGDVA D Y  Y ED DL   +GVNS++F
Sbjct  71   YQFEGAYLSHGKGLSNWDVFTHKPGTIMDGTNGDVAVDHYHRYPEDLDLTEYIGVNSYRF  130

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G  N  GI +Y   I+ LL +GI+PFVT+ HYD+PQEL+DR+  WLS
Sbjct  131  SISWARILPKGRFGTANRAGINHYNKFINELLRRGIQPFVTLTHYDIPQELEDRYGAWLS  190

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y AD+CF   GD+VKYW TFNEPN+ +   YR G +P
Sbjct  191  PEIQEDFKYYADICFKSFGDRVKYWTTFNEPNVAASRGYRSGIFP  235



>emb|CDY25325.1| BnaC01g29940D [Brassica napus]
Length=479

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG YL+DGKGL+NWDVF+H+ PG+ILDG NGD+A DQY+ + ED   +  LGVNS++
Sbjct  48   YQYEGAYLTDGKGLNNWDVFSHEKPGDILDGGNGDIAVDQYNRFMEDIQSMNYLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLPKGR G IN  G+++Y  LID+L+  GI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  FSISWSRVLPKGRLGGINHLGVEHYNRLIDALIRNGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ+E+ YLAD CF H GD+VK+WIT NEPN   I +Y  G +P
Sbjct  168  SPEMQKEFGYLADTCFKHFGDRVKHWITINEPNQQIILSYLKGIFP  213



>ref|XP_007026019.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
 gb|EOY28641.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
Length=540

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNIL-DGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEGG++SDGKGL+NWDV++H+PGN++ DGSNGD+A D Y  Y ED DL+ SLGVNS++
Sbjct  53   YQYEGGFMSDGKGLNNWDVYSHKPGNMIADGSNGDIAVDHYHRYLEDIDLMHSLGVNSYR  112

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR G IN  GI +Y  LID+LLLKGI+P VT+ H D PQEL+DR+  WL
Sbjct  113  FSISWARILPKGRFGKINEAGINFYNKLIDALLLKGIKPLVTLTHVDFPQELEDRYGSWL  172

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE QE++AY AD+CF   GD+V+YW+TFNEP+      YR G +P
Sbjct  173  SPEWQEDFAYFADICFKSFGDRVQYWVTFNEPDFQVKFAYRTGIFP  218



>ref|XP_009105270.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Brassica rapa]
Length=517

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG YL+DGKGL+NWDVF+H+ PG+ILDG NGD+A DQY+ + ED   +  LGVNS++
Sbjct  48   YQYEGAYLTDGKGLNNWDVFSHENPGDILDGGNGDIAVDQYNRFMEDIQSMNYLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLPKGR G+IN  GIK+Y  LID+L+  GI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  FSISWSRVLPKGRLGSINHLGIKHYNRLIDALIRNGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ+E+ YLAD CF + GD+VK+WIT NEPN   I +Y  G +P
Sbjct  168  SPEMQKEFGYLADTCFKYFGDRVKHWITINEPNQQIILSYLKGIFP  213



>emb|CDY55219.1| BnaA01g36270D [Brassica napus]
Length=517

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG YL+DGKGL+NWDVF+H+ PG+ILDG NGD+A DQY+ + ED   +  LGVNS++
Sbjct  48   YQYEGAYLTDGKGLNNWDVFSHENPGDILDGGNGDIAVDQYNRFMEDIQSMNYLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLPKGR G+IN  GIK+Y  LID+L+  GI P VT+NH+D PQEL++RF+ WL
Sbjct  108  FSISWSRVLPKGRLGSINHLGIKHYNRLIDALIRNGITPLVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ+E+ YLAD CF H GD+VK+WIT NEPN   I +Y  G +P
Sbjct  168  SPEMQKEFGYLADTCFKHFGDRVKHWITINEPNQQIILSYLKGIFP  213



>ref|XP_002518516.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF43903.1| beta-glucosidase, putative [Ricinus communis]
Length=511

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YLSDGKGL+NWD FTH+PGNILDG+NGD++AD Y  Y ED +L+  +GVNS++F
Sbjct  47   YQFEGAYLSDGKGLNNWDNFTHEPGNILDGTNGDISADHYHRYLEDMNLMEDIGVNSYRF  106

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G+IN  GI +Y   ID+LL KGI+PFV++ H+D+PQEL DR+  WLS
Sbjct  107  SISWARVLPKGRFGHINQAGIHHYNKFIDALLRKGIQPFVSLTHFDIPQELADRYGSWLS  166

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+ E++ Y ADVCF   G++VKYW TFNEPN+  I  YR G +P
Sbjct  167  PEVLEDFKYYADVCFRSFGNRVKYWTTFNEPNVAVIRGYRSGIFP  211



>ref|XP_004234482.1| PREDICTED: beta-glucosidase 46-like [Solanum lycopersicum]
Length=517

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G+I DGSNGD+A D Y+ Y+ED  L+  +GVNS +F
Sbjct  51   YQFEGAFLSDGKGLNNWDVFTHEAGHIADGSNGDIALDHYNRYQEDIKLMEDMGVNSFRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP G +G +N+ GI++Y  LID LL KGI+PFVT+ HYD+PQEL++R+ GWLS
Sbjct  111  SISWARILPNGMYGGVNMAGIQHYNKLIDVLLQKGIQPFVTLAHYDIPQELEERYGGWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q+++ Y  D CF + GD+VKYW+T NEPN+ ++  YRFG +P
Sbjct  171  PKIQDDFCYYGDTCFKYFGDRVKYWVTINEPNVMAVRGYRFGTFP  215



>gb|KEH36817.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   231 bits (590),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG YLSDGKGLS+WDV TH+ P  I DG+NGD+A DQY  Y ED DL+ ++ VNS++
Sbjct  54   YQYEGAYLSDGKGLSDWDVVTHKTPDKIKDGTNGDIAVDQYHRYLEDIDLMEAMKVNSYR  113

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+RVLPKGR G +N  GI YY  LID+LLLKGIEPFVT++H+DLPQEL DR++GWL
Sbjct  114  FSISWARVLPKGRFGEVNSGGISYYNRLIDALLLKGIEPFVTLSHFDLPQELGDRYEGWL  173

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE QE++ YLAD+CF   GD+VKYW TFNEP+      YR G  P
Sbjct  174  SPESQEDFVYLADLCFKSFGDRVKYWATFNEPDYLITYGYRKGIAP  219



>ref|XP_009624454.1| PREDICTED: beta-glucosidase 18 [Nicotiana tomentosiformis]
Length=521

 Score =   231 bits (590),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +LSDGKGL+NWD+FTH+ G+I DGSNGDVA D Y+ Y ED  L+A +GVNS++F
Sbjct  55   YQYEGAFLSDGKGLNNWDLFTHEAGHIKDGSNGDVAVDHYNRYLEDVKLMADMGVNSYRF  114

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+PFVT+ HYD+PQEL+DR+ GWLS
Sbjct  115  SISWARILPKGIFGDVNMAGIEHYNKLIDALLQKGIQPFVTLTHYDIPQELEDRYGGWLS  174

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              +Q++++Y AD+CF + GD+VK+W+T NEPN+ +   YR G +P
Sbjct  175  SRIQDDFSYFADICFKYFGDRVKHWVTMNEPNLMADRGYRTGIYP  219



>ref|XP_009608375.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=512

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +LSDGKGLSNWDVFTH+ G++ DGSNGDVA D Y  Y ED  L+A +GVNS +F
Sbjct  48   YQYEGAFLSDGKGLSNWDVFTHEAGHVKDGSNGDVAVDHYHRYLEDIKLMADMGVNSFRF  107

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G +N+ GI++Y  LID+LL KGI+PFVT+ HYD+PQEL+DR+ GWLS
Sbjct  108  SISWARILPKGIFGEVNMAGIEHYSKLIDALLQKGIQPFVTLTHYDIPQELEDRYGGWLS  167

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +++++++Y A++CF +LGD+VKYW+T NEP+  +I+ YR G +P
Sbjct  168  SQIRDDFSYFANICFKYLGDRVKYWVTMNEPSFVAISGYRDGTYP  212



>gb|AAC28502.1| Similar to F4I1.26 putative beta-glucosidase gi|3128187 from 
A. thaliana BAC gb|AC004521. ESTs gb|N97083, gb|F19868 and gb|F15482 
come from this gene [Arabidopsis thaliana]
Length=527

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            +QYEG +L+DGKGL+NWDVF H+ PG I+DGSNGD+A DQY  Y ED   +  LGVNS++
Sbjct  59   FQYEGAFLTDGKGLNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQSMNFLGVNSYR  118

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLP GR G IN +GIKYY NLID+L+ KGI PFVT+NH+D PQEL++RF+ WL
Sbjct  119  LSISWSRVLPNGRFGVINYKGIKYYNNLIDALIKKGITPFVTLNHFDYPQELENRFKSWL  178

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EMQ+++ YLAD+CF H GD+VK+WIT NEPN      YR G +P
Sbjct  179  SSEMQKDFGYLADICFKHFGDRVKHWITINEPNQHISLAYRSGLFP  224



>ref|NP_850968.1| beta glucosidase 46 [Arabidopsis thaliana]
 sp|O80690.2|BGL46_ARATH RecName: Full=Beta-glucosidase 46; Short=AtBGLU46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE33892.1| beta glucosidase 46 [Arabidopsis thaliana]
Length=516

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            +QYEG +L+DGKGL+NWDVF H+ PG I+DGSNGD+A DQY  Y ED   +  LGVNS++
Sbjct  48   FQYEGAFLTDGKGLNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQSMNFLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLP GR G IN +GIKYY NLID+L+ KGI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  LSISWSRVLPNGRFGVINYKGIKYYNNLIDALIKKGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EMQ+++ YLAD+CF H GD+VK+WIT NEPN      YR G +P
Sbjct  168  SSEMQKDFGYLADICFKHFGDRVKHWITINEPNQHISLAYRSGLFP  213



>ref|XP_009105752.1| PREDICTED: beta-glucosidase 45-like [Brassica rapa]
Length=516

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L++GKGL+NWD+FTH+ PG I D +NGD+A DQY  +KED  L+ SLGVN ++
Sbjct  51   YQYEGAFLTEGKGLNNWDIFTHENPGKIRDENNGDMAVDQYHRFKEDIQLMTSLGVNGYR  110

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQEL++RFQ WL
Sbjct  111  FSISWSRVLPRGRFGGINYSGIKYYNRLIDALISRGIKPFVTLNHLDYPQELENRFQSWL  170

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ ++ YLAD+CF H GD+VK+W T NEPN   I T+  G +P
Sbjct  171  SPEMQNDFGYLADICFKHFGDRVKHWTTLNEPNQQIILTHLKGTFP  216



>ref|XP_010418157.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            +QYEG YL+DGKGL+NWDVF H+ P  I+DGSNGD+AADQY  Y ED   ++ LGVNS++
Sbjct  48   FQYEGAYLTDGKGLNNWDVFAHENPEKIVDGSNGDIAADQYHRYMEDVQSMSFLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLPKGR G IN +GIKYY NLI++L+ KGI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  LSISWSRVLPKGRFGGINYKGIKYYNNLINALIGKGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EM +++ YLAD+CF H GD+VK+W+T NEPN      YR G +P
Sbjct  168  SSEMVKDFGYLADICFKHFGDRVKHWMTLNEPNQQITLAYRSGLFP  213



>ref|XP_008224797.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
 ref|XP_008224798.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
Length=519

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGL+NWDVFTH+PG+I DG+NGD+A DQY LY ED DL++ +GVN+++F
Sbjct  52   YQFEGAFLNDGKGLNNWDVFTHKPGHISDGTNGDIAVDQYHLYLEDLDLMSYIGVNTYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y   I++LL +GI+PFVT+ HYD+PQEL+D +  WLS
Sbjct  112  SISWARVLPKGRFGEVNRAGIDHYNKFINTLLHRGIQPFVTLTHYDIPQELEDIYGAWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ + A++CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  172  PKVQEDFKHYANICFKFFGDRVKYWVTFNEPNVAVIHGYRSGIYP  216



>gb|KJB81912.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=300

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKGLSNWDVFTH PGNI +  NGD A D Y L+ EDA++  SLGVN+++F
Sbjct  54   YQVEGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GIK+Y  +ID+LLL+GIEPF+TI+H+DLPQEL+DR+  WLS
Sbjct  114  SISWARILPRGRFGEVNPGGIKFYNKIIDNLLLRGIEPFLTIHHFDLPQELEDRYGAWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQ+++  LA+ CF   GD+VKYW T NEPN+++  +Y  G +P
Sbjct  174  PLMQDDFLLLAETCFKSFGDRVKYWTTINEPNVFAEMSYVRGLYP  218



>emb|CDY47163.1| BnaA01g22890D [Brassica napus]
Length=516

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L++GKGL+NWD+FTH+ PG I D +NGD+A DQY  +KED  L+ SLG+N ++
Sbjct  51   YQYEGAFLTEGKGLNNWDIFTHENPGKIRDENNGDMAVDQYHRFKEDIQLMTSLGLNGYR  110

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQEL++RFQ WL
Sbjct  111  FSISWSRVLPRGRFGGINYSGIKYYNRLIDALISRGIKPFVTLNHLDYPQELENRFQSWL  170

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ ++ YLAD+CF H GD+VK+W T NEPN   I T+  G +P
Sbjct  171  SPEMQNDFGYLADICFKHFGDRVKHWTTLNEPNQQIILTHLKGTFP  216



>ref|XP_006348092.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=517

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG  LSDGKGL+NWDVFTH+ G+I DGSNGDVA D Y+ Y ED  L+  +GVNS++F
Sbjct  51   YQYEGAILSDGKGLNNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDIKLMEDMGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+PF+T+ HYD+PQEL++R+ GWLS
Sbjct  111  SISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPFITLTHYDIPQELEERYGGWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              +Q++++Y AD+CF + GD+VKYW T NEPN+ ++  YR G +P
Sbjct  171  SRIQDDFSYYADICFKYFGDRVKYWTTINEPNVMALFGYRLGTYP  215



>ref|XP_009794052.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=521

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +L+DGK L+NWD+FTH+ G+I DGSNGDVA D Y+ Y ED  L+A +GVNS++F
Sbjct  55   YQYEGAFLTDGKSLNNWDLFTHEAGHIKDGSNGDVAVDHYNRYLEDVKLMADMGVNSYRF  114

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G  G+IN+ GI++Y  LID+LL KGI+PFVT+ HYD+PQEL+DR+ GWLS
Sbjct  115  SISWARILPRGIFGDINMAGIEHYNKLIDALLQKGIQPFVTLTHYDIPQELEDRYGGWLS  174

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q++++Y AD+CF + GD+VK+W+T NEPN+ +   YR G +P
Sbjct  175  SQIQDDFSYFADICFKYFGDRVKHWVTMNEPNLMADRGYRTGIYP  219



>ref|XP_006348091.1| PREDICTED: probable inactive beta-glucosidase 14-like [Solanum 
tuberosum]
Length=517

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG  +SDGKGL+NWDVFTH+ G+I DGSNGDVA D Y+ Y ED  L+  +GVNS++F
Sbjct  51   YQYEGAIVSDGKGLNNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDIKLMEDMGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y NLID+LL KGI+PF+T+ HYD+PQEL++R+ GWLS
Sbjct  111  SISWARILPKGTFGDVNMAGIEHYNNLIDALLQKGIQPFITLTHYDIPQELEERYGGWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q++++Y AD+CF + GD+VKYW T NEPN+ ++  YR G  P
Sbjct  171  SQIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYREGTHP  215



>gb|KHG29723.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=529

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 133/170 (78%), Gaps = 5/170 (3%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGN-ILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEGGYL+DGKGL+NWDV++H+PGN I+DGSNGD+A D Y  Y ED DL+ SLGVNS++
Sbjct  57   YQYEGGYLADGKGLNNWDVYSHKPGNNIVDGSNGDIAVDYYHRYLEDIDLMHSLGVNSYR  116

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR G IN  GIK+Y N+ID LLLKGIEPF+T+ H D PQEL+DR+  WL
Sbjct  117  FSISWARILPKGRFGEINEAGIKFYNNVIDGLLLKGIEPFITLTHIDFPQELEDRYGSWL  176

Query  563  SPEMQ----EEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE Q    E++AY AD+CF   GD+VKYW+TFN+P+      Y  G +P
Sbjct  177  SPESQLTTLEDFAYYADICFKSFGDRVKYWVTFNQPDSQVKFGYLTGTFP  226



>ref|XP_006343294.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=499

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGKGL+NWDVFTH+ G+I DGSNGD+A D Y+ Y+ED  L+  +GVNS +F
Sbjct  32   YQFEGAFLSDGKGLNNWDVFTHEAGHIADGSNGDIALDHYNRYQEDIKLMEDMGVNSFRF  91

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG +G +N+ GI++Y  LID+LL K I+P VT+ HYD+PQEL++R+ GWLS
Sbjct  92   SISWARILPKGMYGGVNMAGIQHYNKLIDALLQKDIQPLVTLAHYDIPQELEERYGGWLS  151

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q+++ Y  D+CF + GD+VKYW+T NEPN+ ++  YR G +P
Sbjct  152  PKIQDDFGYYGDICFKYFGDRVKYWVTINEPNVVAVRAYRLGTFP  196



>ref|XP_008384043.1| PREDICTED: beta-glucosidase 47-like [Malus domestica]
Length=522

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK L+NWDVFTH+P  I DG+NGD+A DQY LY ED DL+  LGVNS++F
Sbjct  55   YQYEGAYLNDGKALNNWDVFTHEPDRISDGTNGDIAVDQYHLYMEDLDLMNYLGVNSYRF  114

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y   ID LLL+GI+P+VT+ HYD+PQEL+DR+  WLS
Sbjct  115  SISWARVLPKGRFGRVNRAGIAHYNKFIDELLLRGIQPYVTLTHYDIPQELEDRYGAWLS  174

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q ++ + A+ CF   GD+VKYW TFNEPN+     YR G +P
Sbjct  175  PQVQADFKHYANTCFKFFGDRVKYWATFNEPNVAVPNGYRLGTYP  219



>ref|XP_010473402.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            +QYEG YL+DGKGL+NWDVF H+ P  I+DGSNGD+AADQY  Y ED   ++ LGVNS++
Sbjct  48   FQYEGAYLTDGKGLNNWDVFVHENPEKIVDGSNGDIAADQYHRYMEDIQSMSFLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLPKGR G IN +GI+YY NLI++L+ KGI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  LSISWSRVLPKGRFGGINYKGIRYYDNLINALIRKGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EM +++ YLAD CF H GD+VK+W+T NEPN      YR G +P
Sbjct  168  SSEMVKDFGYLADTCFKHFGDRVKHWMTLNEPNQQITLAYRAGLFP  213



>ref|XP_010316602.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Solanum lycopersicum]
Length=520

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG  LSDGKGL+NWDVFTHQ G+I DGSNGDVA D Y+ Y ED  L+  +GVN ++F
Sbjct  54   YQYEGAILSDGKGLNNWDVFTHQAGHIKDGSNGDVAVDHYNRYLEDIKLMEDMGVNGYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+P +T+ HYD+PQEL++R+ GWLS
Sbjct  114  SISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPLITLTHYDIPQELEERYGGWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q++++Y AD+CF + GD+VKYW T NEPN+ ++  YR G +P
Sbjct  174  SQIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYRLGTYP  218



>ref|XP_010430205.1| PREDICTED: beta-glucosidase 46-like isoform X2 [Camelina sativa]
Length=498

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            +QYEG YL+DGKGL+NWDVF H+ P  I+DGSNGD+AADQY  Y ED   ++ LGVNS++
Sbjct  48   FQYEGAYLTDGKGLNNWDVFAHENPEKIVDGSNGDIAADQYHRYMEDIQSMSFLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLPKGR G IN +GI+YY NLI +L+ KGI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  LSISWSRVLPKGRFGGINYKGIRYYDNLIKALIGKGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EM +++ YLAD+CF H GD+VK+W+T NEPN      YR G +P
Sbjct  168  SSEMVKDFGYLADICFKHFGDRVKHWMTLNEPNQQITLAYRKGLFP  213



>ref|XP_006300409.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
 gb|EOA33307.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
Length=516

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG YL+DGKGL+NWD+F H+ P  ILDGSNGDVAADQY  Y ED + ++ LGVNS++
Sbjct  48   YQYEGAYLTDGKGLNNWDIFAHENPEKILDGSNGDVAADQYHRYMEDIESMSFLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSR+LPKGR G IN +GIKYY NLI++L+ KGI PFVT+NH+D PQ L+++F+ WL
Sbjct  108  LSISWSRILPKGRFGGINYKGIKYYNNLINALISKGITPFVTLNHFDYPQNLENQFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EM +++ YLAD+CF H GD+VK+W+T NEPN   I  Y+ G +P
Sbjct  168  SSEMGKDFGYLADICFKHFGDRVKHWMTINEPNQQIILAYQKGIFP  213



>ref|XP_009363823.1| PREDICTED: beta-glucosidase 45-like isoform X2 [Pyrus x bretschneideri]
Length=497

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGLSNWDVFTH+PG+I DG+NGD+A DQY LY ED DL+  +GVN+++F
Sbjct  31   YQFEGAFLTDGKGLSNWDVFTHKPGHISDGTNGDIADDQYHLYLEDLDLMNYIGVNTYRF  90

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLP+ R G +N  GI +Y   ID+LL +GI PFVT+ HYD+PQEL+DR+  WLS
Sbjct  91   SISWARVLPR-RFGKVNRAGINHYNKFIDALLRRGIHPFVTLTHYDIPQELEDRYGAWLS  149

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  150  PQLQEDFLYYANTCFKFFGDRVKYWVTFNEPNVVVIRGYRSGVYP  194



>gb|KJB69320.1| hypothetical protein B456_011G016100 [Gossypium raimondii]
Length=724

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGN-ILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEGGYL+DGKGL+NWDV++H+PGN I+DGSNGD+A D Y  Y ED DL+ SLGVNS++
Sbjct  477  YQYEGGYLADGKGLNNWDVYSHKPGNNIVDGSNGDIAVDYYHRYLEDIDLMHSLGVNSYR  536

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR G IN  GIK+Y NLID LLLKGIEPF+T+ H D PQEL+DR+  WL
Sbjct  537  FSISWARILPKGRFGEINEAGIKFYNNLIDGLLLKGIEPFITLTHIDFPQELEDRYGSWL  596

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE QE++ Y AD+CF   GD+V YW+TFN+P+      Y  G +P
Sbjct  597  SPESQEDFEYYADICFKSFGDRVNYWVTFNQPDSQVKFGYLTGIFP  642


 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  338  EDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINH  517
            ED DL+ SLGVNS++FSISW+R+LPKGR G IN  GIK+Y NLID LLLKGIEPFVT+ H
Sbjct  2    EDIDLMHSLGVNSYRFSISWARILPKGRFGEINEAGIKFYNNLIDGLLLKGIEPFVTLTH  61

Query  518  YDLPQELQDRFQGWLSPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFW  697
             D PQEL+DR+  WLSPE QE++AY AD+CF   GD+VKYW+TFNEP+      Y+ G +
Sbjct  62   MDFPQELEDRYGSWLSPESQEDFAYYADICFKSFGDRVKYWVTFNEPSFQVKFGYQAGTF  121

Query  698  P  700
            P
Sbjct  122  P  122



>ref|XP_008669175.1| PREDICTED: probable inactive beta-glucosidase 14 [Zea mays]
Length=517

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL D KGLSNWDVF+H PGNI DGSNGDVAAD Y  YK+D +++ S+G++S++F
Sbjct  46   YQVEGAYLDDSKGLSNWDVFSHVPGNIDDGSNGDVAADHYHRYKDDIEMMHSIGLSSYRF  105

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SWSR+LPKGR G +N  G+K+Y +LI+ LL KGI+PFVTINHYD+P+ELQ+R+  WL+
Sbjct  106  SLSWSRILPKGRFGGVNQAGVKFYNSLINGLLEKGIQPFVTINHYDIPEELQERYNSWLN  165

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y  ++CF   GD+VK+W+TFNEPN+     Y  G +P
Sbjct  166  PEIQEDFTYFVELCFKMFGDRVKHWVTFNEPNLIVKLAYSIGAFP  210



>ref|XP_003529622.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03066.1| Beta-glucosidase 46 [Glycine soja]
Length=524

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGN--ILDGSNGDVAADQYDLYKEDADLLASLGVNSH  379
            YQYEG Y SDGKGLSNWD +TH PG   I+DGSNGD+A D Y  Y ED DL+ +LGVNS+
Sbjct  43   YQYEGAYKSDGKGLSNWDNYTHGPGRSVIMDGSNGDIAIDHYHRYLEDIDLMETLGVNSY  102

Query  380  KFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGW  559
            + S+SW+R+LPKGR G  N  GI++Y  LID LLLKGI+PFVT++HYD+PQEL+DR+  W
Sbjct  103  RLSLSWARILPKGRFGEPNHAGIEFYNRLIDVLLLKGIQPFVTLSHYDIPQELEDRYGSW  162

Query  560  LSPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            LSP++QE++A+ AD+CF   GD+VKYW+TFNEPN      YR G +P
Sbjct  163  LSPQLQEDFAFYADLCFKTFGDRVKYWVTFNEPNFLVSLGYRSGLYP  209



>ref|XP_010430204.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Camelina sativa]
Length=518

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            +QYEG YL+DGKGL+NWDVF H+ P  I+DGSNGD+AADQY  Y ED   ++ LGVNS++
Sbjct  48   FQYEGAYLTDGKGLNNWDVFAHENPEKIVDGSNGDIAADQYHRYMEDIQSMSFLGVNSYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLPKGR G IN +GI+YY NLI +L+ KGI PFVT+NH+D PQEL++RF+ WL
Sbjct  108  LSISWSRVLPKGRFGGINYKGIRYYDNLIKALIGKGITPFVTLNHFDYPQELENRFKSWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EM +++ YLAD+CF H GD+VK+W+T NEPN      YR G +P
Sbjct  168  SSEMVKDFGYLADICFKHFGDRVKHWMTLNEPNQQITLAYRKGLFP  213



>gb|AES92596.2| glucose 6-phosphate/phosphate translocator 1 [Medicago truncatula]
Length=1029

 Score =   233 bits (595),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YLSDGKGLSNWDVFTH+PG+  DGSNGDV  DQY  Y ED DL+ ++ VNS++F
Sbjct  534  YQYEGAYLSDGKGLSNWDVFTHKPGSTHDGSNGDVTVDQYHRYLEDVDLMEAIKVNSYRF  593

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +NL GI YY  LI +LLL+GI+PFVT+ H D PQEL+DR+ GWLS
Sbjct  594  SISWARILPKGRFGEVNLAGIDYYNRLIHALLLRGIQPFVTLFHLDFPQELEDRYGGWLS  653

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++   AD+CF   GD+VKYW TFNEPN+     YR G  P
Sbjct  654  PQSQEDFVLFADICFKSFGDRVKYWTTFNEPNLQVSLGYRKGKHP  698



>gb|KJB81913.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=411

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKGLSNWDVFTH PGNI +  NGD A D Y L+ EDA++  SLGVN+++F
Sbjct  54   YQVEGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GIK+Y  +ID+LLL+GIEPF+TI+H+DLPQEL+DR+  WLS
Sbjct  114  SISWARILPRGRFGEVNPGGIKFYNKIIDNLLLRGIEPFLTIHHFDLPQELEDRYGAWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQ+++  LA+ CF   GD+VKYW T NEPN+++  +Y  G +P
Sbjct  174  PLMQDDFLLLAETCFKSFGDRVKYWTTINEPNVFAEMSYVRGLYP  218



>ref|XP_010316605.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
 ref|XP_010316606.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
Length=520

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +LSDGK L+NWD+FTH+ G+I DGSNGDVA D Y+ Y ED  L+  +GVNS++F
Sbjct  54   YQFEGAFLSDGKSLNNWDIFTHEAGHIEDGSNGDVAVDHYNRYLEDIKLMEDMGVNSYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y  LID+LL KGIEPF+T+ HYD+PQEL++R+ GWLS
Sbjct  114  SISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIEPFITLTHYDVPQELEERYGGWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              +Q++++Y AD+CF + GD+VKYW T NEPN+ ++  YR G +P
Sbjct  174  SRIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYREGTYP  218



>gb|KFK40643.1| hypothetical protein AALP_AA2G023200 [Arabis alpina]
Length=454

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG Y++DGKGL+NWDVFTH  P  ILD S+GD+A DQY LY ED   + +LGVNS++
Sbjct  22   YQYEGAYVTDGKGLNNWDVFTHVNPEKILDESHGDIAVDQYHLYMEDIQSMINLGVNSYR  81

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSR+LPKGR G IN  GIK+Y +LID+L+  GI PFVT+NH+D PQEL++RF  WL
Sbjct  82   LSISWSRILPKGRIGGINYLGIKHYNSLIDALIKNGITPFVTLNHFDYPQELENRFNSWL  141

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ E+ YLAD+CF H GD+V +WIT NEPN   I +Y  G +P
Sbjct  142  SPEMQTEFGYLADICFKHFGDRVTHWITINEPNQQIIGSYIKGTFP  187



>emb|CDY25326.1| BnaC01g29950D [Brassica napus]
Length=691

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L++GKGL+NWD+FTH+ PG I D +NGD+A DQY  +KED  L+ SLG+N ++
Sbjct  51   YQYEGAFLTEGKGLNNWDIFTHENPGKIRDENNGDMAVDQYHRFKEDIQLMTSLGLNGYR  110

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQEL++RFQ WL
Sbjct  111  FSISWSRVLPRGRFGGINYSGIKYYNRLIDALISRGIKPFVTLNHLDYPQELENRFQSWL  170

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ ++ YLAD+CF H GD+VK+W T NEPN   I T+  G +P
Sbjct  171  SPEMQNDFGYLADICFKHFGDRVKHWTTLNEPNQQIILTHLKGTFP  216


 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +2

Query  413  KGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSPEMQEEYAY  592
            +GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQEL++RFQ WLSPEMQ ++ Y
Sbjct  296  RGRFGGINYSGIKYYNRLIDALISRGIKPFVTLNHLDYPQELENRFQSWLSPEMQNDFGY  355

Query  593  LADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            LAD+CF H GD+VK+W T NEPN   I T+  G +P
Sbjct  356  LADICFKHFGDRVKHWTTLNEPNQQIILTHLKGTFP  391



>ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula]
Length=1051

 Score =   233 bits (595),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YLSDGKGLSNWDVFTH+PG+  DGSNGDV  DQY  Y ED DL+ ++ VNS++F
Sbjct  556  YQYEGAYLSDGKGLSNWDVFTHKPGSTHDGSNGDVTVDQYHRYLEDVDLMEAIKVNSYRF  615

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +NL GI YY  LI +LLL+GI+PFVT+ H D PQEL+DR+ GWLS
Sbjct  616  SISWARILPKGRFGEVNLAGIDYYNRLIHALLLRGIQPFVTLFHLDFPQELEDRYGGWLS  675

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+ QE++   AD+CF   GD+VKYW TFNEPN+     YR G  P
Sbjct  676  PQSQEDFVLFADICFKSFGDRVKYWTTFNEPNLQVSLGYRKGKHP  720



>gb|KJB81914.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=442

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKGLSNWDVFTH PGNI +  NGD A D Y L+ EDA++  SLGVN+++F
Sbjct  54   YQVEGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GIK+Y  +ID+LLL+GIEPF+TI+H+DLPQEL+DR+  WLS
Sbjct  114  SISWARILPRGRFGEVNPGGIKFYNKIIDNLLLRGIEPFLTIHHFDLPQELEDRYGAWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQ+++  LA+ CF   GD+VKYW T NEPN+++  +Y  G +P
Sbjct  174  PLMQDDFLLLAETCFKSFGDRVKYWTTINEPNVFAEMSYVRGLYP  218



>gb|KHG07627.1| Beta-glucosidase 18 [Gossypium arboreum]
Length=277

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  215  EGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSIS  394
            EGGYL DGKGLSNWDVFTH PGNI +  NGD A D Y L+  DA++  SLGVN+++FSIS
Sbjct  25   EGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLVDAEIAQSLGVNAYRFSIS  84

Query  395  WSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSPEM  574
            W+R+LP+GR G +N  GIK+Y  +ID+LLL+GIEPF+TI+H+DLPQEL+DR+  WLSP M
Sbjct  85   WARILPRGRFGEVNPGGIKFYNKIIDNLLLRGIEPFLTIHHFDLPQELEDRYGAWLSPLM  144

Query  575  QEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            Q+++  LA+ CF   GD+VKYW T NEPNM++  +Y  G +P
Sbjct  145  QDDFLLLAETCFKSFGDRVKYWTTINEPNMFAEMSYVRGLYP  186



>ref|XP_010316604.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=516

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG  LSDGKGL+NWDVFTH+ G+I DGSNGDVA D Y+ Y ED  L+  LGVN ++F
Sbjct  50   YQYEGAILSDGKGLNNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDVKLMEDLGVNGYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+P +T+ HYD+PQEL++R+ GWLS
Sbjct  110  SISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPLITLTHYDIPQELEERYGGWLS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              +Q++++Y AD+CF + GD+VKYW T NEPN+ ++  YR G +P
Sbjct  170  SRIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYREGTYP  214



>ref|XP_009397666.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=502

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL D K LSNWDVFTH PG+I DGSNGD+A D Y  Y ED +L+ SLGVNS++F
Sbjct  40   YQIEGAYLEDNKSLSNWDVFTHIPGHIKDGSNGDIADDHYHRYMEDIELMHSLGVNSYRF  99

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G IN +G+ +Y  LID+LLLKGI+PFVT+NHYD+PQEL+DR+  WLS
Sbjct  100  SISWSRILPRGRFGGINPQGVAFYNKLIDALLLKGIQPFVTLNHYDIPQELEDRYGAWLS  159

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q+++ Y A+VCF   GD+VKYW TFNEPN+     Y  G +P
Sbjct  160  AQIQKDFGYFAEVCFEEFGDRVKYWTTFNEPNVMVKFGYGNGKYP  204



>ref|XP_009382650.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG Y    K LSNWDVFTH Q G I DGSNGDVAAD Y +Y ED +L+ SLG+NS++
Sbjct  47   YQIEGAYQEGNKSLSNWDVFTHSQGGKIKDGSNGDVAADHYHIYMEDIELMHSLGINSYR  106

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR+G IN  GI +Y NLIDSLLL+GIEPFVT++HYD+PQEL+DR+  WL
Sbjct  107  FSISWSRVLPRGRYGKINPTGIAFYNNLIDSLLLRGIEPFVTLSHYDIPQELEDRYGAWL  166

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SP++Q+++ Y A+VCF+  GD+VKYW TFNEP M     Y  G +P
Sbjct  167  SPKIQKDFGYFAEVCFSKFGDRVKYWSTFNEPRMMVRYGYGTGEYP  212



>ref|XP_008669176.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Zea 
mays]
Length=510

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL D KGLSNWDVFTH  GNI DGSNGD+A D Y  YK+D +++ S+G+ S+KF
Sbjct  38   YQIEGAYLEDNKGLSNWDVFTHIKGNIDDGSNGDMATDHYHRYKDDIEMMHSIGLTSYKF  97

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SWSR+LPKGR G IN  GIK+Y NLI+ LL KGI+P VTINHYD+P+ELQ+R+  WL+
Sbjct  98   SLSWSRILPKGRFGGINQAGIKFYNNLINGLLEKGIQPLVTINHYDIPEELQERYNSWLN  157

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y A++CF   GD+VK+W+TFNEPN+ +   Y  G +P
Sbjct  158  PEIQEDFTYFAELCFKMFGDRVKHWVTFNEPNLLAKLEYFIGGFP  202



>ref|XP_006391958.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
 gb|ESQ29244.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
Length=518

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L++GKGL+NWD+FTH+ PG I D +NGD+A DQY  + ED  L+ SLGVNS++
Sbjct  53   YQYEGAFLAEGKGLNNWDIFTHENPGKIRDENNGDMAVDQYHRFMEDIQLMTSLGVNSYR  112

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQE ++RFQ WL
Sbjct  113  FSISWSRVLPRGRFGGINYSGIKYYDRLIDALISRGIKPFVTLNHLDYPQEFENRFQSWL  172

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EMQ+++ YLAD+CF H GD+VK+W TFNEPN   I ++  G +P
Sbjct  173  SREMQDDFGYLADLCFKHFGDRVKHWTTFNEPNQQIILSHLKGTFP  218



>ref|XP_010418158.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L++GKGL+NWD+FTH+ PG I D +NGD+A DQY  + ED  L+ SLGVNS++
Sbjct  53   YQYEGAFLAEGKGLNNWDIFTHEYPGKIRDANNGDMAVDQYHRFMEDIQLMTSLGVNSYR  112

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G+IN  GI YY  LID+L+ +GI+PFVT+NH D PQEL++RFQ WL
Sbjct  113  FSISWSRVLPRGRFGSINYSGITYYNRLIDALISRGIKPFVTLNHLDYPQELENRFQSWL  172

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ+++ YLA++CF H GD+VK W T NEPN   I ++  G +P
Sbjct  173  SPEMQKDFLYLANICFKHFGDRVKLWTTLNEPNNQIILSHLRGTFP  218



>ref|XP_009413739.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=508

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PG I DG  GD+A D Y  Y ED  L+ SLGVNS++F
Sbjct  41   YQIEGAYLEGNKSLSNWDVFTHLPGKIKDGRTGDIADDHYHRYMEDISLMHSLGVNSYRF  100

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SWSR+LP+GR G++N  GIK+Y  +IDSLL+KGI+PFVT+NH+D+PQEL+DR+  WLS
Sbjct  101  SMSWSRILPRGRFGDVNPVGIKFYNRIIDSLLIKGIQPFVTLNHFDVPQELEDRYGSWLS  160

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ +LA+VCF   GD+VK+W TFNEPN++   +Y FG +P
Sbjct  161  PQIREDFGHLAEVCFKEFGDRVKFWTTFNEPNLFVKFSYAFGKYP  205



>gb|KFK40644.1| hypothetical protein AALP_AA2G023300 [Arabis alpina]
Length=518

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG YL+DGKGL+NWDVFTH+ PG I DG NGD+AADQY  + ED   +  LG+NS++
Sbjct  50   YQYEGAYLTDGKGLNNWDVFTHENPGKIGDGKNGDIAADQYHRFMEDIKSMTYLGLNSYR  109

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLPKGR G +N  GIK+Y +LID+L+  GI+PFVT+NH+D PQ  +D+FQ WL
Sbjct  110  LSISWSRVLPKGRFGGVNYLGIKHYNSLIDALIKNGIKPFVTLNHFDYPQVFEDKFQSWL  169

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPE+Q E+ YLAD+CF H GD+VK+W+T NEPN   I +Y  G +P
Sbjct  170  SPEIQIEFGYLADICFKHFGDRVKHWMTINEPNQQIILSYTKGIFP  215



>ref|XP_008384040.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Malus domestica]
Length=497

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG YL+DGK LSNWDVFTH+PG+I DG+NGD+A DQY LY ED DL+  +GVN+++F
Sbjct  31   YQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLMNYIGVNTYRF  90

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLP+ R G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQEL+DR+  WLS
Sbjct  91   SISWARVLPR-RFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQELEDRYGAWLS  149

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q+++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  150  SQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYP  194



>ref|XP_012071274.1| PREDICTED: beta-glucosidase 18-like [Jatropha curcas]
Length=514

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG +L   KGLSNWDVF+H  G I DGSNGD+A D Y+LYKED +L+ SLGVNS++F
Sbjct  44   YQIEGAFLEGNKGLSNWDVFSHIQGKIKDGSNGDMADDHYNLYKEDIELMHSLGVNSYRF  103

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLPKGR G +NLEGIK+Y  LI++LLLKGI+PFVT+NH+D+PQELQDR+  WL+
Sbjct  104  SISWSRVLPKGRFGKVNLEGIKFYNKLINALLLKGIQPFVTLNHFDIPQELQDRYGSWLN  163

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++QE++ Y A++CF   GD+VKYW T NEPN+ +   Y  G  P
Sbjct  164  SQIQEDFGYFAELCFKAFGDRVKYWATLNEPNVVAQFGYYSGKHP  208



>ref|XP_002448169.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
 gb|EES12497.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
Length=510

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y  D KGLSNWDVFTH  G I+DGSNGDVAAD Y  YKED +++ S+G++S++F
Sbjct  39   YQIEGAYREDNKGLSNWDVFTHIQGKIVDGSNGDVAADHYHRYKEDIEMMHSVGLDSYRF  98

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SWSR+LPKGR G++N  G+K+Y +LI+ +L KGIEPFVTINHYD+P+ELQ R+  WLS
Sbjct  99   SLSWSRILPKGRFGDVNPAGVKFYNSLINGMLQKGIEPFVTINHYDIPEELQQRYGSWLS  158

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y A++CF   GD+VK+W TFNEPN+ +   Y  G +P
Sbjct  159  PEIQEDFTYFAEICFKMFGDRVKHWATFNEPNLMAKLAYFNGKFP  203



>ref|XP_010665547.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 46-like [Beta 
vulgaris subsp. vulgaris]
Length=573

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEG-GYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG  YL DGKGL+NWD FTH+ G I D SNGDVA D Y  Y ED +L+  L +NS++
Sbjct  94   YQYEGRAYLVDGKGLNNWDTFTHKSGMIADKSNGDVATDHYHRYLEDVELMEDLQLNSYR  153

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LPKGR+GNINL GIK+Y  LID+LL KGI+PFVT++H+D+PQEL+DR+ G L
Sbjct  154  FSISWARILPKGRYGNINLAGIKFYIKLIDTLLAKGIQPFVTLSHFDIPQELEDRYGGLL  213

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S E+QE++AY ADVCF +LGD+VKYW TFNEPN+     YR G +P
Sbjct  214  SHEIQEDFAYYADVCFKYLGDRVKYWATFNEPNVNIHQGYRTGLYP  259



>ref|XP_008669177.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Zea 
mays]
 tpg|DAA36953.1| TPA: hypothetical protein ZEAMMB73_881817 [Zea mays]
Length=509

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL D KGLSNWDVFTH  GNI DGSNGD+A D Y  YK+D +++ S+G+ S+KF
Sbjct  38   YQIEGAYLEDNKGLSNWDVFTHIKGNIDDGSNGDMATDHYHRYKDDIEMMHSIGLTSYKF  97

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SWSR+LPKGR G IN  GIK+Y NLI+ LL KGI+P VTINHYD+P+ELQ+R+  WL+
Sbjct  98   SLSWSRILPKGRFGGINQAGIKFYNNLINGLLEKGIQPLVTINHYDIPEELQERYNSWLN  157

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+QE++ Y A++CF   GD+VK+W+TFNEPN+ +   Y  G +P
Sbjct  158  PEIQEDFTYFAELCFKMFGDRVKHWVTFNEPNLLAKLEYFIGGFP  202



>ref|NP_001185287.1| beta-glucosidase 45 [Arabidopsis thaliana]
 gb|AEE33891.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=543

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L+DGK L+NWDVFTH+ PG ILD +N D A DQY+ + ED  L++ LGVNS++
Sbjct  51   YQYEGAFLTDGKSLNNWDVFTHKNPGKILDKNNADRAVDQYNRFLEDIQLMSFLGVNSYR  110

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW R+LP+GR G IN  GIKYY   ID+L+ +GI+PFVT+NH D PQEL+DRFQ WL
Sbjct  111  FSISWCRILPRGRFGEINYLGIKYYNIFIDALISRGIKPFVTLNHVDYPQELEDRFQSWL  170

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            +PEMQ+E+ YLAD+CF H G++VKYW T NEPN   I  Y  G +P
Sbjct  171  NPEMQKEFGYLADICFKHFGNRVKYWTTLNEPNQQLILGYLTGKFP  216



>ref|NP_176374.1| beta-glucosidase 45 [Arabidopsis thaliana]
 sp|O80689.1|BGL45_ARATH RecName: Full=Beta-glucosidase 45; Short=AtBGLU45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC28501.1| Similar to beta-glucosidase BGQ60 precursor gb|L41869 from Hordeum 
vulgare [Arabidopsis thaliana]
 gb|AEE33890.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=520

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L+DGK L+NWDVFTH+ PG ILD +N D A DQY+ + ED  L++ LGVNS++
Sbjct  51   YQYEGAFLTDGKSLNNWDVFTHKNPGKILDKNNADRAVDQYNRFLEDIQLMSFLGVNSYR  110

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW R+LP+GR G IN  GIKYY   ID+L+ +GI+PFVT+NH D PQEL+DRFQ WL
Sbjct  111  FSISWCRILPRGRFGEINYLGIKYYNIFIDALISRGIKPFVTLNHVDYPQELEDRFQSWL  170

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            +PEMQ+E+ YLAD+CF H G++VKYW T NEPN   I  Y  G +P
Sbjct  171  NPEMQKEFGYLADICFKHFGNRVKYWTTLNEPNQQLILGYLTGKFP  216



>ref|XP_004976205.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Setaria italica]
Length=508

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PG I DGS GD+A D Y  Y ED +L+ SLGVN+++F
Sbjct  46   YQIEGAYLEGNKSLSNWDVFTHAPGRIKDGSAGDIADDHYHRYDEDVELMNSLGVNAYRF  105

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLP+GR G +N  GI++Y  LIDSLLLKGIEPFVT+NHYD+PQEL+DR+  WLS
Sbjct  106  SISWARVLPEGRFGRVNPLGIEFYNKLIDSLLLKGIEPFVTLNHYDIPQELEDRYGAWLS  165

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++ + ADVCF   GD+VKYW TFNEPN+  +  Y  G +P
Sbjct  166  AEIQRDFGHFADVCFAAFGDRVKYWTTFNEPNVAVLTGYMLGTYP  210



>ref|XP_006348093.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=518

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG  LSDGKGLSNWDVFTH+ G+I DGSNGDVA D Y+ Y ED  L+  +GVN ++F
Sbjct  52   YQYEGAILSDGKGLSNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDIKLMEDMGVNGYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+P +T+ HYD+PQEL++R+ GWLS
Sbjct  112  SISWARILPKGTFGDVNMAGIEHYSKLIDALLQKGIQPLITLTHYDIPQELEERYGGWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              +Q++++Y AD+CF + GD+VKYW T NEPN+ +   YR G +P
Sbjct  172  SRIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAGRGYREGTYP  216



>gb|KJB81911.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=546

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKGLSNWDVFTH PGNI +  NGD A D Y L+ EDA++  SLGVN+++F
Sbjct  54   YQVEGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GIK+Y  +ID+LLL+GIEPF+TI+H+DLPQEL+DR+  WLS
Sbjct  114  SISWARILPRGRFGEVNPGGIKFYNKIIDNLLLRGIEPFLTIHHFDLPQELEDRYGAWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQ+++  LA+ CF   GD+VKYW T NEPN+++  +Y  G +P
Sbjct  174  PLMQDDFLLLAETCFKSFGDRVKYWTTINEPNVFAEMSYVRGLYP  218



>ref|XP_010273571.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=513

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PG I DGSNGDVA D Y  Y +D +L+  LGVNS++F
Sbjct  39   YQIEGAYLEGNKSLSNWDVFTHIPGKIKDGSNGDVADDHYHRYMQDIELMHQLGVNSYRF  98

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR G +N EGI++Y  LI++LLLKGI+PFVT+NHYD+PQEL+DR+  WL+
Sbjct  99   SISWSRVLPRGRFGEVNSEGIEFYDKLINALLLKGIQPFVTLNHYDIPQELEDRYGAWLN  158

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q+++ Y A+VCF   GD+VKYW TFNEPN+     Y FG +P
Sbjct  159  AQIQQDFGYFAEVCFKAFGDRVKYWSTFNEPNIMVTYGYLFGKYP  203



>ref|XP_002448173.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
 gb|EES12501.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
Length=515

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL   KGLSNWD+FTH+ G + DG+NGD A D Y  Y ED +L+ SLGVNS++F
Sbjct  42   YQIEGGYLEGNKGLSNWDIFTHKQGTVEDGTNGDTADDHYHRYMEDIELIHSLGVNSYRF  101

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+W+R+LPKGR G++N +G+ +Y  LID+LL +GIEPFVTI+HYD+P EL+ R+ GWLS
Sbjct  102  SIAWARILPKGRFGHVNPDGVAFYNALIDALLQRGIEPFVTISHYDIPYELEKRYGGWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++ ++ YLADVCF   GD+VK+WITFNEPN+++  +Y +G +P
Sbjct  162  PKIRRDFGYLADVCFRMFGDRVKFWITFNEPNIFAKLSYIYGRYP  206



>sp|Q7XSK0.2|BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54546.1| OSJNBa0004N05.26 [Oryza sativa Japonica Group]
 emb|CAE01910.2| OSJNBb0070J16.3 [Oryza sativa Japonica Group]
 emb|CAH67620.1| OSIGBa0140J09.1 [Oryza sativa Indica Group]
Length=505

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PGNI DGSNGD+A D Y  Y+ED +L+ SLGVN+++F
Sbjct  45   YQIEGAYLEGNKSLSNWDVFTHLPGNIKDGSNGDIADDHYHRYEEDVELMNSLGVNAYRF  104

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LPKGR G +N  GI +Y  LIDS+LLKGI+PFVT+ HYD+PQEL+DR+  WL+
Sbjct  105  SISWSRILPKGRFGGVNPAGIDFYNKLIDSILLKGIQPFVTLTHYDIPQELEDRYGAWLN  164

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++ + ADVCF   GD+VKYW TFNEPN+     Y  G +P
Sbjct  165  AEIQSDFGHFADVCFGAFGDRVKYWTTFNEPNVAVRHGYMLGTYP  209



>ref|XP_006302139.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
 gb|EOA35037.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
Length=522

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG + +DGK L+NWDVFTH+ PG ILD +NGD+A DQY  + ED   +  LGVNS++
Sbjct  55   YQYEGAFSTDGKSLNNWDVFTHENPGKILDENNGDIAVDQYHRFMEDIQSMNFLGVNSYR  114

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH+D P EL++RFQ WL
Sbjct  115  FSISWSRVLPRGRFGEINYSGIKYYNILIDALISRGIKPFVTLNHFDYPHELENRFQSWL  174

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             PEMQ E+ YLAD+CF H G++VKYW T NEPN   I  Y  G +P
Sbjct  175  EPEMQIEFGYLADLCFKHFGNRVKYWTTLNEPNQQVILGYVTGLFP  220



>ref|XP_004976202.1| PREDICTED: probable inactive beta-glucosidase 14-like [Setaria 
italica]
Length=521

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L   +GLSNWDVF H PG I DGSNGD A D Y  Y ED +L+ S+GVNS++F
Sbjct  44   YQIEGANLEGNRGLSNWDVFAHTPGKIEDGSNGDTADDHYHRYMEDIELMHSMGVNSYRF  103

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+W+R+LP+GR G++N +G+ +Y NLID+LL KGI+PFVTI+HYD+PQEL+ ++ GWLS
Sbjct  104  SIAWTRILPRGRFGHVNPDGVAFYNNLIDALLQKGIQPFVTISHYDIPQELETQYGGWLS  163

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+Q+++ YLA+VCF   GD+VK+WITFN+PN+W   +Y  G +P
Sbjct  164  PEIQKDFGYLAEVCFMMFGDRVKFWITFNQPNLWLKFSYMDGLYP  208



>gb|KFK40642.1| hypothetical protein AALP_AA2G023000 [Arabis alpina]
Length=516

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ+EG YL+DGKGL+NWDVFTH+ PG ILDGSNGD+A+DQY  + ED   +  LGVNS++
Sbjct  22   YQHEGAYLTDGKGLNNWDVFTHENPGKILDGSNGDIASDQYHRFMEDIQSMIHLGVNSYR  81

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSR+LPKGR G  N  GIK+Y +LID+L+  GI+P VT+NH+D PQ  +D+F+ WL
Sbjct  82   LSISWSRILPKGRFGGTNYLGIKHYNSLIDALIKNGIKPLVTLNHFDYPQVFEDKFKSWL  141

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SP MQ E+ YLAD+CF H GD+VK+WIT NEPN   + +Y  G +P
Sbjct  142  SPAMQLEFGYLADICFKHFGDRVKHWITLNEPNQQILLSYIKGLFP  187



>ref|XP_010473401.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45 [Camelina 
sativa]
Length=552

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG + +DGK L+NWDVFTH+ PG I D  NGD+A DQY  + ED  L+  LGVNS++
Sbjct  52   YQYEGAFSTDGKSLNNWDVFTHENPGKIHDEINGDIAVDQYHRFMEDIQLMTFLGVNSYR  111

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+G+ G IN  GIKYY  LIDSL+ +GI+PFVT+NH D PQEL++RFQ WL
Sbjct  112  FSISWSRVLPRGKVGGINYSGIKYYNILIDSLISRGIKPFVTLNHMDYPQELENRFQSWL  171

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            +P+MQ E+ YLAD+CF H G++VKYW T NEPN   I  Y  G +P
Sbjct  172  NPKMQNEFGYLADICFKHFGNRVKYWTTLNEPNQQVILGYITGRFP  217



>gb|ABC55715.1| beta-mannosidase 4 [Oncidium hybrid cultivar]
Length=498

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL   KGLSNWDVF+H PG I DGSNGD+A D Y  YK D DL+ SL VNS++F
Sbjct  39   YQIEGGYLDGNKGLSNWDVFSHIPGKIEDGSNGDIADDHYHRYKSDIDLMHSLEVNSYRF  98

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N +GI +Y  LID LLLKGI+PFVT+ HYD+PQEL+DR+  WL+
Sbjct  99   SISWSRILPRGRFGEVNSKGISFYNELIDYLLLKGIQPFVTLCHYDIPQELEDRYGAWLN  158

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++QE++ Y AD+CF   G+KVKYW TFNEP +     YR G +P
Sbjct  159  SQIQEDFGYYADICFKEFGEKVKYWSTFNEPAVLVNKGYRLGIYP  203



>ref|XP_010430203.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L++GKGL+NWD+FTH+ PG I D +NGD+A DQY  + ED  L+ SLGVNS++
Sbjct  53   YQYEGAFLTEGKGLNNWDIFTHEYPGKIRDENNGDMAVDQYHRFMEDIQLMTSLGVNSYR  112

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G+IN  GI YY  LID+L+ +GI+PFVT+NH D PQEL+ RFQ WL
Sbjct  113  FSISWSRVLPRGRFGSINYSGITYYNRLIDALISRGIKPFVTLNHLDYPQELEYRFQSWL  172

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ+++ YL ++CF H GD+VK W T NEPN   I ++  G +P
Sbjct  173  SPEMQKDFLYLTNICFKHFGDRVKLWTTLNEPNNQIILSHLKGTFP  218



>gb|KJB81916.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=514

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  215  EGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSIS  394
            EGGYL DGKGLSNWDVFTH PGNI +  NGD A D Y L+ EDA++  SLGVN+++FSIS
Sbjct  25   EGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRFSIS  84

Query  395  WSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSPEM  574
            W+R+LP+GR G +N  GIK+Y  +ID+LLL+GIEPF+TI+H+DLPQEL+DR+  WLSP M
Sbjct  85   WARILPRGRFGEVNPGGIKFYNKIIDNLLLRGIEPFLTIHHFDLPQELEDRYGAWLSPLM  144

Query  575  QEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            Q+++  LA+ CF   GD+VKYW T NEPN+++  +Y  G +P
Sbjct  145  QDDFLLLAETCFKSFGDRVKYWTTINEPNVFAEMSYVRGLYP  186



>gb|KFK40645.1| hypothetical protein AALP_AA2G023400 [Arabis alpina]
Length=523

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 127/166 (77%), Gaps = 3/166 (2%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG +L+DGK L+NWDVFTH+  G I DGSNGD + DQY  + ED  L+  LGVNS++
Sbjct  51   YQYEGAFLTDGKSLNNWDVFTHEHSGEIHDGSNGDTSVDQYHRFMEDIQLMNFLGVNSYR  110

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSRVLP+GR G IN  GIKYY  LID+L+   I+PFVT+NH D PQEL+ RFQ WL
Sbjct  111  FSISWSRVLPRGRFGGINYSGIKYYNILIDTLIR--IKPFVTLNHVDYPQELEMRFQSWL  168

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SPEMQ+E+ +LAD+CF H GD+VKYW T NEPN   I +Y +G +P
Sbjct  169  SPEMQKEFTHLADICFKHFGDRVKYWTTINEPNQQLILSYLWGIFP  214



>ref|XP_007021332.1| Beta-glucosidase 45, putative [Theobroma cacao]
 gb|EOY12857.1| Beta-glucosidase 45, putative [Theobroma cacao]
Length=617

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKGLSNWD F+H PGNI +  NGDVA D Y L+ ED ++  SLGVNS++F
Sbjct  58   YQVEGGYLDDGKGLSNWDAFSHVPGNIKNNENGDVADDDYHLFLEDIEMARSLGVNSYRF  117

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GIK+Y N+ID+LL++GIEPFVTI H+D PQEL+DR+  WLS
Sbjct  118  SISWARILPRGRFGEVNPSGIKFYNNIIDNLLIRGIEPFVTIFHHDHPQELEDRYGSWLS  177

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQE++  LA+ CF + GD+VKYW+T NE N+++   Y  G +P
Sbjct  178  PLMQEDFVLLAETCFKNFGDRVKYWVTINEANLFADMAYIRGLYP  222



>ref|XP_002448174.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
 gb|EES12502.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
Length=522

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL   KGLSNWD+FTH  G + DG+NGD A D Y  Y ED +L+ S+GVNS++F
Sbjct  43   YQIEGGYLEGNKGLSNWDIFTHTQGKVEDGTNGDTADDHYHHYMEDIELMHSMGVNSYRF  102

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+W+R+LPKGR G++N +G+  Y  LID+LL +GIEPFVTI+H+D+P EL++R+ GWLS
Sbjct  103  SIAWARILPKGRFGHVNPDGVALYNALIDALLQRGIEPFVTISHFDIPYELEERYGGWLS  162

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++ ++ YLADVCF   GD+VK+WITFNEPNM++   Y +G +P
Sbjct  163  PKIRRDFGYLADVCFRMFGDRVKFWITFNEPNMFTKLGYIYGRFP  207



>ref|XP_009630283.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=539

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DG+ LSNWDVF+H  G+I +G NGDVA D Y  Y ED D++ASLGVN+++F
Sbjct  57   YQIEGAYIEDGRSLSNWDVFSHTNGSITNGGNGDVADDHYHSYLEDIDIMASLGVNAYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+G+ G +N  GIK+Y N+ID+LLLKG+ PFVTI+H D PQEL+DR+  WLS
Sbjct  117  SISWSRVLPRGKLGAVNPAGIKFYNNIIDNLLLKGVAPFVTIHHNDFPQELEDRYGAWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF   GD+VKYW T NEPN+++   Y  G +P
Sbjct  177  PLMQEEFVHFAETCFKGFGDRVKYWATINEPNLFAELAYMNGVFP  221



>ref|XP_004976204.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Setaria italica]
Length=510

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQP--GNILDGSNGDVAADQYDLYKEDADLLASLGVNSH  379
            YQ EG YL   K LSNWDVFTH P  G I DGS GD+A D Y  Y ED +L+ SLGVN++
Sbjct  46   YQIEGAYLEGNKSLSNWDVFTHAPVSGRIKDGSAGDIADDHYHRYDEDVELMNSLGVNAY  105

Query  380  KFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGW  559
            +FSISW+RVLP+GR G +N  GI++Y  LIDSLLLKGIEPFVT+NHYD+PQEL+DR+  W
Sbjct  106  RFSISWARVLPEGRFGRVNPLGIEFYNKLIDSLLLKGIEPFVTLNHYDIPQELEDRYGAW  165

Query  560  LSPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            LS E+Q ++ + ADVCF   GD+VKYW TFNEPN+  +  Y  G +P
Sbjct  166  LSAEIQRDFGHFADVCFAAFGDRVKYWTTFNEPNVAVLTGYMLGTYP  212



>ref|XP_009772387.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=538

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DG+ LSNWDVF+H  G+I +G NGDVA D Y  Y ED D++ASLGVN+++F
Sbjct  57   YQIEGAYIEDGRSLSNWDVFSHTNGSITNGGNGDVADDHYHRYLEDIDIMASLGVNAYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+G+ G +N  GIK+Y N+ID+LLLKG+ PFVTI+H D PQEL+DR+  WLS
Sbjct  117  SISWSRLLPRGKLGVVNPAGIKFYNNIIDNLLLKGVTPFVTIHHNDYPQELEDRYGAWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF   GD+VKYW+T NEPN+++   Y  G +P
Sbjct  177  PLMQEEFVHFAETCFKSFGDRVKYWVTINEPNLFAELAYMNGIFP  221



>ref|XP_006348229.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=538

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG +L DGKGLSNWDVF+H  G I +G  GD+A D Y  ++ED +L+ S+G+NS++F
Sbjct  50   YQIEGAFLEDGKGLSNWDVFSHTKGRINNGDTGDIADDHYHRFQEDVELMHSIGLNSYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR G +N  G+ +Y  LIDSLLLKGI PFVT+NH+D P EL++++ GWL+
Sbjct  110  SISWSRVLPRGRFGKVNFAGVTFYNELIDSLLLKGITPFVTLNHHDHPHELEEKYGGWLN  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE++Y A +CF+  GD+VKYW T NEPNM++   Y  G +P
Sbjct  170  PIMQEEFSYFAQICFSSFGDRVKYWTTINEPNMFAEMAYVRGVYP  214



>ref|XP_002448178.1| hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
 gb|EES12506.1| hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
Length=510

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PG I DGS GD A D Y  +++D +L+ SLG N+++F
Sbjct  50   YQIEGAYLEGNKSLSNWDVFTHIPGRIEDGSTGDTADDHYHRFEDDVELMHSLGTNAYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N EGI +Y  LIDSLLLKGIEPFVT+ HYD+PQEL DR+  WLS
Sbjct  110  SISWARILPRGRFGQVNPEGIAFYNKLIDSLLLKGIEPFVTLAHYDIPQELVDRYGAWLS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++ YLADVCF   GD+VK+W TFNEPN+     Y  G +P
Sbjct  170  TEVQRDFGYLADVCFAAFGDRVKHWATFNEPNVAMTKGYMLGTYP  214



>ref|XP_009137214.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=520

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DG++G VA D Y  Y ED DL+  LGVNS++F
Sbjct  58   YQYEGAYLTDGKTLSNWDVFTSIPGKISDGTHGKVAVDHYHRYPEDLDLMQDLGVNSYRF  117

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQEL+ R++ WLS
Sbjct  118  SLSWARILPKGRLGDVNMEGIDHYNRMINAVLKRGMEPFVTLTHYDIPQELEHRYKSWLS  177

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A +CF H G++VK+W TFNEPN+  I  YR G +P
Sbjct  178  PQIREDFEHYAAICFRHFGNRVKFWSTFNEPNVQVILGYRKGTYP  222



>ref|XP_006391959.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
 gb|ESQ29245.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
Length=520

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG + +DGKGL+NWDVFTH+ P  I+   NGD+A DQY L+ +D   +  LGVNS++
Sbjct  50   YQYEGAFSTDGKGLNNWDVFTHENPEKIIKEGNGDIAVDQYHLFMKDIQSMTYLGVNSYR  109

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISWSRVLPKGR+G IN  GIK+Y  LID+L+  GI PFVT+NH+D PQEL++RF+ WL
Sbjct  110  LSISWSRVLPKGRNGGINHLGIKHYNRLIDALIRNGITPFVTLNHFDYPQELENRFKSWL  169

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            S EMQ+E+ YLAD+CF H GD+VK+WIT NEPN   I +Y  G +P
Sbjct  170  SSEMQKEFGYLADLCFKHFGDRVKHWITINEPNQQIILSYLKGIFP  215



>ref|NP_001053302.1| Os04g0513100 [Oryza sativa Japonica Group]
 sp|Q7XPY7.2|BGL14_ORYSJ RecName: Full=Probable inactive beta-glucosidase 14; Short=Os4bglu14; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE03397.2| OSJNBa0004N05.21 [Oryza sativa Japonica Group]
 dbj|BAF15216.1| Os04g0513100 [Oryza sativa Japonica Group]
 dbj|BAG90635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77631.1| hypothetical protein OsI_16623 [Oryza sativa Indica Group]
Length=516

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL   KGLSNWDVFTH+ G I DGSNGD A D Y  Y ED +L+ SLGVNS++F
Sbjct  42   YQVEGGYLEGNKGLSNWDVFTHKQGTIEDGSNGDTANDHYHRYMEDIELMHSLGVNSYRF  101

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G++N +G+ +Y  LID L+ KGI+PFVTI HYD+P EL +R+ GWLS
Sbjct  102  SISWARILPKGRFGDVNPDGVAFYNALIDGLVQKGIQPFVTICHYDIPHELDERYGGWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFW  697
            PE+Q++++Y A+VCF   GD++K+W TFN+PN+    +Y  GF+
Sbjct  162  PEIQKDFSYFAEVCFKLFGDRIKFWTTFNQPNLSIKFSYMDGFY  205



>ref|XP_006449069.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
 gb|ESR62309.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
Length=523

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 130/175 (74%), Gaps = 12/175 (7%)
 Frame = +2

Query  212  YEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSI  391
            YEG +L+DGKGL+NWD FTH+PGNI+DGSNGDVA D Y  Y +D DL+  LGVNS++FSI
Sbjct  46   YEGAFLTDGKGLNNWDNFTHKPGNIMDGSNGDVAVDHYHRYLQDLDLMDYLGVNSYRFSI  105

Query  392  SWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSPE  571
            SW+RVLP GR G++N  GI +Y  LI++LLLKGI+PFVT+ HYD+PQEL+DR+  WLS E
Sbjct  106  SWARVLPNGRFGDVNWAGIDHYNKLINALLLKGIQPFVTLTHYDIPQELEDRYGAWLSRE  165

Query  572  M------------QEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
                         +E++ Y AD+CF + GD+VKYW TFNEPN+  I  Y+ G +P
Sbjct  166  TLRFPTNADRKFSREDFEYYADICFKYFGDRVKYWATFNEPNVVVIRGYQSGIYP  220



>gb|AFK44109.1| unknown [Medicago truncatula]
Length=521

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG Y SDGKG SNWD FTH   G I+DGSNGD+A D Y  Y+ED +LL  L VNSH+
Sbjct  46   YQYEGAYNSDGKGQSNWDNFTHGGRGIIVDGSNGDIAVDHYHRYQEDINLLEDLEVNSHR  105

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISW+R+LPKGR G +N  GI +Y  L+D+L+LKGI+PFVT++HYD+PQEL+DR+ G L
Sbjct  106  LSISWARILPKGRFGEVNWAGIDFYNKLLDALMLKGIQPFVTLSHYDIPQELEDRYGGLL  165

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SP+ Q+++A+ AD+CF   GD+VK+WITFNEPN  +   YR G +P
Sbjct  166  SPQSQDDFAFYADLCFKTFGDRVKFWITFNEPNYLASLGYRSGLFP  211



>ref|XP_009605773.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG +L DGKGLSNWDVF+H  G I +G  GD+A D Y  + ED +L+ SLG+NS++F
Sbjct  49   YQIEGAFLEDGKGLSNWDVFSHTKGRIKNGDTGDIADDHYHRFLEDVELMHSLGLNSYRF  108

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N  GI +Y  LIDSL LKGI PFVT+NH+D PQEL++++ GWLS
Sbjct  109  SISWSRILPRGRFGKVNFAGIMFYNKLIDSLSLKGITPFVTLNHHDHPQELEEKYGGWLS  168

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE++Y A +CF   GD+V+YW T NEPNM++   Y  G +P
Sbjct  169  PLMQEEFSYFAQICFESFGDRVQYWTTINEPNMFAEMAYVRGVYP  213



>ref|XP_003610400.1| Beta-glucosidase [Medicago truncatula]
 gb|AES92597.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG Y SDGKG SNWD FTH   G I+DGSNGD+A D Y  Y+ED +LL  L VNSH+
Sbjct  46   YQYEGAYNSDGKGQSNWDNFTHGGRGIIVDGSNGDIAVDHYHRYQEDINLLEDLEVNSHR  105

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISW+R+LPKGR G +N  GI +Y  L+D+L+LKGI+PFVT++HYD+PQEL+DR+ G L
Sbjct  106  LSISWARILPKGRFGEVNWAGIDFYNKLLDALMLKGIQPFVTLSHYDIPQELEDRYGGLL  165

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SP+ Q+++A+ AD+CF   GD+VK+WITFNEPN  +   YR G +P
Sbjct  166  SPQSQDDFAFYADLCFKTFGDRVKFWITFNEPNYLASLGYRSGLFP  211



>ref|XP_010245701.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=512

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PG I DGSNGDVA D Y  Y ED +L+  LGVNS++F
Sbjct  39   YQIEGAYLEGNKSLSNWDVFTHIPGKIKDGSNGDVADDHYHHYMEDVELMHYLGVNSYRF  98

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR G +N  GI++Y  LI++LL+KGI+PFVT+NH+D+PQEL+DR+  WL+
Sbjct  99   SISWSRVLPRGRFGEVNSGGIEFYNKLINALLIKGIQPFVTLNHFDMPQELEDRYGSWLN  158

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             ++Q+++ Y A+VCF   GD+VKYW TFNEPN+     Y FG  P
Sbjct  159  SQIQQDFGYFAEVCFKAFGDRVKYWSTFNEPNIIVPYGYLFGGCP  203



>ref|XP_007145856.1| hypothetical protein PHAVU_007G273800g [Phaseolus vulgaris]
 gb|ESW17850.1| hypothetical protein PHAVU_007G273800g [Phaseolus vulgaris]
Length=531

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGKGLSNWDVF+H PG I +  NGD+A D Y LY ED  L++SLG+N ++F
Sbjct  48   YQIEGAPLEDGKGLSNWDVFSHIPGKISNDENGDIADDHYHLYSEDIKLMSSLGINVYRF  107

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  GIK+Y  +ID+LLL+GIEPFVTI+H+DLPQEL++++ GWLS
Sbjct  108  SISWTRILPRGIYGDINPSGIKFYNKIIDNLLLRGIEPFVTIHHHDLPQELEEQYGGWLS  167

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ Y A++CF   GD++KYW T NEPN+++ A +  G +P
Sbjct  168  PLIQRDFVYFAEICFKSFGDRIKYWATINEPNLFADAAFIRGIYP  212



>ref|XP_002448179.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
 gb|EES12507.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Length=516

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PG I D S GDVA D Y  Y+ED +L+ SLG N+++F
Sbjct  55   YQIEGAYLEGNKSLSNWDVFTHAPGRIKDRSTGDVADDHYHRYEEDIELMHSLGTNAYRF  114

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N  GI +Y  LIDSLLLKGIEPFVT+ HYD PQEL+DR+  WLS
Sbjct  115  SISWARVLPKGRFGKVNPAGIAFYNKLIDSLLLKGIEPFVTLTHYDTPQELEDRYGAWLS  174

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E + ++ +LADVCF   GD+VKYW TFNEPN+     Y  G +P
Sbjct  175  AEARRDFGHLADVCFAAFGDRVKYWSTFNEPNVVVTRGYMVGTYP  219



>gb|KDO74146.1| hypothetical protein CISIN_1g012716mg [Citrus sinensis]
Length=303

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL DGK LSNWDVF+H PGNI +  NGDVA D Y  + ED  ++ SLGVNS++F
Sbjct  57   FQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIGIMHSLGVNSYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+L++++  WLS
Sbjct  117  SISWPRILPKGRFGKVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQLEEKYGSWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+MQ+E+ +LA  CF + GD+VKYW T NEPN+ +   Y  G +P
Sbjct  177  PQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYP  221



>ref|NP_001053303.1| Os04g0513400 [Oryza sativa Japonica Group]
 dbj|BAF15217.1| Os04g0513400 [Oryza sativa Japonica Group]
Length=268

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL D KGL+NWDVFTH Q G I DG NGDVA D Y  Y ED D+L +LGVNS++
Sbjct  46   YQIEGAYLDDNKGLNNWDVFTHTQAGRISDGRNGDVADDHYHRYTEDVDILHNLGVNSYR  105

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LP+GR G +N  GI +Y  LI++LL KGI+PFVT+NH+D+P EL+ R+ GWL
Sbjct  106  FSISWARILPRGRLGGVNSAGIAFYNRLINALLQKGIQPFVTLNHFDIPHELETRYGGWL  165

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y +DVCFN  GD+V++W TFNEPN+ +   Y  G +P
Sbjct  166  GAAIREEFEYYSDVCFNAFGDRVRFWTTFNEPNLSTRHQYILGEFP  211



>ref|XP_006413735.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55188.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=528

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YLSDGK LSNWDVFT+  G I DGS+G VA D Y  Y ED DL+  LGVNS++F
Sbjct  63   YQYEGAYLSDGKTLSNWDVFTNITGKIADGSHGKVAVDHYHRYPEDLDLMEDLGVNSYRF  122

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+EGI +Y  +ID++L +GIEPFVT+ HYD+PQEL+ R+  WL+
Sbjct  123  SLSWARILPKGRFGDMNMEGIYHYNRVIDAILKRGIEPFVTLTHYDIPQELEYRYGSWLN  182

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF + G++VK+W TFNEPN+  I  YR G +P
Sbjct  183  PQIREDFEHYAEICFRYFGNRVKFWSTFNEPNVQVILGYRKGTYP  227



>ref|XP_010920356.1| PREDICTED: beta-glucosidase 18-like [Elaeis guineensis]
Length=510

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTH PG+I D S+GD+A D Y LY ED  L+  LGVNS++F
Sbjct  42   YQIEGAYLEGNKSLSNWDVFTHIPGHIEDSSDGDIADDHYHLYMEDIKLMHHLGVNSYRF  101

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N  GI +Y  LID+LLLKGI+PFVT+NHYD+PQEL+DR+  WL+
Sbjct  102  SISWSRILPRGRFGKVNSAGIAFYNRLIDALLLKGIQPFVTLNHYDVPQELEDRYGAWLN  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++Q+++ + ADVCF   G KVKYW TFNEPN+     +  G +P
Sbjct  162  PQIQKDFGHYADVCFKAFGKKVKYWTTFNEPNVVVKRGFMSGEYP  206



>ref|XP_010023758.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW60129.1| hypothetical protein EUGRSUZ_H02855 [Eucalyptus grandis]
Length=518

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL   K LSNWDVF+H PG I DGSN DV  + Y+L+ ED +L+  LGV++++F
Sbjct  52   FQIEGAYLQGNKSLSNWDVFSHIPGKIEDGSNADVTDNHYNLFMEDIELMCDLGVDAYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLPKGR G +N EGI++Y NLID+LL+KGI+PFVT+NHYD+PQ L+DR+ GWLS
Sbjct  112  SISWSRVLPKGRFGEVNSEGIEFYNNLIDALLVKGIKPFVTLNHYDIPQLLEDRYGGWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++ Y A VCF   GD+V YW TFNEPN++    Y  G +P
Sbjct  172  SEIQLDFGYFAQVCFEAFGDRVTYWTTFNEPNVFIYDGYVVGTYP  216



>ref|XP_006413734.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 ref|XP_006413736.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55187.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55189.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=524

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YLSDGK LSNWDVFT+  G I DGS+G VA D Y  Y ED DL+  LGVNS++F
Sbjct  63   YQYEGAYLSDGKTLSNWDVFTNITGKIADGSHGKVAVDHYHRYPEDLDLMEDLGVNSYRF  122

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+EGI +Y  +ID++L +GIEPFVT+ HYD+PQEL+ R+  WL+
Sbjct  123  SLSWARILPKGRFGDMNMEGIYHYNRVIDAILKRGIEPFVTLTHYDIPQELEYRYGSWLN  182

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF + G++VK+W TFNEPN+  I  YR G +P
Sbjct  183  PQIREDFEHYAEICFRYFGNRVKFWSTFNEPNVQVILGYRKGTYP  227



>ref|XP_004976207.1| PREDICTED: beta-glucosidase 18-like [Setaria italica]
Length=594

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVFTHQPG I D S GD+A D Y  +++D +L+ SLG N+++F
Sbjct  134  YQIEGAYLEGNKSLSNWDVFTHQPGRIKDRSTGDIADDHYHRFEDDVELMHSLGTNAYRF  193

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +NL GI +Y  LIDSLL KGIEPFVT+ HYD+PQEL+DR+  WLS
Sbjct  194  SISWARILPRGRFGRVNLAGIAFYDELIDSLLHKGIEPFVTLTHYDIPQELEDRYGSWLS  253

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++ Y ADVCF   GD+VKYW TFNEPN+     Y  G +P
Sbjct  254  DEIQRDFGYFADVCFAAFGDRVKYWATFNEPNVAVRKGYMLGTYP  298



>ref|XP_004976201.1| PREDICTED: probable inactive beta-glucosidase 14-like isoform 
X2 [Setaria italica]
Length=469

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL   KGLSNWDVFTH+ G I DGSNGD A D Y  Y ED +L+ SLGVNS++F
Sbjct  51   YQIEGGYLEGNKGLSNWDVFTHKQGTIKDGSNGDSADDHYHRYMEDINLMHSLGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+W+R+LP+GR G +N +G+ +Y  +ID+LL KG++PFVTI H+D+P EL  R+ GWLS
Sbjct  111  SIAWTRILPRGRFGKVNPDGVAFYNAIIDALLQKGMQPFVTIYHFDIPHELDKRYGGWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFG  691
             E+Q+++ Y AD+CF   GD+VK+WIT NEPN+++  +Y +G
Sbjct  171  SEIQKDFGYFADICFKMFGDRVKFWITINEPNLFTKLSYMYG  212



>ref|XP_006348230.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=528

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y  DG+ LSNWD + H  G I +G +GD+A D Y  Y ED D++ASLGVN+++F
Sbjct  54   YQVEGAYSEDGRSLSNWDTYCHINGRIPNGGSGDIADDHYHRYLEDIDIMASLGVNAYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+G+ G +N  GIK+Y N+IDSLLLKGI PFVTI+HYD PQE +DRFQ WLS
Sbjct  114  SISWSRILPRGKLGLVNPAGIKFYNNIIDSLLLKGIIPFVTIHHYDYPQEFEDRFQAWLS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ Y A++CF   G++VKYW T NEPN++    Y  G +P
Sbjct  174  PLMQEEFVYFAEICFKSFGNRVKYWATLNEPNLYMEMAYLKGVFP  218



>ref|XP_011628484.1| PREDICTED: beta-glucosidase 18 [Amborella trichopoda]
Length=518

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +L+DGKG SNWDVF+H PG I++G NGD A D+Y  Y+ED +L+ SLGVN+++F
Sbjct  42   YQYEGAFLTDGKGPSNWDVFSHIPGRIVNGDNGDFAVDEYHRYQEDIELMHSLGVNTYRF  101

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLP+G+ G IN  GIKYY  LID+L+ KGI+PFVTINHYD+PQE+++R+  WLS
Sbjct  102  SISWARVLPRGKFGGINPAGIKYYNKLIDALVKKGIQPFVTINHYDIPQEIENRYGSWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P ++ ++ + A++CF   GD+VKYW T NEPN+     Y  G +P
Sbjct  162  PLIRLDFGHFAELCFREFGDRVKYWATLNEPNIVVRFGYMSGSYP  206



>gb|EAZ31330.1| hypothetical protein OsJ_15447 [Oryza sativa Japonica Group]
Length=566

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 126/163 (77%), Gaps = 0/163 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            Q EGGYL   KGLSNWDVFTH+ G I DGSNGD A D Y  Y ED +L+ SLGVNS++FS
Sbjct  130  QVEGGYLEGNKGLSNWDVFTHKQGTIEDGSNGDTANDHYHRYMEDIELMHSLGVNSYRFS  189

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            ISW+R+LPKGR G++N +G+ +Y  LID L+ KGI+PFVTI HYD+P EL +R+ GWLSP
Sbjct  190  ISWARILPKGRFGDVNPDGVAFYNALIDGLVQKGIQPFVTICHYDIPHELDERYGGWLSP  249

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFW  697
            E+Q++++Y A+VCF   GD++K+W TFN+PN+    +Y  GF+
Sbjct  250  EIQKDFSYFAEVCFKLFGDRIKFWTTFNQPNLSIKFSYMDGFY  292



>ref|XP_010449006.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DGS G VA D Y  Y ED DL+  LGVNS++ 
Sbjct  64   YQYEGAYLTDGKNLSNWDVFTSIPGKIADGSQGKVAVDHYHRYPEDLDLMEDLGVNSYRL  123

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+ GI +Y  +I+++L +G+EPFVT+ HYD+PQEL  R+  WL 
Sbjct  124  SLSWARILPKGRFGDVNMGGIDHYNRMINAILKRGMEPFVTLTHYDIPQELVVRYGSWLD  183

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF H GD+VK+W TFNEPN+  I  YR G +P
Sbjct  184  PQIREDFEHYAEICFRHFGDRVKFWTTFNEPNVQVILGYRTGTYP  228



>gb|AFK46781.1| unknown [Medicago truncatula]
Length=521

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNIL-DGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG Y SDGKG SNWD FTH    I+ DGSNGD+A D Y  Y+ED +LL  L VNSH+
Sbjct  46   YQYEGAYNSDGKGQSNWDNFTHGGRCIIVDGSNGDIAVDHYHRYQEDINLLEDLEVNSHR  105

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISW+R+LPKGR G +N  GI +Y  L+D+L+LKGI+PFVT++HYD+PQEL+DR+ G L
Sbjct  106  LSISWARILPKGRFGEVNWAGIDFYNKLLDALMLKGIQPFVTLSHYDIPQELEDRYGGLL  165

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SP+ Q+++A+ AD+CF   GD+VK+WITFNEPN  +   YR G +P
Sbjct  166  SPQSQDDFAFYADLCFKTFGDRVKFWITFNEPNYLASLGYRSGLFP  211



>gb|ERN19524.1| hypothetical protein AMTR_s00062p00043120 [Amborella trichopoda]
Length=537

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG +L+DGKG SNWDVF+H PG I++G NGD A D+Y  Y+ED +L+ SLGVN+++F
Sbjct  42   YQYEGAFLTDGKGPSNWDVFSHIPGRIVNGDNGDFAVDEYHRYQEDIELMHSLGVNTYRF  101

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLP+G+ G IN  GIKYY  LID+L+ KGI+PFVTINHYD+PQE+++R+  WLS
Sbjct  102  SISWARVLPRGKFGGINPAGIKYYNKLIDALVKKGIQPFVTINHYDIPQEIENRYGSWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P ++ ++ + A++CF   GD+VKYW T NEPN+     Y  G +P
Sbjct  162  PLIRLDFGHFAELCFREFGDRVKYWATLNEPNIVVRFGYMSGSYP  206



>ref|XP_009602726.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=266

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DG+ LSNWDV+    G I +G +GD+A D Y  Y ED D +ASLGVN+++F
Sbjct  56   YQIEGAYIEDGRSLSNWDVYCRINGRIPNGGSGDIADDHYHRYLEDIDRMASLGVNAYRF  115

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N  GI++Y N+I +LLLKGI PFVTI+HYD PQE +DR+  WLS
Sbjct  116  SISWSRILPRGRFGAVNPAGIRFYNNIIVNLLLKGITPFVTIHHYDYPQEFEDRYGAWLS  175

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF   GD+VKYW T NEPN+++   Y  G +P
Sbjct  176  PLMQEEFVHFAETCFKSFGDRVKYWSTMNEPNLFAEMAYLKGVFP  220



>ref|XP_009768487.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=530

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG +L DGKGLSNWDVF+H  G I +G  GD+A D Y  + ED +L+ SLG+NS++F
Sbjct  49   YQIEGAFLEDGKGLSNWDVFSHTKGRIKNGDTGDIADDHYHRFLEDVELMHSLGLNSYRF  108

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N  GI +Y  LIDSL LKGI PF+T+NH+D PQEL++++ GWL+
Sbjct  109  SISWSRILPRGRFGKLNFAGIIFYNKLIDSLSLKGITPFMTLNHHDHPQELEEKYGGWLN  168

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ Y A +CF   GD+VKYW T NEPNM++   Y  G +P
Sbjct  169  PLMQEEFTYFAQICFESFGDRVKYWTTINEPNMFAEMAYVRGVYP  213



>ref|XP_008454703.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=480

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            Q EG YL DGKGLSNWDVF+H PG I +   GDVA D Y  + ED +L+ S+G+NS++FS
Sbjct  3    QIEGAYLEDGKGLSNWDVFSHLPGRIRNNDTGDVADDHYHRFLEDIELMHSMGMNSYRFS  62

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            ISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  R+  W+S 
Sbjct  63   ISWTRILPKGRFGKVNRRGIAFYNKIIDNLLLKGIEPFVTIHHHDLPAELDKRYGSWMSA  122

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            EMQE++ Y A +CF   GD+VKYWIT NEPN+ ++  Y  G +P
Sbjct  123  EMQEDFVYFAKICFEEFGDRVKYWITINEPNVITLMGYTKGVYP  166



>ref|XP_006285457.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
 gb|EOA18355.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
Length=514

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DGS+G VA D Y  Y ED DL+  LGVNS++ 
Sbjct  55   YQYEGAYLTDGKNLSNWDVFTSIPGKIADGSHGKVAVDHYHRYPEDLDLMEDLGVNSYRL  114

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S SW+R+LPKGR G++N+ GI +Y  +I+++L +GIEPFVT+ HYDLPQEL  R+  WL 
Sbjct  115  SFSWARILPKGRFGDVNMGGIDHYNRMINAILKRGIEPFVTLTHYDLPQELVVRYGSWLD  174

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++   A++CF H GD+VK+W TFNEPN+  +  YR G +P
Sbjct  175  PQIREDFENYAEICFRHFGDRVKFWATFNEPNVQVVLGYRTGTYP  219



>ref|XP_007153927.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
 gb|ESW25921.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
Length=528

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 124/167 (74%), Gaps = 2/167 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGN--ILDGSNGDVAADQYDLYKEDADLLASLGVNSH  379
            YQYEG Y SDGKG+SNWD FTH  G   I+ G NGD+A D Y+ Y ED DL+ +LGVNS+
Sbjct  47   YQYEGAYQSDGKGMSNWDNFTHGTGRYVIIGGGNGDIANDHYNRYLEDIDLMEALGVNSY  106

Query  380  KFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGW  559
            + SISW+R+LPKGR G  N  GI +Y  LID L+LKGI+PFVT++HY+ PQEL+DR+  W
Sbjct  107  RLSISWARILPKGRFGEANHAGIAFYNRLIDVLILKGIQPFVTLSHYESPQELEDRYGSW  166

Query  560  LSPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            LSP+ QE++A+ AD+CF   GD+VKYW TFNEPN      YR G +P
Sbjct  167  LSPQSQEDFAFYADLCFKTFGDRVKYWATFNEPNFQVPLGYRSGLYP  213



>gb|KDO74144.1| hypothetical protein CISIN_1g012716mg [Citrus sinensis]
 gb|KDO74145.1| hypothetical protein CISIN_1g012716mg [Citrus sinensis]
Length=389

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL DGK LSNWDVF+H PGNI +  NGDVA D Y  + ED  ++ SLGVNS++F
Sbjct  57   FQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIGIMHSLGVNSYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+L++++  WLS
Sbjct  117  SISWPRILPKGRFGKVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQLEEKYGSWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+MQ+E+ +LA  CF + GD+VKYW T NEPN+ +   Y  G +P
Sbjct  177  PQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYP  221



>gb|EMT09723.1| Beta-glucosidase 6 [Aegilops tauschii]
Length=508

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  215  EGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSIS  394
            EGGYL   KGLSNWDV+TH+ G I DGSNGD+AAD Y  Y ED +L+ SLGVNS++FSI+
Sbjct  37   EGGYLEGKKGLSNWDVYTHKQGTIEDGSNGDIAADHYHRYMEDIELMHSLGVNSYRFSIA  96

Query  395  WSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSPEM  574
            W+R+LP+GR G++N +G+ +Y  +I++LL KGI+PFVTI HYD+P EL++R+ GWLSPE+
Sbjct  97   WTRILPRGRFGHVNPDGVAFYNAIINALLHKGIQPFVTIFHYDIPHELEERYGGWLSPEI  156

Query  575  QEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            Q+++ Y A+VCF   GD+VK+W+T N+PN+ +   Y  G++P
Sbjct  157  QKDFGYFAEVCFKMFGDRVKFWVTMNQPNLLAKFAYMNGWFP  198



>ref|XP_006348385.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=512

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGY+ DGK LSNWDV++H  G+I +G NGD+A D Y  Y ED D++ SLGVN+++F
Sbjct  37   YQIEGGYIEDGKSLSNWDVYSHTNGSIKNGGNGDIADDHYHRYLEDIDIMESLGVNAYRF  96

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP G  G +N  GIK+Y N+ID+LLLKGI PFVTI+H D PQEL++R+  WLS
Sbjct  97   SISWSRVLPNGSSGPMNPAGIKFYNNIIDNLLLKGITPFVTIHHNDYPQELEERYGAWLS  156

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A +CF + G++VKYW T NEPN++S   Y  G +P
Sbjct  157  PFMQEEFVHFASICFKNFGNRVKYWATINEPNLFSELAYMKGIFP  201



>ref|XP_010434129.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DGS G VA D Y  Y ED DL+  LGVNS++ 
Sbjct  64   YQYEGAYLTDGKNLSNWDVFTSIPGKIADGSQGKVAVDHYHRYPEDLDLMEDLGVNSYRL  123

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+ GI +Y  +I+++L +G++PFVT+ HYD+PQEL  R+  WL 
Sbjct  124  SLSWARILPKGRFGDVNMGGIDHYNRMINAILKRGMDPFVTLTHYDIPQELVVRYGSWLD  183

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF H GD+VK+W TFNEPN+  I  YR G +P
Sbjct  184  PQIREDFEHYAEICFRHFGDRVKFWTTFNEPNVQVILGYRTGTYP  228



>ref|XP_004976200.1| PREDICTED: probable inactive beta-glucosidase 14-like isoform 
X1 [Setaria italica]
Length=533

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL   KGLSNWDVFTH+ G I DGSNGD A D Y  Y ED +L+ SLGVNS++F
Sbjct  51   YQIEGGYLEGNKGLSNWDVFTHKQGTIKDGSNGDSADDHYHRYMEDINLMHSLGVNSYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+W+R+LP+GR G +N +G+ +Y  +ID+LL KG++PFVTI H+D+P EL  R+ GWLS
Sbjct  111  SIAWTRILPRGRFGKVNPDGVAFYNAIIDALLQKGMQPFVTIYHFDIPHELDKRYGGWLS  170

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFG  691
             E+Q+++ Y AD+CF   GD+VK+WIT NEPN+++  +Y +G
Sbjct  171  SEIQKDFGYFADICFKMFGDRVKFWITINEPNLFTKLSYMYG  212



>ref|XP_010675613.1| PREDICTED: beta-glucosidase 18-like [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL DGK LSNWDVFTH PGNI  G NGDVA D Y  Y ED + L  LGVN+++F
Sbjct  53   YQIEGAYLEDGKSLSNWDVFTHVPGNIESGENGDVADDHYHHYMEDIEKLEYLGVNAYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G  N  G+ +Y N+ID+LLLKGI+PFVTI+H D+PQEL+DR+  WLS
Sbjct  113  SISWTRILPRGRFGEKNPSGVLFYNNIIDNLLLKGIQPFVTIHHNDIPQELEDRYGSWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+QE++   A  CF + GD+VKYW+T NEPN+ +I  Y  G +P
Sbjct  173  SEIQEDFVLFAKTCFENFGDRVKYWVTINEPNINAILAYMEGAFP  217



>ref|XP_011652391.1| PREDICTED: beta-glucosidase 18 isoform X2 [Cucumis sativus]
Length=537

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL DGKGLSNWDVF+H P  I +   GDVA D Y  + ED +L+ S+G+NS++F
Sbjct  59   YQVEGAYLEDGKGLSNWDVFSHLPARIRNSDTGDVADDHYHRFLEDIELMHSMGMNSYRF  118

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  R+  W+S
Sbjct  119  SISWTRILPKGRFGKVNRRGIAFYNKIIDNLLLKGIEPFVTIHHHDLPAELDKRYGSWMS  178

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +MQE++ Y A +CF   GD+VKYWIT NEPN+ ++  Y  G +P
Sbjct  179  AQMQEDFVYFAKICFEEFGDRVKYWITINEPNVITLMGYTKGVYP  223



>ref|XP_011098340.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=550

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DGKGLSNWDV+    GNI DG++GD+A D Y  Y ED +++ SLG+ +++F
Sbjct  69   YQIEGAVHEDGKGLSNWDVYCRIQGNIADGTSGDIANDHYHRYMEDIEIIHSLGLTAYRF  128

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GRHG +N  GI +Y ++ID+LLL+GI+PFVTI H + PQEL+DR  GWLS
Sbjct  129  SISWSRVLPRGRHGGVNQAGITFYNSIIDNLLLRGIQPFVTIFHNEYPQELEDRIGGWLS  188

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF H  D+VKYW+T NEPN+ +  TY  G +P
Sbjct  189  PVMQEEFVHFAETCFKHFADRVKYWMTINEPNLLAEVTYERGLFP  233



>gb|KDO74143.1| hypothetical protein CISIN_1g012716mg [Citrus sinensis]
Length=458

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL DGK LSNWDVF+H PGNI +  NGDVA D Y  + ED  ++ SLGVNS++F
Sbjct  57   FQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIGIMHSLGVNSYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+L++++  WLS
Sbjct  117  SISWPRILPKGRFGKVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQLEEKYGSWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+MQ+E+ +LA  CF + GD+VKYW T NEPN+ +   Y  G +P
Sbjct  177  PQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYP  221



>ref|XP_010069050.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW57267.1| hypothetical protein EUGRSUZ_H00071 [Eucalyptus grandis]
Length=515

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL+  K LSNWDV+TH PG + DGSN DVA D Y L+ ED + +  LGVNS++F
Sbjct  44   FQIEGAYLTGNKSLSNWDVYTHIPGKVEDGSNADVADDHYHLFMEDVESMEDLGVNSYRF  103

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP GR+G  N +GI +Y NLID+LL KGIEPFVT+NHY+ PQ L+DR+  WLS
Sbjct  104  SISWSRVLPHGRYGETNPDGINFYNNLIDALLQKGIEPFVTLNHYEHPQVLEDRYGSWLS  163

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++A+ A+VCF   GD+VKYW T NEPNM++   Y  G +P
Sbjct  164  SEIQLDFAHFAEVCFEAFGDRVKYWTTINEPNMFTYYAYFEGTYP  208



>gb|KFK28775.1| hypothetical protein AALP_AA7G045800 [Arabis alpina]
Length=492

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DGS+G VA D Y  Y ED DL+  LGVNS++ 
Sbjct  30   YQYEGAYLTDGKTLSNWDVFTSIPGKIADGSHGKVAVDHYHRYPEDLDLMEDLGVNSYRL  89

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+ GI +Y  +I+++L +GIEPFVT+ HYD+PQEL+ R+  WL+
Sbjct  90   SLSWARILPKGRFGDVNMAGIHHYNRMINNILKRGIEPFVTLTHYDIPQELEFRYGSWLN  149

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF + G++VK+W TFNEPN+  I  YR G +P
Sbjct  150  PQIREDFEHYAEICFQYFGNRVKFWSTFNEPNVQVILGYRKGTYP  194



>ref|XP_009135219.1| PREDICTED: beta-glucosidase 47 isoform X2 [Brassica rapa]
Length=522

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT   G I DGS+G V+ D Y  Y  D DL   LGVNS++F
Sbjct  62   YQYEGAYLTDGKALSNWDVFTSISGKIADGSHGKVSVDHYHRYPGDLDLKKDLGVNSYRF  121

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQEL+ R+  WL+
Sbjct  122  SLSWARILPKGRFGDVNMEGINHYNRMINAILKRGMEPFVTLTHYDMPQELECRYGSWLN  181

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF H G++VK+W TFNEPN+  I  YR G +P
Sbjct  182  PQIREDFEHYAEICFRHFGNRVKFWTTFNEPNVQVILGYRKGTYP  226



>ref|XP_006451937.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
 gb|ESR65177.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
Length=523

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL DGK LSNWDVF+H PGNI +  NGDVA D Y  + ED +++ SLGVNS++F
Sbjct  57   FQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIEIMHSLGVNSYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+++D++  WLS
Sbjct  117  SISWPRILPKGRFGEVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQIEDKYGSWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+MQ+E+ +LA  CF + GD+VKYW T NEPN+ +   Y  G +P
Sbjct  177  PQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYP  221



>ref|XP_004141366.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
 gb|KGN55151.1| hypothetical protein Csa_4G638400 [Cucumis sativus]
Length=523

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGY+ DG+G SNWDVF+H PGNI +   GDVA D Y  + ED ++++S+G+N+++F
Sbjct  48   YQIEGGYVEDGRGTSNWDVFSHIPGNIKNSDTGDVADDHYHRFMEDIEMMSSMGMNAYRF  107

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  R+  W+S
Sbjct  108  SISWTRILPKGRFGKVNRRGIVFYNKIIDNLLLKGIEPFVTIHHHDLPDELDKRYGSWMS  167

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              MQE++ Y A +CF   GD+VK+WIT NEPN+ ++  Y  G +P
Sbjct  168  SHMQEDFVYFAKICFKEFGDRVKHWITINEPNLVTLMGYIKGVYP  212



>ref|XP_008224799.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45-like [Prunus 
mume]
Length=513

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ+EG +L+DGKGL+NWDVFTH+PG+I DG+NGD+A DQY LY ED DL++ +GV+S++F
Sbjct  52   YQFEGAFLTDGKGLNNWDVFTHKPGHISDGTNGDIAVDQYHLYLEDLDLMSYIGVHSYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLPKGR G +N    + + N  D  L   I+PFVT++HYD+PQEL+DR+  WLS
Sbjct  112  SISWARVLPKGRFGKVN----RAFLNKYDKXLR--IQPFVTLSHYDIPQELEDRYGAWLS  165

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++QE++ Y A+ CF   GD+VKYW+TFNEPN+  I  YR G +P
Sbjct  166  PKVQEDFKYYANTCFEFYGDRVKYWVTFNEPNVVVIRGYRSGVYP  210



>ref|XP_010439426.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DGS G VA D Y  Y ED DL+  LGVNS++ 
Sbjct  64   YQYEGAYLTDGKNLSNWDVFTSIPGKIADGSQGKVAVDHYHRYPEDLDLMEDLGVNSYRL  123

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+ GI +Y  +I+++L +G+EPFVT+ HYD+PQEL  R+  WL 
Sbjct  124  SLSWARILPKGRFGDVNMGGIDHYNRMINAILKRGMEPFVTLTHYDIPQELVVRYGSWLD  183

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF + GD+VK+W TFNEPN+  +  YR G +P
Sbjct  184  PQIREDFEHYAEICFRYFGDRVKFWATFNEPNVQVVLGYRTGTYP  228



>ref|XP_003581423.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Brachypodium 
distachyon]
Length=518

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL   KG SNWDV+TH+ G I  GSNGD AAD Y  Y ED +L+ SLGVNS++F
Sbjct  45   YQIEGGYLEGNKGTSNWDVYTHKQGTIRGGSNGDTAADHYHRYMEDIELMHSLGVNSYRF  104

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+W+R+LP+GR G++N +G+ +Y  +ID+L  KGI+PFVTI HYD+P EL +R+ GWLS
Sbjct  105  SIAWTRILPRGRFGDVNPDGVAFYNAIIDALWQKGIQPFVTIFHYDIPHELDERYGGWLS  164

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            PE+Q+++ Y A+VCF   GD+VK+W T NEPN+ +  +Y  G++P
Sbjct  165  PEIQKDFGYFAEVCFKMFGDRVKFWTTINEPNLLTKFSYMDGWYP  209



>gb|KGN59900.1| hypothetical protein Csa_3G852490 [Cucumis sativus]
Length=545

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            Y+ EG YL DGKGLSNWDVF+H P  I +   GDVA D Y  + ED +L+ S+G+NS++F
Sbjct  67   YKVEGAYLEDGKGLSNWDVFSHLPARIRNSDTGDVADDHYHRFLEDIELMHSMGMNSYRF  126

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  R+  W+S
Sbjct  127  SISWTRILPKGRFGKVNRRGIAFYNKIIDNLLLKGIEPFVTIHHHDLPAELDKRYGSWMS  186

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +MQE++ Y A +CF   GD+VKYWIT NEPN+ ++  Y  G +P
Sbjct  187  AQMQEDFVYFAKICFEEFGDRVKYWITINEPNVITLMGYTKGVYP  231



>ref|XP_002869865.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46124.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT+  G I DGS+G VA D Y  Y  D DL+  LGVNS++ 
Sbjct  64   YQYEGAYLTDGKTLSNWDVFTNISGKIADGSHGKVAVDHYHRYPGDLDLMEDLGVNSYRL  123

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+ GI +Y  +I+ +L++GIEPFVT+ HYD+PQEL+ R+  WL+
Sbjct  124  SLSWARILPKGRFGDVNMGGIDHYNRMINDILMRGIEPFVTLTHYDIPQELESRYGSWLN  183

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF + GD+VK+W TFNEPN+  I  YR G +P
Sbjct  184  PQIREDFEHYANICFRYFGDRVKFWATFNEPNVQVILGYRTGTYP  228



>gb|AID16401.1| monolignol beta-glucosidase, partial [synthetic construct]
Length=498

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL D KGL+NWDVFTH Q G I DG NGDVA D Y  Y ED D+L +LGVNS++
Sbjct  28   YQIEGAYLDDNKGLNNWDVFTHTQAGRISDGRNGDVADDHYHRYTEDVDILHNLGVNSYR  87

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LP+GR G +N  GI +Y  LI++LL KGI+PFVT+NH+D+P EL+ R+ GWL
Sbjct  88   FSISWARILPRGRLGGVNSAGIAFYNRLINALLQKGIQPFVTLNHFDIPHELETRYGGWL  147

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y +DVCFN  GD+V++W TFNEPN+ +   Y  G +P
Sbjct  148  GAAIREEFEYYSDVCFNAFGDRVRFWTTFNEPNLSTRHQYILGEFP  193



>sp|Q7XSK2.2|BGL16_ORYSJ RecName: Full=Beta-glucosidase 16; Short=Os4bglu16; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54544.1| OSJNBa0004N05.24 [Oryza sativa Japonica Group]
 emb|CAE01908.2| OSJNBb0070J16.1 [Oryza sativa Japonica Group]
 gb|EEC77634.1| hypothetical protein OsI_16626 [Oryza sativa Indica Group]
Length=516

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL D KGL+NWDVFTH Q G I DG NGDVA D Y  Y ED D+L +LGVNS++
Sbjct  46   YQIEGAYLDDNKGLNNWDVFTHTQAGRISDGRNGDVADDHYHRYTEDVDILHNLGVNSYR  105

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LP+GR G +N  GI +Y  LI++LL KGI+PFVT+NH+D+P EL+ R+ GWL
Sbjct  106  FSISWARILPRGRLGGVNSAGIAFYNRLINALLQKGIQPFVTLNHFDIPHELETRYGGWL  165

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y +DVCFN  GD+V++W TFNEPN+ +   Y  G +P
Sbjct  166  GAAIREEFEYYSDVCFNAFGDRVRFWTTFNEPNLSTRHQYILGEFP  211



>ref|XP_006464711.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Citrus sinensis]
Length=492

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL DGK LSNWDVF+H PGNI +  NGDVA D Y  + ED  ++ SLGVNS++F
Sbjct  57   FQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIGIMHSLGVNSYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+L++++  WLS
Sbjct  117  SISWPRILPKGRFGKVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQLEEKYGSWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+MQ+E+ +LA  CF + GD+VKYW T NEPN+ +   Y  G +P
Sbjct  177  PQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYP  221



>ref|XP_007149593.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21587.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=530

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGKGLSNWDVF+H PG I +  NGD+A D Y LY ED  L++SLG+N ++F
Sbjct  48   YQIEGAPLEDGKGLSNWDVFSHIPGKISNDENGDIADDHYHLYSEDIKLMSSLGINVYRF  107

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  GIK+Y  +ID+LLL+GIEPFVTI+H+DLP+EL++++ GWLS
Sbjct  108  SISWTRILPRGIYGDINPSGIKFYNKIIDNLLLRGIEPFVTIHHHDLPRELEEQYGGWLS  167

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ Y A++CF   GD++KYW T NEPN+ +   +  G +P
Sbjct  168  PLIQRDFVYFAEICFKSFGDRIKYWTTINEPNLIADFAFIRGTYP  212



>ref|XP_010324440.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=521

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGY+ DGK LSNWDV++H  G+I +G NGD+A D Y  Y ED D++ SLGVN+++F
Sbjct  53   YQIEGGYIEDGKSLSNWDVYSHTNGSIKNGGNGDIADDHYHRYLEDIDIMESLGVNAYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP G  G +N  G+K+Y N+ID+LLLKGI PFVT +H D PQEL++R+  WLS
Sbjct  113  SISWSRVLPNGSSGPMNPAGMKFYNNIIDNLLLKGITPFVTTHHNDYPQELEERYGAWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A  CF + GD+VKYW T NEPN++S   Y  G +P
Sbjct  173  PFMQEEFVHFASTCFKNFGDRVKYWATINEPNLFSELAYMKGIFP  217



>ref|XP_004487691.1| PREDICTED: beta-glucosidase 18-like [Cicer arietinum]
Length=525

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DGKGLSNWDVF+H PG I +  NGD+A D Y  Y+ED  L++SLG+N ++F
Sbjct  47   YQIEGAAFEDGKGLSNWDVFSHTPGKINNNENGDIADDHYHHYQEDIKLMSSLGINVYRF  106

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +GNIN  G+ +Y N+ID+LLL+GIEPFVTI+H+DLPQEL+DR+ GWLS
Sbjct  107  SISWTRILPRGIYGNINPSGVMFYNNIIDNLLLRGIEPFVTIHHHDLPQELEDRYGGWLS  166

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNM  664
            P +Q ++ + A++CF   GD+VKYWIT NEP +
Sbjct  167  PLIQRDFVHFAEICFKSFGDRVKYWITINEPTL  199



>emb|CDX94055.1| BnaC07g36890D [Brassica napus]
Length=519

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DG++G VA D Y  Y ED DL+  LGVNS++F
Sbjct  58   YQYEGAYLTDGKTLSNWDVFTSIPGKIADGTHGKVAVDHYHRYPEDLDLMQDLGVNSYRF  117

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LP+ R G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQEL+ R++ WLS
Sbjct  118  SLSWARILPR-RLGDVNMEGIDHYNRMINAILKRGMEPFVTLTHYDIPQELELRYKSWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A +CF H G++VK+W TFNEPN+  I  YR G +P
Sbjct  177  PQIREDFEHYAAICFRHFGNRVKFWSTFNEPNVQVILGYRKGTYP  221



>ref|XP_010023760.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Eucalyptus grandis]
Length=496

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EGGYL   K LSNWDVF+H PG I DGSN DVA D Y+L+ ED  L+ SLGV++++F
Sbjct  47   FQIEGGYLQGNKSLSNWDVFSHMPGKIEDGSNADVADDHYNLFLEDIQLMHSLGVDAYRF  106

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+WSRVLP+GR G +N EGI++Y N+ID+LL++ I+PFVT+NHYDLPQ L+DR+  WLS
Sbjct  107  SIAWSRVLPQGRFGEVNSEGIEFYNNIIDALLVRDIKPFVTLNHYDLPQLLEDRYGSWLS  166

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++ Y A VCF   GD+V YW  FNEPN+     Y  G +P
Sbjct  167  SEIQLDFGYFAQVCFEAFGDRVTYWSIFNEPNVLIYHGYLLGTYP  211



>emb|CAB36820.1| beta-glucosidase-like protein [Arabidopsis thaliana]
 emb|CAB81283.1| beta-glucosidase-like protein [Arabidopsis thaliana]
Length=520

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT+  G I DGS+G VA D Y  Y  D DL+  LGVNS++ 
Sbjct  72   YQYEGAYLTDGKTLSNWDVFTNISGKIADGSHGKVAVDHYHRYPGDLDLMEDLGVNSYRL  131

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+ GI +Y  +I+ +L  GIEPFVT+ HYD+PQEL+ R+  WL+
Sbjct  132  SLSWARILPKGRFGDVNMGGIDHYNRMINDILKTGIEPFVTLTHYDIPQELEYRYGSWLN  191

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF H GD+VK+W TFNEPN+  I  YR G +P
Sbjct  192  PQIREDFEHYANICFRHFGDRVKFWSTFNEPNVQVILGYRTGTYP  236



>ref|XP_007149591.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 ref|XP_007149592.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21585.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21586.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=532

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGKGLSNWDVF+H PG I +  NGD+A D Y LY ED  L++SLG+N ++F
Sbjct  48   YQIEGAPLEDGKGLSNWDVFSHIPGKISNDENGDIADDHYHLYSEDIKLMSSLGINVYRF  107

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  GIK+Y  +ID+LLL+GIEPFVTI+H+DLP+EL++++ GWLS
Sbjct  108  SISWTRILPRGIYGDINPSGIKFYNKIIDNLLLRGIEPFVTIHHHDLPRELEEQYGGWLS  167

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ Y A++CF   GD++KYW T NEPN+ +   +  G +P
Sbjct  168  PLIQRDFVYFAEICFKSFGDRIKYWTTINEPNLIADFAFIRGTYP  212



>ref|XP_011652389.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=520

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKG+SNWDVF+H PG I +   GDVA D Y  + ED +L+ S+G+N+++F
Sbjct  54   YQIEGGYLEDGKGISNWDVFSHIPGKITNNDTGDVADDHYHRFLEDIELMHSMGLNAYRF  113

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GI +Y  +ID+LLLKGIEPFVTI H+D P EL+ R++ W+S
Sbjct  114  SISWTRILPRGRFGKVNKGGINFYNKIIDNLLLKGIEPFVTIYHFDYPMELERRYESWMS  173

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +MQ+++   A VCF   GD+VKYW+T NEP M +I  YR G +P
Sbjct  174  SQMQDDFVEFAKVCFEEFGDRVKYWMTINEPEMVAILGYRMGSFP  218



>ref|XP_006464710.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Citrus sinensis]
Length=523

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EG YL DGK LSNWDVF+H PGNI +  NGDVA D Y  + ED  ++ SLGVNS++F
Sbjct  57   FQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIGIMHSLGVNSYRF  116

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+L++++  WLS
Sbjct  117  SISWPRILPKGRFGKVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQLEEKYGSWLS  176

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+MQ+E+ +LA  CF + GD+VKYW T NEPN+ +   Y  G +P
Sbjct  177  PQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYP  221



>gb|EMS59801.1| putative inactive beta-glucosidase 14 [Triticum urartu]
Length=552

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            + EGGYL   KGLSNWDV+TH+ G I DGSNGD+AAD Y  Y ED +L+ SLGVNS++FS
Sbjct  79   KIEGGYLEGKKGLSNWDVYTHKQGTIEDGSNGDIAADHYHRYMEDIELMHSLGVNSYRFS  138

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            I+W+R+LP+GR G++N +G+ +Y  +I++LL KGI+PFVTI HYD+P EL++R+ GWLSP
Sbjct  139  IAWARILPRGRFGHVNPDGVAFYNAIINALLHKGIQPFVTIFHYDIPHELEERYGGWLSP  198

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            E+Q+++ Y A++CF   GD+VK+W+T N+PN+ +  +Y  G++P
Sbjct  199  EIQKDFGYFANICFKLFGDRVKFWLTMNQPNLLAKFSYLNGWFP  242



>gb|KGN59899.1| hypothetical protein Csa_3G852480 [Cucumis sativus]
Length=518

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKG+SNWDVF+H PG I +   GDVA D Y  + ED +L+ S+G+N+++F
Sbjct  52   YQIEGGYLEDGKGISNWDVFSHIPGKITNNDTGDVADDHYHRFLEDIELMHSMGLNAYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GI +Y  +ID+LLLKGIEPFVTI H+D P EL+ R++ W+S
Sbjct  112  SISWTRILPRGRFGKVNKGGINFYNKIIDNLLLKGIEPFVTIYHFDYPMELERRYESWMS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +MQ+++   A VCF   GD+VKYW+T NEP M +I  YR G +P
Sbjct  172  SQMQDDFVEFAKVCFEEFGDRVKYWMTINEPEMVAILGYRMGSFP  216



>ref|XP_010274443.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=522

 Score =   210 bits (535),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L  G+GLSNWDVF+H PG I  G N D A D Y LY +D DL+ SLG+N+++F
Sbjct  53   YQTEGAILEGGRGLSNWDVFSHVPGKIETGENADTADDHYHLYLQDIDLMHSLGINAYRF  112

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G++N  GI +Y ++ID+LL +GIEPFVT+ H+ LPQEL+DR+ GWLS
Sbjct  113  SISWARILPRGRFGDVNPTGIAFYNSIIDNLLRRGIEPFVTLYHHXLPQELEDRYGGWLS  172

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +QE++ Y A++CF   GD+VKYW + NEPN+++   Y  G +P
Sbjct  173  PLIQEDFGYFAEICFRRFGDRVKYWSSLNEPNLYAHFAYLRGMYP  217



>ref|XP_009137215.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=521

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT  PG I DGS+G VA D Y LY ED DL+  LGVNS++F
Sbjct  59   YQYEGAYLADGKTLSNWDVFTSIPGKIADGSHGKVAVDHYHLYPEDLDLMKDLGVNSYRF  118

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+L  GR G++N+EGI +Y  +I+++L KG+EPF+T+ HYD+PQEL+  +  WL 
Sbjct  119  SLSWARILLHGRFGDVNMEGIDHYNRMINAILKKGMEPFITLTHYDIPQELELIYGSWLD  178

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF H G++VK+W TFNEPN+  I  Y+ G +P
Sbjct  179  PQVREDFVHYAEICFRHFGNRVKFWTTFNEPNVQVILGYQKGTYP  223



>ref|XP_008661573.1| PREDICTED: beta-glucosidase isoform X1 [Zea mays]
 ref|XP_008661574.1| PREDICTED: beta-glucosidase isoform X1 [Zea mays]
Length=522

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVF+H PG I DGS GDVA D Y  Y++D +L+ SLG N+++F
Sbjct  51   YQIEGAYLEGNKSLSNWDVFSHVPGRIEDGSTGDVADDHYHRYEDDIELMHSLGTNAYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL-  562
            SISW+R+LP+GR G +N  GI +Y  LIDSLLLKGIEPFVT++HYD+PQEL+DR+  WL 
Sbjct  111  SISWARILPRGRFGEVNPAGIAFYNRLIDSLLLKGIEPFVTLSHYDIPQELEDRYGAWLG  170

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              E + ++ +LADVCF   GD+V++W TFNEPN+     Y  G +P
Sbjct  171  GAEARRDFGHLADVCFAAFGDRVRHWATFNEPNVAVTRGYMLGTYP  216



>ref|XP_006370302.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
 gb|ERP66871.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
Length=522

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DGKGL+NWDVF+H PGNI +  NGD+A + Y  + ED +L+ SLG N+++F
Sbjct  45   YQVEGAYIEDGKGLNNWDVFSHIPGNIKNNDNGDIADNHYYRFLEDIELMCSLGTNAYRF  104

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G+ G +N  GI +Y  LID+LL +G+EPFVTI+H+D+PQEL DR+ GWLS
Sbjct  105  SISWTRILPRGKFGQVNPRGIMFYNKLIDNLLERGLEPFVTIHHHDIPQELVDRYGGWLS  164

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQE++ Y A++CF   GD++K WIT NEPN+    +Y  G++P
Sbjct  165  PLMQEDFVYFAEICFKSFGDRIKNWITMNEPNLLVDMSYIRGWYP  209



>ref|XP_006652510.1| PREDICTED: beta-glucosidase 16-like [Oryza brachyantha]
Length=518

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL D KGL+NWDVFTH   G I DG NGD+A D Y  Y ED D+L +LGV+S++
Sbjct  47   YQIEGAYLDDNKGLNNWDVFTHTHAGKISDGGNGDIADDHYHRYTEDVDILHNLGVDSYR  106

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+RVLP GR G +N  GI +Y  LID+LL KGI+PFVT+NH+D+P EL+ RF GWL
Sbjct  107  FSISWARVLPSGRLGGVNSAGIAFYNRLIDALLQKGIQPFVTLNHFDIPHELETRFGGWL  166

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               +QEE+ Y +D+CF   GD+V++W TFNEPN+++   +  G +P
Sbjct  167  GAAIQEEFVYYSDICFRAFGDRVRFWTTFNEPNLFTRFQFVLGVYP  212



>ref|XP_010644221.1| PREDICTED: beta-glucosidase 18-like [Vitis vinifera]
 emb|CBI20347.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG +L DGK LSNWDVF+H PG I  G NGDVA D Y  Y ED +L+ SLGVN+++F
Sbjct  46   YQIEGAFLEDGKTLSNWDVFSHIPGKIERGENGDVAVDHYHRYLEDIELMHSLGVNAYRF  105

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+RVLP+GR G+IN  G+++Y  +ID LLLKGIEPFVTI+H+D+PQEL+  + G+LS
Sbjct  106  SISWARVLPRGRFGSINPAGVEFYNKIIDCLLLKGIEPFVTISHHDIPQELEHGYGGFLS  165

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q+++   A  CF + GD+VKYW TFNEPN+++   Y  G +P
Sbjct  166  PLVQDDFVLFAKTCFENYGDRVKYWTTFNEPNIYADMGYIRGVYP  210



>ref|XP_009135212.1| PREDICTED: beta-glucosidase 47 isoform X1 [Brassica rapa]
Length=528

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            QYEG YL+DGK LSNWDVFT   G I DGS+G V+ D Y  Y  D DL   LGVNS++FS
Sbjct  69   QYEGAYLTDGKALSNWDVFTSISGKIADGSHGKVSVDHYHRYPGDLDLKKDLGVNSYRFS  128

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            +SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQEL+ R+  WL+P
Sbjct  129  LSWARILPKGRFGDVNMEGINHYNRMINAILKRGMEPFVTLTHYDMPQELECRYGSWLNP  188

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            +++E++ + A++CF H G++VK+W TFNEPN+  I  YR G +P
Sbjct  189  QIREDFEHYAEICFRHFGNRVKFWTTFNEPNVQVILGYRKGTYP  232



>ref|XP_011042497.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Populus euphratica]
Length=483

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DGKGL+NWDVF+H PGNI +  NGD+A + Y  + ED +L++SLG N+++F
Sbjct  50   YQVEGAYIEDGKGLNNWDVFSHIPGNIKNNDNGDIADNHYYRFLEDIELMSSLGTNAYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G+ G +N  GI +Y  LID+LL +G+EPFVTI+H+D+PQEL DR+ GWLS
Sbjct  110  SISWARILPRGKFGQVNPRGIMFYNKLIDNLLERGMEPFVTIHHHDIPQELVDRYGGWLS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQE++ Y A+ CF   GD++K WIT NEPN+    +Y  G++P
Sbjct  170  PLMQEDFVYFAETCFKSFGDRIKNWITMNEPNLLVDMSYIRGWYP  214



>ref|XP_003541851.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=537

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y  DGKGLSNWD F+H PG I    NGD+A D Y  Y ED +L++SLGVN ++F
Sbjct  60   YQIEGAYFEDGKGLSNWDAFSHTPGKIKKDENGDIADDHYHRYLEDIELMSSLGVNVYRF  119

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  GI +Y  +ID+LLL+GIEPFVTI+HYDLPQEL++R+ GW+S
Sbjct  120  SISWARILPRGIYGDINPSGIMFYNKIIDNLLLRGIEPFVTIHHYDLPQELEERYGGWIS  179

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWS  670
            P +Q ++ + A++CF   GD+VKYW T NEPN+++
Sbjct  180  PLIQSDFVHFAEICFKSFGDRVKYWTTINEPNLFA  214



>ref|XP_010023759.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Eucalyptus grandis]
 gb|KCW60130.1| hypothetical protein EUGRSUZ_H02856 [Eucalyptus grandis]
Length=514

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            +Q EGGYL   K LSNWDVF+H PG I DGSN DVA D Y+L+ ED  L+ SLGV++++F
Sbjct  47   FQIEGGYLQGNKSLSNWDVFSHMPGKIEDGSNADVADDHYNLFLEDIQLMHSLGVDAYRF  106

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SI+WSRVLP+GR G +N EGI++Y N+ID+LL++ I+PFVT+NHYDLPQ L+DR+  WLS
Sbjct  107  SIAWSRVLPQGRFGEVNSEGIEFYNNIIDALLVRDIKPFVTLNHYDLPQLLEDRYGSWLS  166

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             E+Q ++ Y A VCF   GD+V YW  FNEPN+     Y  G +P
Sbjct  167  SEIQLDFGYFAQVCFEAFGDRVTYWSIFNEPNVLIYHGYLLGTYP  211



>ref|XP_008454668.1| PREDICTED: beta-glucosidase 18-like [Cucumis melo]
Length=519

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EGGYL DGKG+SNWDVF+H PG I++   GDVA D Y  Y ED +L+ S+G+N+++F
Sbjct  55   YQIEGGYLEDGKGISNWDVFSHTPGKIINNDTGDVADDHYHRYLEDIELMHSMGMNAYRF  114

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N  GI +Y  +ID+LLLKGIEPFVTI H+D P EL+ R++ W+S
Sbjct  115  SISWTRILPRGRLGKVNKRGINFYNKIIDNLLLKGIEPFVTIYHFDYPMELETRYESWMS  174

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +M++++   A++CF   GD+VKYW+T NEP M +I  Y+ G +P
Sbjct  175  SQMKDDFVDFANICFEEFGDRVKYWMTINEPEMVAILGYKKGNFP  219



>ref|XP_004244205.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=538

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGKGLSNWDVF+H  G I +G  GDVA D Y  ++ED +L+ S+G+NS++F
Sbjct  50   YQIEGAILEDGKGLSNWDVFSHTKGTINNGDTGDVADDHYHRFQEDVELMHSIGLNSYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+G  G +N  G+ +Y  LIDSLLL+GI  FVT+NH+D P EL+++  GWL+
Sbjct  110  SISWSRVLPRGSFGKVNFAGVTFYNELIDSLLLRGITAFVTLNHHDHPHELEEKHGGWLN  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE++Y A +CF   GD+VKYW T NEPNM++   Y  G +P
Sbjct  170  PIMQEEFSYFAKICFESFGDRVKYWTTINEPNMFAEMAYVRGVYP  214



>ref|XP_006594785.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=543

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y  DGKGLSNWD F+H PG I    NGD+A D Y  Y ED +L++SLGVN ++F
Sbjct  60   YQIEGAYFEDGKGLSNWDAFSHTPGKIKKDENGDIADDHYHRYLEDIELMSSLGVNVYRF  119

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  GI +Y  +ID+LLL+GIEPFVTI+HYDLPQEL++R+ GW+S
Sbjct  120  SISWARILPRGIYGDINPSGIMFYNKIIDNLLLRGIEPFVTIHHYDLPQELEERYGGWIS  179

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWS  670
            P +Q ++ + A++CF   GD+VKYW T NEPN+++
Sbjct  180  PLIQSDFVHFAEICFKSFGDRVKYWTTINEPNLFA  214



>ref|NP_193907.2| beta-glucosidase 47 [Arabidopsis thaliana]
 sp|Q9SVS1.2|BGL47_ARATH RecName: Full=Beta-glucosidase 47; Short=AtBGLU47; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE84500.1| beta-glucosidase 47 [Arabidopsis thaliana]
Length=535

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+DGK LSNWDVFT+  G I DGS+G VA D Y  Y  D DL+  LGVNS++ 
Sbjct  72   YQYEGAYLTDGKTLSNWDVFTNISGKIADGSHGKVAVDHYHRYPGDLDLMEDLGVNSYRL  131

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+ GI +Y  +I+ +L  GIEPFVT+ HYD+PQEL+ R+  WL+
Sbjct  132  SLSWARILPKGRFGDVNMGGIDHYNRMINDILKTGIEPFVTLTHYDIPQELEYRYGSWLN  191

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF H GD+VK+W TFNEPN+  I  YR G +P
Sbjct  192  PQIREDFEHYANICFRHFGDRVKFWSTFNEPNVQVILGYRTGTYP  236



>ref|XP_011042496.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Populus euphratica]
Length=537

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DGKGL+NWDVF+H PGNI +  NGD+A + Y  + ED +L++SLG N+++F
Sbjct  50   YQVEGAYIEDGKGLNNWDVFSHIPGNIKNNDNGDIADNHYYRFLEDIELMSSLGTNAYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G+ G +N  GI +Y  LID+LL +G+EPFVTI+H+D+PQEL DR+ GWLS
Sbjct  110  SISWARILPRGKFGQVNPRGIMFYNKLIDNLLERGMEPFVTIHHHDIPQELVDRYGGWLS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQE++ Y A+ CF   GD++K WIT NEPN+    +Y  G++P
Sbjct  170  PLMQEDFVYFAETCFKSFGDRIKNWITMNEPNLLVDMSYIRGWYP  214



>ref|XP_006653596.1| PREDICTED: beta-glucosidase 16-like, partial [Oryza brachyantha]
Length=503

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 123/166 (74%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL D KGLS WDVFTH Q G I DG NGDVA D Y  Y ED D+L +LGVNS++
Sbjct  31   YQIEGAYLEDNKGLSIWDVFTHAQAGRISDGRNGDVADDHYHRYMEDVDILHNLGVNSYR  90

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LP+GR G +N  GI +Y  LI++LL KGI+PFVT+NH+D+P ELQ R+ GWL
Sbjct  91   FSISWARILPRGRLGGVNSVGIAFYDRLINALLKKGIQPFVTLNHFDIPHELQARYGGWL  150

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y +DVCF+  GD+V++W TFNEPN+ S   +  G +P
Sbjct  151  GAGIREEFVYYSDVCFDAFGDRVRFWATFNEPNLLSKFQFMLGVYP  196



>ref|XP_006653597.1| PREDICTED: beta-glucosidase 16-like [Oryza brachyantha]
Length=448

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL D KGL+NWDVFTH Q G I DG NGDVA D Y  Y ED ++L  LGVNS++
Sbjct  44   YQIEGAYLDDNKGLNNWDVFTHSQAGRISDGRNGDVADDHYHWYTEDVEILQDLGVNSYR  103

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LP+G+ G +N  GI +Y  LID LL KGIEPFVT+NH+D+P EL+ R+ GWL
Sbjct  104  FSISWARILPRGQLGGVNPAGIAFYNRLIDVLLQKGIEPFVTLNHFDIPHELETRYGGWL  163

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               +++E+ Y +DVCF   GD+V++W TFNEPN+++   +  G +P
Sbjct  164  GAAIRDEFVYYSDVCFKAFGDRVRFWTTFNEPNLFTKFQFMLGVYP  209



>emb|CDX79092.1| BnaA01g11590D [Brassica napus]
Length=470

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG YL+ GK LSNWDVFT   G I DGS G V+ D Y  Y  D DL+  LGVNS++F
Sbjct  30   YQYEGAYLTGGKTLSNWDVFTSISGKIADGSQGKVSVDHYHRYPGDLDLMEDLGVNSYRF  89

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQEL+ R+  WL 
Sbjct  90   SLSWARILPKGRFGDVNMEGINHYNRMINAILKRGMEPFVTLTHYDMPQELECRYGSWLK  149

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P+++E++ + A++CF H G++VK+W TFNE N+  I  YR G +P
Sbjct  150  PQIREDFEHYAEICFRHFGNRVKFWTTFNESNVQVILGYRKGTYP  194



>ref|NP_001140717.1| beta-glucosidase precursor [Zea mays]
 gb|ACF84449.1| unknown [Zea mays]
 gb|AFW58838.1| beta-glucosidase [Zea mays]
Length=511

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVF+H PG I DGS GDVA D Y  Y++D +L+ SLG N+++F
Sbjct  51   YQIEGAYLEGNKSLSNWDVFSHVPGRIEDGSTGDVADDHYHRYEDDIELMHSLGTNAYRF  110

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL-  562
            SISW+R+LP+GR G +N  GI +Y  LIDSLLLKGIEPFVT++HYD+PQEL+DR+  WL 
Sbjct  111  SISWARILPRGRFGEVNPAGIAFYNRLIDSLLLKGIEPFVTLSHYDIPQELEDRYGAWLG  170

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              E + ++ +LADVCF   GD+V++W TFNEPN+     Y  G +P
Sbjct  171  GAEARRDFGHLADVCFAAFGDRVRHWATFNEPNVAVTRGYMLGTYP  216



>ref|XP_009762322.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=531

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DG+ LSNWDV+    G I +G +GD+A D Y  Y ED D +ASLGVN+++F
Sbjct  56   YQIEGAYIEDGRSLSNWDVYCRINGRIPNGGSGDIADDHYHRYLEDIDRMASLGVNAYRF  115

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N  GIK+Y N+ID+LLLKGI PFVTI+H D PQE +DR+  WLS
Sbjct  116  SISWSRILPRGRFGAVNPAGIKFYNNIIDNLLLKGITPFVTIHHDDYPQEFEDRYGAWLS  175

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF   GD+VKYW T NEPN+++   Y  G +P
Sbjct  176  PLMQEEFVHFAETCFKSFGDRVKYWATINEPNLFAEMAYLKGVFP  220



>ref|XP_011098338.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=549

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGK LSNWDVF    G+I DG NGDVA D Y  Y ED +++ SLG+ +++F
Sbjct  69   YQVEGASLEDGKSLSNWDVFCRIEGSIADGRNGDVADDHYHRYMEDIEIMHSLGLTAYRF  128

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR+G +N   + +Y ++ID+LLL+GIEPFVTI H + PQEL+DRF GWLS
Sbjct  129  SISWSRVLPRGRYGGVNQAAVSFYNSIIDNLLLRGIEPFVTIFHNEYPQELEDRFGGWLS  188

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF++  D+VKYW+T NEPN+ S  +Y    +P
Sbjct  189  PLMQEEFVHFAETCFSYFADRVKYWMTINEPNLTSEMSYERATYP  233



>gb|KEH38756.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=528

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DGKGLSNWD F+H PG I +  NGD+A D Y  Y ED  L++SLG+N ++F
Sbjct  48   YQIEGAAFEDGKGLSNWDKFSHTPGMINNDENGDIANDHYHRYLEDIKLMSSLGINVYRF  107

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+G +G+IN  G+ +Y NLID+LLL+GIEPFVTI+H+DLPQEL++R+ GWLS
Sbjct  108  SISWSRILPRGTYGDINPSGVMFYNNLIDNLLLRGIEPFVTIHHHDLPQELEERYGGWLS  167

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ + A++CF   GD+VKYW+T NEP + S   +  G +P
Sbjct  168  PLIQRDFVHFAEICFKSFGDRVKYWVTINEPTLVSDFAFIRGKYP  212



>ref|XP_004508228.1| PREDICTED: uncharacterized protein LOC101501316 [Cicer arietinum]
Length=1078

 Score =   214 bits (545),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 125/166 (75%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQ-PGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQYEG Y  DGKG SNWD FTH      +DGSNGD+A D Y  Y+ED DLL +L +NSH+
Sbjct  56   YQYEGAYNVDGKGQSNWDNFTHGGRSRTVDGSNGDIAVDHYHRYQEDIDLLEALKINSHR  115

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
             SISW+R+LPKG  G +NL GI +Y  L+D+LLLKGI+PFVT++HYD PQEL++R+ GWL
Sbjct  116  LSISWARILPKGIFGEVNLAGIDFYNKLLDALLLKGIQPFVTLSHYDSPQELEERYGGWL  175

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            SP+ Q+++++ AD+CF   GD+VKYW+TFNEPN      YR G +P
Sbjct  176  SPQSQDDFSFYADLCFKTFGDRVKYWVTFNEPNYLVPLGYRSGIYP  221



>ref|NP_001148165.1| beta-glucosidase precursor [Zea mays]
 gb|ACG29990.1| beta-glucosidase [Zea mays]
Length=510

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL   K LSNWDVF+H PG I DGS GDVA D Y  Y++D +L+ SLG N+++F
Sbjct  50   YQIEGAYLEGNKSLSNWDVFSHVPGRIEDGSTGDVADDHYHRYEDDIELMHSLGTNAYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL-  562
            SISW+R+LP+GR G +N  GI +Y  LIDSLLLKGIEPFVT++HYD+PQEL+DR+  WL 
Sbjct  110  SISWARILPRGRFGEVNPAGIAFYNRLIDSLLLKGIEPFVTLSHYDIPQELEDRYGAWLG  169

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              E + ++ +LADVCF   GD+V++W TFNEPN+     Y  G +P
Sbjct  170  GAEARRDFGHLADVCFAAFGDRVRHWATFNEPNVAVTRGYMLGTYP  215



>ref|XP_009605771.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   208 bits (529),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG Y+ DG+ LSNWDV+    G I +G +GD+A D Y  Y ED D +ASLGVN+++F
Sbjct  56   YQIEGAYIEDGRSLSNWDVYCRINGRIPNGGSGDIADDHYHRYLEDIDRMASLGVNAYRF  115

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N  GI++Y N+I +LLLKGI PFVTI+HYD PQE +DR+  WLS
Sbjct  116  SISWSRILPRGRFGAVNPAGIRFYNNIIVNLLLKGITPFVTIHHYDYPQEFEDRYGAWLS  175

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF   GD+VKYW T NEPN+++   Y  G +P
Sbjct  176  PLMQEEFVHFAETCFKSFGDRVKYWSTMNEPNLFAEMAYLKGVFP  220



>emb|CDP05879.1| unnamed protein product [Coffea canephora]
Length=559

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DG+ LSNWDVF H  GNI +G N D+A D Y  Y ED +++ SLGV+S++F
Sbjct  61   YQVEGAVHEDGRSLSNWDVFAHTKGNIENGDNADIADDHYHRYLEDIEIMHSLGVDSYRF  120

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            S+SW R+LP+G+ G++N  GI +Y  +ID+LLL+GIEPF+TI+H+DLPQEL DR+ GWLS
Sbjct  121  SVSWERILPRGKFGDVNPAGILFYNKIIDNLLLRGIEPFLTIHHHDLPQELMDRYGGWLS  180

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +QE++  LA+ CF H GD+V+YWIT NEPN+ S   Y  G +P
Sbjct  181  PLIQEDFVRLAEACFKHFGDRVRYWITINEPNLVSEFAYERGKYP  225



>ref|XP_003580124.2| PREDICTED: beta-glucosidase 16-like [Brachypodium distachyon]
Length=554

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL D K L+NWDVFTH +PG I DG NGDVA D Y  Y ED +++ +LGVNS++
Sbjct  86   YQIEGAYLEDNKSLNNWDVFTHTRPGGIRDGRNGDVADDHYHRYMEDVEIMHNLGVNSYR  145

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSR+LP+GR G +N  GI +Y  LI +LL KGIEPFVT+NH+D+P E++ R+  WL
Sbjct  146  FSISWSRILPRGRLGGVNSAGIAFYDRLIAALLQKGIEPFVTLNHFDVPHEMETRYGSWL  205

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y ADVCF   GD+VKYW TFNEPN+++   Y  G +P
Sbjct  206  GAGIREEFDYYADVCFRAFGDRVKYWTTFNEPNLFTKFAYLLGEYP  251



>ref|XP_010644220.1| PREDICTED: beta-glucosidase 18 isoform X2 [Vitis vinifera]
Length=467

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGK  +NWDVF H PG I +G  GD+A D Y  + ED +++ SLGVN+++F
Sbjct  49   YQIEGAVLEDGKSPNNWDVFCHIPGGIKNGDTGDIADDHYHQFLEDIEIIHSLGVNAYRF  108

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR G +N +G+ +Y  +ID+LLLKGIEP+VTI H+D PQEL++RF  WLS
Sbjct  109  SISWSRVLPRGRLGEVNPKGVMFYSKIIDNLLLKGIEPYVTIYHHDHPQELEERFGAWLS  168

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF + GD+VKYW T NEPN+ +   Y +G +P
Sbjct  169  PLMQEEFVHFAETCFENFGDRVKYWTTINEPNLLAEMAYLWGRYP  213



>emb|CDP05877.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = +2

Query  134  THNLEDsspspfppnfffgtssssYQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVA  313
            T  LED   S FP  F FG ++SSYQ EG  L DGKGLS+WDVF H+ GN+ +G  GD+A
Sbjct  36   TEELEDVKRSHFPGGFLFGVATSSYQIEGAILEDGKGLSDWDVFVHKNGNVENGDTGDIA  95

Query  314  ADQYDLYKEDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGI  493
             D Y  Y ED +++ SLGV++++FSISW R+LP G+ G++N  GI +Y ++ID+LL++GI
Sbjct  96   TDHYHHYMEDIEMIHSLGVDAYRFSISWPRILPNGKLGDVNAAGIMFYNSIIDNLLVRGI  155

Query  494  EPFVTINHYDLPQELQDRFQGWLSPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSI  673
             PFVTI+H DLPQ L DR+ GWLSP +Q+++ + A+ CF + GD+V+YW+T NE N+ S 
Sbjct  156  RPFVTIHHGDLPQVLHDRYGGWLSPLIQDDFVHFAETCFKNFGDRVRYWVTINEANLVSE  215

Query  674  ATYRFGFWP  700
              Y  G +P
Sbjct  216  FAYEMGIFP  224



>gb|KEH38762.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=416

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DGKGLSNWD F+H PG I +  NGD+A D Y  Y ED  L++SLG+N ++F
Sbjct  50   YQIEGAAFEDGKGLSNWDKFSHTPGMINNDENGDIANDHYHRYLEDIKLMSSLGINVYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  G+ +Y NLID+LLL+GIEPFVTI+H DLP+EL+ R+ GWLS
Sbjct  110  SISWTRILPRGIYGDINPSGVMFYNNLIDNLLLRGIEPFVTIHHQDLPEELEQRYGGWLS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ + A++CF   GD+VKYW+T NEPN+ +   +  G +P
Sbjct  170  PLIQRDFVHFAEICFKSFGDRVKYWVTINEPNLVADFGFMRGTYP  214



>ref|XP_008226673.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Prunus mume]
Length=526

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 118/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL DGK LSNWDVF H PG I    NGDVA D Y  Y ED +L+ SLG+NS++F
Sbjct  45   YQVEGAYLEDGKSLSNWDVFCHTPGTIESNENGDVADDHYHRYLEDIELMHSLGMNSYRF  104

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP G  G  N  GI +Y  LID LLLKGIEPFVT++H D+PQ L+ R  GWLS
Sbjct  105  SISWARILPDGMLGKTNPSGITFYNKLIDHLLLKGIEPFVTVHHNDMPQVLEQRDGGWLS  164

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P ++EE+A+ A +CF   GD+VKYWITFNEPN+     Y  G++P
Sbjct  165  PLLREEFAHFASICFKSFGDRVKYWITFNEPNLMIEFAYIRGWYP  209



>gb|EMS46231.1| Beta-glucosidase 16 [Triticum urartu]
Length=509

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL DGKGLSNWDVFTH Q   I DG NGDVA D Y  Y ED +++  LGVNS++
Sbjct  42   YQIEGAYLEDGKGLSNWDVFTHTQSREINDGRNGDVADDHYHRYMEDVEIMHDLGVNSYR  101

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LP+GR G +N   I +Y  LI +LL KGIEPFVT++H+DLP EL+ R+ GWL
Sbjct  102  FSISWARLLPRGRLGGVNTAAIAFYDRLIAALLEKGIEPFVTLHHFDLPHELETRYGGWL  161

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y ADVCF   GD+VK+W T NEPN+++   Y  G +P
Sbjct  162  GAGIREEFDYYADVCFKAFGDRVKFWTTLNEPNLFTKFAYMLGMYP  207



>gb|EYU26405.1| hypothetical protein MIMGU_mgv1a004080mg [Erythranthe guttata]
Length=545

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  + DGK +SNWD+F    G I DG+NGDVA D Y  Y ED +++ SLG+ +++F
Sbjct  60   YQIEGAVVEDGKSVSNWDIFCRTDGRISDGTNGDVADDHYHRYMEDIEIMHSLGLTAYRF  119

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G +N   I +Y ++ID+L+++GIEPFVTI H++ PQEL+DRF GWLS
Sbjct  120  SISWSRILPRGRFGGVNQAAIIFYNSIIDNLVVRGIEPFVTIFHHEYPQELEDRFGGWLS  179

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ +LA++CF +  D+VKYWIT NEPN++S   Y    +P
Sbjct  180  PLMQEEFVHLAEMCFKYFADRVKYWITINEPNLFSEMGYERATYP  224



>ref|XP_011098410.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=453

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGKGLSNWDV+    G I DG+ GD+A D Y  Y ED +++ SLG+ +++F
Sbjct  68   YQIEGAVLEDGKGLSNWDVYCRIKGTIADGTIGDIANDHYHRYMEDIEIMHSLGLTAYRF  127

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR G +N  GI +Y ++ID+LLL+GI+PFVTI H + PQE +DRF GWLS
Sbjct  128  SISWSRVLPRGRLGGVNQAGITFYNSIIDNLLLRGIQPFVTIFHNEYPQEFEDRFGGWLS  187

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              MQEE+ + A+ CF H  D+VKYW+T NEPN+++   Y    +P
Sbjct  188  SVMQEEFVHFAETCFKHFADRVKYWMTMNEPNVFAEMAYESAMFP  232



>gb|AIP98403.1| beta-glucosidase [Pinus sylvestris]
Length=513

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG    DGKG S WD  TH PG I D SNGDVAADQY  Y ED +L+ASLG+++++F
Sbjct  43   YQYEGAVREDGKGPSTWDALTHMPGRIKDSSNGDVAADQYHRYMEDIELMASLGLDAYRF  102

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G IN+ GI+YY NLID+LL  GI+PFVT+ H+DLP+ L+D + GWLS
Sbjct  103  SISWSRILPEGR-GEINMAGIEYYNNLIDALLQNGIQPFVTLFHFDLPKALEDSYGGWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++  ++   A++CF   GD+VKYW T NEPN++    Y  G +P
Sbjct  162  PQIINDFEAYAEICFRAFGDRVKYWATVNEPNLFVPLGYTVGIFP  206



>ref|XP_002448177.1| hypothetical protein SORBIDRAFT_06g022490 [Sorghum bicolor]
 gb|EES12505.1| hypothetical protein SORBIDRAFT_06g022490 [Sorghum bicolor]
Length=517

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL DGKGL NWDVFTH   G I+DG  GDVA D Y  Y  D ++L SLGVN+++
Sbjct  44   YQIEGAYLEDGKGLCNWDVFTHTHTGAIMDGRTGDVADDHYHRYMGDVEILQSLGVNAYR  103

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+R+LP+GR G +N  GI +Y  LID+LL KGI+PFVT+NH+D+P EL  R+ GWL
Sbjct  104  FSISWARILPRGRLGGVNAGGIAFYNRLIDALLQKGIQPFVTLNHFDMPHELDVRYVGWL  163

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               +++E+ Y ADVCF   GD+V++W TFNEPN+ +   Y  G +P
Sbjct  164  GAGIRDEFEYYADVCFAAFGDRVRFWTTFNEPNLSTKFQYMLGVYP  209



>ref|XP_011098339.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=568

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DG+  SNWDVF    G+I DG NGD+A D Y  Y ED +++ SLG+ +++F
Sbjct  87   YQIEGAVLEDGRSFSNWDVFCRIQGSIADGKNGDIAEDHYHRYMEDIEIMHSLGLTAYRF  146

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR G +N  GI +Y ++ID+LLL+GI+PFVTI H + PQE +DRF GWLS
Sbjct  147  SISWSRVLPRGRLGGVNQAGITFYNSIIDNLLLRGIQPFVTIFHNEYPQEFEDRFGGWLS  206

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF H  D+VKYW+T NEPN+++   Y    +P
Sbjct  207  PVMQEEFVHFAETCFKHFSDRVKYWMTINEPNLFAEMAYERATFP  251



>ref|XP_010644219.1| PREDICTED: beta-glucosidase 18 isoform X1 [Vitis vinifera]
 emb|CBI20346.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGK  +NWDVF H PG I +G  GD+A D Y  + ED +++ SLGVN+++F
Sbjct  49   YQIEGAVLEDGKSPNNWDVFCHIPGGIKNGDTGDIADDHYHQFLEDIEIIHSLGVNAYRF  108

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSRVLP+GR G +N +G+ +Y  +ID+LLLKGIEP+VTI H+D PQEL++RF  WLS
Sbjct  109  SISWSRVLPRGRLGEVNPKGVMFYSKIIDNLLLKGIEPYVTIYHHDHPQELEERFGAWLS  168

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P MQEE+ + A+ CF + GD+VKYW T NEPN+ +   Y +G +P
Sbjct  169  PLMQEEFVHFAETCFENFGDRVKYWTTINEPNLLAEMAYLWGRYP  213



>ref|XP_003541849.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=532

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DG G SNWDVF H PG I +  NGD+A D Y  Y ED +L++SLGVN ++F
Sbjct  50   YQIEGAPFEDGSGTSNWDVFCHTPGKINNDENGDIADDHYHRYLEDIELMSSLGVNVYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +GNIN  GI +Y  +ID+LLL+GIEPFVTI+H+D+PQEL++ + GW+S
Sbjct  110  SISWTRILPRGIYGNINPSGIMFYNKIIDNLLLRGIEPFVTIHHHDMPQELEEIYGGWIS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ + A++CF   GD+VKYW T NEPN +S   Y  G +P
Sbjct  170  PLIQRDFVHFAEICFKSFGDRVKYWTTINEPNQFSDFAYMRGIYP  214



>dbj|BAJ93784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL DGKGLSNWDVFTH Q   I DG NGDVA D Y  Y ED +++ +LGVNS++
Sbjct  42   YQIEGAYLEDGKGLSNWDVFTHTQSREINDGRNGDVADDHYHRYMEDVEIMHNLGVNSYR  101

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+RVLP+GR G +N   I +Y  LI +LL KGIEPFVT++H+DLP EL+ R  GWL
Sbjct  102  FSISWARVLPRGRLGGVNSAAIAFYNRLIAALLEKGIEPFVTLHHFDLPHELETRHGGWL  161

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y ADVCF   GD+VK+W T NEPN+++   Y  G +P
Sbjct  162  GAGIREEFGYYADVCFKAFGDRVKFWTTLNEPNLFTKFAYMLGQYP  207



>ref|XP_006594783.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=533

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DG G SNWDVF H PG I +  NGD+A D Y  Y ED +L++SLGVN ++F
Sbjct  50   YQIEGAPFEDGSGTSNWDVFCHTPGKINNDENGDIADDHYHRYLEDIELMSSLGVNVYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +GNIN  GI +Y  +ID+LLL+GIEPFVTI+H+D+PQEL++ + GW+S
Sbjct  110  SISWTRILPRGIYGNINPSGIMFYNKIIDNLLLRGIEPFVTIHHHDMPQELEEIYGGWIS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ + A++CF   GD+VKYW T NEPN +S   Y  G +P
Sbjct  170  PLIQRDFVHFAEICFKSFGDRVKYWTTINEPNQFSDFAYMRGIYP  214



>ref|XP_008453064.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=546

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            + +GG++ DG+G SNWDVF+H PG I D   GDVA D Y  + ED +L++S+G+N+++FS
Sbjct  68   RLKGGFVEDGRGKSNWDVFSHIPGKIKDNDTGDVADDHYHRFTEDIELMSSMGMNAYRFS  127

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            ISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  R+  W+S 
Sbjct  128  ISWTRILPKGRFGEVNRRGIIFYNKIIDNLLLKGIEPFVTIHHHDLPDELDKRYGSWMSS  187

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            +MQE++ Y A +CF   GD+VK+WIT NEPN+ ++  Y  G +P
Sbjct  188  QMQEDFVYFARICFEEFGDRVKHWITINEPNLVTLMAYIRGVYP  231



>dbj|BAJ92008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL DGKGLSNWDVFTH Q   I DG NGD+A D Y  Y ED +++ +LGV+S++
Sbjct  39   YQIEGAYLEDGKGLSNWDVFTHTQSRKIKDGRNGDIADDHYHRYMEDVEIMHNLGVDSYR  98

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISWSR+LP+GR G +N  GI +Y  LI  LL KGIEPFVT++H+++PQEL  R+ GWL
Sbjct  99   FSISWSRILPRGRLGGVNSAGIAFYDRLIAELLQKGIEPFVTLHHFEMPQELGTRYGGWL  158

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EE+ Y ADVCF   G++VK+W TFNEPN+++   Y  G +P
Sbjct  159  GVGIREEFGYYADVCFKAFGNRVKFWTTFNEPNLFAKLAYMLGNYP  204



>ref|XP_008661459.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW58836.1| beta-glucosidase [Zea mays]
Length=519

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 120/166 (72%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL DGKGL NWDVFTH   G ++DG  GDVA D Y  Y  D ++L SLGVN+++
Sbjct  48   YQIEGAYLEDGKGLCNWDVFTHTHSGGVMDGRTGDVADDHYHRYVGDLEILQSLGVNAYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+RVLP+GR G +N  G+ +Y  LID+LL KGI+PFVT+NH+D+P+EL+ R+ GWL
Sbjct  108  FSISWARVLPRGRVGGVNAGGVAFYNRLIDALLQKGIQPFVTLNHFDMPRELEVRYGGWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EEY + ADVCF   GD+V+ W TFNEPN+     Y  G +P
Sbjct  168  DAGIREEYEHYADVCFGAFGDRVRLWTTFNEPNLLVKFQYMLGAYP  213



>sp|Q9ZT64.1|CBG_PINCO RecName: Full=Coniferin beta-glucosidase; Flags: Precursor [Pinus 
contorta]
 gb|AAC69619.1| beta-glucosidase [Pinus contorta]
Length=513

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQYEG    DGKG S WD  TH PG I D SNGDVA DQY  Y ED +L+ASLG+++++F
Sbjct  43   YQYEGAVREDGKGPSTWDALTHMPGRIKDSSNGDVAVDQYHRYMEDIELMASLGLDAYRF  102

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISWSR+LP+GR G IN+ GI+YY NLID+LL  GI+PFVT+ H+DLP+ L+D + GWLS
Sbjct  103  SISWSRILPEGR-GEINMAGIEYYNNLIDALLQNGIQPFVTLFHFDLPKALEDSYGGWLS  161

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P++  ++   A++CF   GD+VKYW T NEPN++    Y  G +P
Sbjct  162  PQIINDFEAYAEICFRAFGDRVKYWATVNEPNLFVPLGYTVGIFP  206



>ref|XP_007214434.1| hypothetical protein PRUPE_ppa025660mg [Prunus persica]
 gb|EMJ15633.1| hypothetical protein PRUPE_ppa025660mg [Prunus persica]
Length=482

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL DGKGLSNWD FT  PG I D  NG+VA D Y+ Y ED +L+ SLG N+++F
Sbjct  44   YQVEGAYLEDGKGLSNWDFFTQIPGKIADDDNGEVADDHYNRYLEDIELMHSLGTNAYRF  103

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP G  G++N  GI +Y  LID+LL KGIEPFVTI+H DLPQ L+ R  GWLS
Sbjct  104  SISWARILPDGMLGSVNPRGIIFYNKLIDNLLSKGIEPFVTIHHNDLPQVLEQRDGGWLS  163

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P ++EE+ + A +CF   GD+VKYW+T NEPNM +   Y  G +P
Sbjct  164  PLLREEFVHFASICFESFGDRVKYWVTINEPNMVADFAYLRGLFP  208



>gb|KEH38761.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=529

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG    DGKGLSNWD F+H PG I +  NGD+A D Y  Y ED  L++SLG+N ++F
Sbjct  50   YQIEGAAFEDGKGLSNWDKFSHTPGMINNDENGDIANDHYHRYLEDIKLMSSLGINVYRF  109

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  G+ +Y NLID+LLL+GIEPFVTI+H DLP+EL+ R+ GWLS
Sbjct  110  SISWTRILPRGIYGDINPSGVMFYNNLIDNLLLRGIEPFVTIHHQDLPEELEQRYGGWLS  169

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ + A++CF   GD+VKYW+T NEPN+ +   +  G +P
Sbjct  170  PLIQRDFVHFAEICFKSFGDRVKYWVTINEPNLVADFGFMRGTYP  214



>gb|KHN36807.1| Beta-glucosidase 18 [Glycine soja]
Length=529

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  209  QYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  388
            Q EG    DG G SNWDVF+H PG I +  NGD+A D Y  Y ED +L++SLGVN ++FS
Sbjct  45   QIEGAPFEDGSGTSNWDVFSHTPGKINNDENGDIADDHYHRYLEDIELMSSLGVNVYRFS  104

Query  389  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSP  568
            ISW+R+LP+G +GNIN  GI +Y  +ID+LLL+GIEPFVTI+H+D+PQEL++ + GW+SP
Sbjct  105  ISWTRILPRGIYGNINPSGIMFYNKIIDNLLLRGIEPFVTIHHHDMPQELEEIYGGWISP  164

Query  569  EMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
             +Q ++ + A++CF   GD+VKYW T NEPN +S   Y  G +P
Sbjct  165  LIQRDFVHFAEICFKSFGDRVKYWTTINEPNQFSDFAYMRGIYP  208



>gb|KHN28049.1| Beta-glucosidase 18 [Glycine soja]
Length=529

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG  L DGKGLSNWDVF+H PGNI +  NGD+A D Y  Y ED +L++SLG+N ++F
Sbjct  47   YQIEGAPLEDGKGLSNWDVFSHIPGNINNDENGDIADDHYHRYLEDIELMSSLGINVYRF  106

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+G +G+IN  G+ +Y  +ID+LLL+GIEPFVTI+H+D P EL++R+  WLS
Sbjct  107  SISWARILPRGIYGDINPSGVMFYNKIIDNLLLRGIEPFVTIHHHDYPGELEERYGAWLS  166

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +Q ++ + A+VCF   GD+VKYW T NEPN+++   +  G +P
Sbjct  167  PLIQRDFVHFAEVCFKSFGDRVKYWATINEPNLFADMGFIRGTYP  211



>ref|XP_008226671.1| PREDICTED: beta-glucosidase 18-like [Prunus mume]
Length=533

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL DGKGLSNWD FT  PG I D  NG+VA D Y+ Y ED +L+ SLG N+++F
Sbjct  52   YQVEGAYLEDGKGLSNWDFFTQIPGKIADDDNGEVADDHYNRYLEDIELMHSLGTNAYRF  111

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP G  G++N  GI +Y  LID+L+ KGIEPFVTI+H DLPQ L+ R  GWLS
Sbjct  112  SISWARILPDGMLGSVNPRGIIFYNKLIDNLISKGIEPFVTIHHSDLPQVLEQRDGGWLS  171

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            P +++E+ + A VCF   GD+VKYW+T NEPNM +   Y  G +P
Sbjct  172  PLLRKEFVHFASVCFESFGDRVKYWVTINEPNMMAYFAYLKGLYP  216



>ref|XP_004976203.1| PREDICTED: beta-glucosidase 16-like [Setaria italica]
Length=518

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKF  385
            YQ EG YL DGK L NWDVFTH    I DG NGDVA D Y  Y  D ++L SLGVN+++F
Sbjct  46   YQIEGAYLEDGKSLCNWDVFTHTHVGIKDGRNGDVADDHYHRYMGDVEILQSLGVNAYRF  105

Query  386  SISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLS  565
            SISW+R+LP+GR G +N +GI +Y  LID+LL KGI+PFVT++H+D+P EL+ R  GWL 
Sbjct  106  SISWARILPRGRLGGVNPDGIAFYNRLIDALLQKGIQPFVTLHHFDMPHELEVRHVGWLG  165

Query  566  PEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
              ++EE+ + ADVCF   GD+V++W TFNEPN+++   Y  G +P
Sbjct  166  AGIREEFEHYADVCFRAFGDRVRFWTTFNEPNLFTKFQYMLGAYP  210



>ref|NP_001167660.1| beta-glucosidase precursor [Zea mays]
 gb|ACG25510.1| beta-glucosidase [Zea mays]
Length=519

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  YQYEGGYLSDGKGLSNWDVFTH-QPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  382
            YQ EG YL DGKGL NWDVFTH   G ++DG  GDVA D Y  Y  D ++L SLGVN+++
Sbjct  48   YQIEGAYLEDGKGLCNWDVFTHTHSGGVMDGRTGDVADDHYHRYMGDLEILQSLGVNAYR  107

Query  383  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWL  562
            FSISW+RVLP+GR G +N  G+ +Y  LID+LL KGI+PFVT+NH+D+P+EL+ R+ GWL
Sbjct  108  FSISWARVLPRGRVGGVNAGGVAFYNRLIDALLQKGIQPFVTLNHFDMPRELEVRYGGWL  167

Query  563  SPEMQEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
               ++EEY +  DVCF   GD+V+ W TFNEPN+     Y  G +P
Sbjct  168  DAGIREEYEHYPDVCFGAFGDRVRLWTTFNEPNLLVKFQYMLGAYP  213



>ref|XP_008226672.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Prunus mume]
Length=528

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 116/162 (72%), Gaps = 0/162 (0%)
 Frame = +2

Query  215  EGGYLSDGKGLSNWDVFTHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSIS  394
            EG YL DGK LSNWDVF H PG I    NGDVA D Y  Y ED +L+ SLG+NS++FSIS
Sbjct  50   EGAYLEDGKSLSNWDVFCHTPGTIESNENGDVADDHYHRYLEDIELMHSLGMNSYRFSIS  109

Query  395  WSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRFQGWLSPEM  574
            W+R+LP G  G  N  GI +Y  LID LLLKGIEPFVT++H D+PQ L+ R  GWLSP +
Sbjct  110  WARILPDGMLGKTNPSGITFYNKLIDHLLLKGIEPFVTVHHNDMPQVLEQRDGGWLSPLL  169

Query  575  QEEYAYLADVCFNHLGDKVKYWITFNEPNMWSIATYRFGFWP  700
            +EE+A+ A +CF   GD+VKYWITFNEPN+     Y  G++P
Sbjct  170  REEFAHFASICFKSFGDRVKYWITFNEPNLMIEFAYIRGWYP  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394