BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig170

Length=970
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601121.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    184   9e-51   Nicotiana tomentosiformis
ref|XP_009785267.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    184   1e-50   Nicotiana sylvestris
ref|XP_006366041.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    180   3e-49   Solanum tuberosum [potatoes]
emb|CDP05779.1|  unnamed protein product                                171   1e-45   Coffea canephora [robusta coffee]
ref|XP_004244144.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    166   9e-44   Solanum lycopersicum
ref|XP_011095359.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    164   3e-43   Sesamum indicum [beniseed]
ref|XP_012070764.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    161   4e-42   Jatropha curcas
ref|XP_012070763.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    161   5e-42   
ref|XP_011009303.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    159   3e-41   Populus euphratica
ref|XP_011009302.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    158   5e-41   Populus euphratica
ref|XP_006370658.1|  glucose-6-phosphate/phosphate-translocator p...    155   9e-40   
gb|EYU19234.1|  hypothetical protein MIMGU_mgv1a007836mg                154   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_011030834.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    152   1e-38   Populus euphratica
ref|XP_002523008.1|  Glucose-6-phosphate/phosphate translocator 1...    151   1e-38   Ricinus communis
ref|XP_004294354.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    151   2e-38   Fragaria vesca subsp. vesca
ref|XP_006377841.1|  hypothetical protein POPTR_0011s13920g             150   2e-38   
ref|XP_002316985.2|  glucose-6-phosphate/phosphate-translocator p...    150   6e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011097912.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    149   1e-37   Sesamum indicum [beniseed]
ref|XP_007213874.1|  hypothetical protein PRUPE_ppa006795mg             147   7e-37   Prunus persica
ref|XP_011660235.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    145   3e-36   Cucumis sativus [cucumbers]
ref|XP_008454525.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    144   8e-36   
ref|XP_008226825.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    144   1e-35   Prunus mume [ume]
gb|KDO50251.1|  hypothetical protein CISIN_1g0163482mg                  139   2e-35   Citrus sinensis [apfelsine]
ref|XP_008463436.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    143   2e-35   Cucumis melo [Oriental melon]
gb|ACJ84766.1|  unknown                                                 137   5e-35   Medicago truncatula
gb|EPS72032.1|  glucose-6-phosphate/phosphate translocator 1, chl...    140   7e-35   Genlisea aurea
ref|XP_004152937.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    141   1e-34   Cucumis sativus [cucumbers]
gb|KCW67182.1|  hypothetical protein EUGRSUZ_F00969                     138   2e-34   Eucalyptus grandis [rose gum]
ref|XP_009342585.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    140   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_006452222.1|  hypothetical protein CICLE_v10008564mg             140   2e-34   Citrus clementina [clementine]
ref|XP_009358127.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    140   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_006493943.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    139   5e-34   Citrus sinensis [apfelsine]
ref|XP_010060420.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    139   7e-34   Eucalyptus grandis [rose gum]
ref|XP_003599946.1|  Glucose-6-phosphate/phosphate-translocator         138   1e-33   Medicago truncatula
ref|XP_008365529.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    138   1e-33   
ref|XP_004500037.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    137   2e-33   
ref|XP_004500035.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    137   3e-33   
gb|KJB81792.1|  hypothetical protein B456_013G161500                    135   7e-33   Gossypium raimondii
gb|KHM99601.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    135   1e-32   Glycine soja [wild soybean]
ref|XP_007146406.1|  hypothetical protein PHAVU_006G037800g             135   1e-32   Phaseolus vulgaris [French bean]
ref|XP_007020963.1|  Glucose 6-phosphate/phosphate translocator 1...    135   2e-32   Theobroma cacao [chocolate]
gb|KJB81793.1|  hypothetical protein B456_013G161500                    135   2e-32   Gossypium raimondii
ref|XP_003551900.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    133   5e-32   Glycine max [soybeans]
gb|KHG04645.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    134   5e-32   Gossypium arboreum [tree cotton]
gb|AAX47109.1|  putative plastid glucose 6 phosphate/phosphate tr...    133   9e-32   Glycine max [soybeans]
ref|XP_010276000.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    132   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_009378791.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    132   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_003519000.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    132   2e-31   
gb|AAC08525.1|  glucose-6-phosphate/phosphate-translocator precursor    130   6e-31   Pisum sativum [garden pea]
ref|XP_003545023.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    130   8e-31   Glycine max [soybeans]
ref|XP_010267729.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    130   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_004491386.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    127   9e-30   Cicer arietinum [garbanzo]
gb|KJB13621.1|  hypothetical protein B456_002G085200                    127   1e-29   Gossypium raimondii
gb|KHN38297.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    127   1e-29   Glycine soja [wild soybean]
ref|XP_003519563.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    127   1e-29   Glycine max [soybeans]
gb|KHG14046.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    126   1e-29   Gossypium arboreum [tree cotton]
ref|XP_010931815.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    126   2e-29   Elaeis guineensis
ref|XP_002281493.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    125   3e-29   Vitis vinifera
gb|KHG27528.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    125   4e-29   Gossypium arboreum [tree cotton]
gb|KJB62604.1|  hypothetical protein B456_009G425600                    125   4e-29   Gossypium raimondii
ref|XP_008784551.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    125   4e-29   Phoenix dactylifera
gb|KJB62603.1|  hypothetical protein B456_009G425600                    125   4e-29   Gossypium raimondii
ref|XP_010694203.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    125   5e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009408271.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    125   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD91175.1|  plastidic glucose 6-phoaphate/phosphate transloc...    125   6e-29   Mesembryanthemum crystallinum
ref|XP_003610399.1|  Glucose-6-phosphate/phosphate translocator         127   2e-28   
ref|XP_008385998.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    123   2e-28   
gb|AES92596.2|  glucose 6-phosphate/phosphate translocator 1            127   2e-28   Medicago truncatula
ref|XP_010665533.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    122   6e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002518517.1|  Glucose-6-phosphate/phosphate translocator 2...    122   8e-28   Ricinus communis
ref|XP_007153924.1|  hypothetical protein PHAVU_003G076600g             121   9e-28   Phaseolus vulgaris [French bean]
ref|XP_011628432.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    121   9e-28   Amborella trichopoda
gb|ERN19519.1|  hypothetical protein AMTR_s00062p00036220               121   1e-27   Amborella trichopoda
ref|XP_007142250.1|  hypothetical protein PHAVU_008G265100g             121   1e-27   Phaseolus vulgaris [French bean]
ref|XP_009617374.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    121   1e-27   Nicotiana tomentosiformis
ref|XP_004293269.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    121   1e-27   Fragaria vesca subsp. vesca
ref|XP_002864355.1|  glucose-6-phosphate transporter 1                  120   2e-27   Arabidopsis lyrata subsp. lyrata
emb|CDY06630.1|  BnaC02g13540D                                          120   2e-27   
ref|XP_006600314.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    120   3e-27   Glycine max [soybeans]
ref|XP_009412013.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    120   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012091392.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    119   5e-27   Jatropha curcas
ref|XP_009420544.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    119   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG03254.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    119   5e-27   Gossypium arboreum [tree cotton]
gb|KHN03459.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    120   6e-27   Glycine soja [wild soybean]
gb|AAF86908.1|AF223360_1  glucose-6P/phosphate translocator precu...    119   6e-27   Mesembryanthemum crystallinum
emb|CDP11791.1|  unnamed protein product                                119   8e-27   Coffea canephora [robusta coffee]
ref|XP_010092109.1|  Glucose-6-phosphate/phosphate translocator 1       119   9e-27   
ref|XP_010538047.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    118   1e-26   Tarenaya hassleriana [spider flower]
gb|AAM63660.1|  glucose-6-phosphate/phosphate translocator              118   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AJV90961.1|  GPT2-b                                                  115   2e-26   Vitis vinifera
gb|KHN33046.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    117   2e-26   Glycine soja [wild soybean]
ref|XP_006594434.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    117   3e-26   Glycine max [soybeans]
ref|XP_006401535.1|  hypothetical protein EUTSA_v10013772mg             117   3e-26   Eutrema salsugineum [saltwater cress]
dbj|BAB08759.1|  glucose-6-phosphate/phosphate translocator             117   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568812.1|  glucose-6-phosphate/phosphate translocator 1          117   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266056.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    117   3e-26   Vitis vinifera
ref|XP_009589013.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    117   3e-26   Nicotiana tomentosiformis
gb|KJB67150.1|  hypothetical protein B456_010G178300                    117   4e-26   Gossypium raimondii
gb|KJB67151.1|  hypothetical protein B456_010G178300                    116   4e-26   Gossypium raimondii
gb|KEH36805.1|  glucose-6-phosphate/phosphate translocator-like p...    116   4e-26   Medicago truncatula
gb|AJV90962.1|  GPT2-c                                                  116   6e-26   Vitis vinifera
gb|EYU24788.1|  hypothetical protein MIMGU_mgv1a007856mg                115   8e-26   Erythranthe guttata [common monkey flower]
ref|XP_007026011.1|  Glucose-6-phosphate/phosphate translocator 2       115   1e-25   
emb|CAN68645.1|  hypothetical protein VITISV_030812                     115   1e-25   Vitis vinifera
gb|KFK27093.1|  hypothetical protein AALP_AA8G333200                    115   1e-25   Arabis alpina [alpine rockcress]
ref|XP_009105258.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    115   1e-25   Brassica rapa
ref|XP_009794775.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    113   2e-25   Nicotiana sylvestris
ref|XP_009802193.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    114   2e-25   Nicotiana sylvestris
ref|XP_006449070.1|  hypothetical protein CICLE_v10015210mg             114   2e-25   
gb|KDO75519.1|  hypothetical protein CISIN_1g039814mg                   114   3e-25   Citrus sinensis [apfelsine]
ref|XP_009397167.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    114   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006449072.1|  hypothetical protein CICLE_v10015210mg             114   3e-25   
ref|XP_003547247.2|  PREDICTED: beta-glucosidase 47-like                116   5e-25   Glycine max [soybeans]
ref|XP_008778019.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    113   5e-25   Phoenix dactylifera
emb|CDY43022.1|  BnaA03g11690D                                          113   5e-25   Brassica napus [oilseed rape]
ref|XP_004486132.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    113   5e-25   Cicer arietinum [garbanzo]
ref|XP_006449073.1|  hypothetical protein CICLE_v10015210mg             114   5e-25   
ref|XP_007026012.1|  Glucose-6-phosphate/phosphate translocator 2...    112   1e-24   
gb|ACV60359.1|  putative glucose-6-phosphate/phosphate translocator     112   1e-24   Camellia sinensis [black tea]
ref|XP_007026013.1|  Glucose-6-phosphate/phosphate translocator 2...    112   1e-24   
ref|XP_006279646.1|  hypothetical protein CARUB_v10026569mg             112   1e-24   Capsella rubella
ref|XP_002888066.1|  glucose-6-phosphate/phosphate translocator 2       111   2e-24   
emb|CDY52572.1|  BnaC03g71800D                                          112   2e-24   Brassica napus [oilseed rape]
emb|CDY55220.1|  BnaA01g36280D                                          111   2e-24   Brassica napus [oilseed rape]
ref|XP_010475728.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    111   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009132423.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    110   5e-24   Brassica rapa
gb|KFK40647.1|  hypothetical protein AALP_AA2G023600                    109   9e-24   Arabis alpina [alpine rockcress]
emb|CDY19859.1|  BnaC09g31250D                                          109   1e-23   Brassica napus [oilseed rape]
ref|XP_010443058.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    109   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009357419.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    109   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_009340951.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    109   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_010482887.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    109   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008439971.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    109   1e-23   Cucumis melo [Oriental melon]
ref|XP_008224795.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    108   2e-23   Prunus mume [ume]
ref|XP_007211968.1|  hypothetical protein PRUPE_ppa006608mg             108   4e-23   
gb|KCW75358.1|  hypothetical protein EUGRSUZ_E04104                     107   4e-23   Eucalyptus grandis [rose gum]
ref|XP_009120008.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    107   5e-23   Brassica rapa
ref|XP_007147746.1|  hypothetical protein PHAVU_006G151500g             107   5e-23   Phaseolus vulgaris [French bean]
emb|CDY17274.1|  BnaA10g09080D                                          107   5e-23   Brassica napus [oilseed rape]
gb|KHN37588.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    107   6e-23   Glycine soja [wild soybean]
ref|XP_006302377.1|  hypothetical protein CARUB_v10020443mg             107   6e-23   Capsella rubella
ref|XP_009765173.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    109   7e-23   Nicotiana sylvestris
ref|XP_008384044.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    107   8e-23   
ref|XP_008384045.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    107   9e-23   
gb|KJB45582.1|  hypothetical protein B456_007G313700                    106   1e-22   Gossypium raimondii
gb|KJB45583.1|  hypothetical protein B456_007G313700                    106   1e-22   Gossypium raimondii
ref|XP_010533829.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    106   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_010042185.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    106   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010041822.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    105   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010473399.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    105   2e-22   Camelina sativa [gold-of-pleasure]
ref|NP_564785.1|  glucose-6-phosphate/phosphate translocator 2          105   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68814.1|  Similar to glucose-6-phosphate/phosphate-transloc...    105   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28500.1|  Similar to glucose-6-phosphate/phosphate-transloc...    105   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430199.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    105   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006367280.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    105   4e-22   Solanum tuberosum [potatoes]
ref|XP_007020964.1|  Glucose-6-phosphate/phosphate translocator 2...    103   5e-22   
ref|XP_006654288.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    104   5e-22   Oryza brachyantha
emb|CDY25324.1|  BnaC01g29930D                                          104   6e-22   Brassica napus [oilseed rape]
ref|XP_010418155.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    104   6e-22   Camelina sativa [gold-of-pleasure]
gb|AAY85658.1|  plastid glucose-6-phosphate/phosphate translocato...    103   8e-22   Helianthus annuus
ref|XP_006383937.1|  hypothetical protein POPTR_0004s01930g             103   9e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002305598.2|  hypothetical protein POPTR_0004s01930g             103   1e-21   
ref|XP_011037695.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    103   1e-21   Populus euphratica
gb|AIR93781.1|  glucose 6-phosphate phosphate translocator              103   2e-21   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_006417337.1|  hypothetical protein EUTSA_v10007876mg             103   2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006417336.1|  hypothetical protein EUTSA_v10007876mg             102   2e-21   Eutrema salsugineum [saltwater cress]
gb|ABJ98060.1|  glucose 6-Pi/Pi transporter                             102   2e-21   Eutrema halophilum
ref|XP_010476089.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    102   5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004134753.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    101   5e-21   Cucumis sativus [cucumbers]
ref|XP_004240145.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    101   8e-21   Solanum lycopersicum
ref|XP_006356920.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    101   9e-21   Solanum tuberosum [potatoes]
gb|AAC08526.1|  glucose-6-phosphate/phosphate-translocator precursor    100   9e-21   Solanum tuberosum [potatoes]
ref|XP_009127064.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    100   1e-20   Brassica rapa
ref|XP_009619233.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    100   1e-20   Nicotiana tomentosiformis
ref|XP_006659185.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    100   1e-20   Oryza brachyantha
ref|XP_010930664.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    100   1e-20   Elaeis guineensis
ref|XP_009417236.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    100   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010493043.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    100   2e-20   Camelina sativa [gold-of-pleasure]
gb|AFW56904.1|  glucose-6-phosphate/phosphate translocator 2Gluco...  99.8    3e-20   
ref|NP_001105604.1|  glucose-6-phosphate/phosphate-translocator p...  99.4    3e-20   Zea mays [maize]
gb|ACN36392.1|  unknown                                               99.4    3e-20   Zea mays [maize]
gb|ABK91089.1|  putative glucose-6-phosphate translocator             99.0    3e-20   Sorghum bicolor [broomcorn]
emb|CDY28750.1|  BnaA02g09420D                                          100   3e-20   Brassica napus [oilseed rape]
emb|CDY34641.1|  BnaC08g42000D                                        99.0    3e-20   Brassica napus [oilseed rape]
ref|XP_010545200.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  99.4    3e-20   Tarenaya hassleriana [spider flower]
gb|ABK91085.1|  putative glucose-6-phosphate translocator             99.0    4e-20   Sorghum bicolor [broomcorn]
ref|XP_002443966.1|  hypothetical protein SORBIDRAFT_07g005200        99.0    4e-20   Sorghum bicolor [broomcorn]
gb|ABK91084.1|  putative glucose-6-phosphate translocator             99.0    4e-20   Sorghum bicolor [broomcorn]
gb|ABK91093.1|  putative glucose-6-phosphate translocator             99.0    4e-20   Sorghum bicolor [broomcorn]
gb|ABK91091.1|  putative glucose-6-phosphate translocator             99.0    5e-20   Sorghum bicolor [broomcorn]
gb|ABK91097.1|  putative glucose-6-phosphate translocator             99.0    5e-20   Sorghum bicolor [broomcorn]
gb|ABK91102.1|  putative glucose-6-phosphate translocator             99.0    5e-20   Sorghum bicolor [broomcorn]
ref|XP_002462940.1|  hypothetical protein SORBIDRAFT_02g034980        98.6    6e-20   
ref|XP_006391961.1|  hypothetical protein EUTSA_v10023518mg           98.6    6e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006391960.1|  hypothetical protein EUTSA_v10023518mg           98.2    6e-20   
ref|XP_006307580.1|  hypothetical protein CARUB_v10009203mg           99.0    7e-20   
ref|XP_006343413.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  98.2    7e-20   Solanum tuberosum [potatoes]
ref|XP_010317737.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  97.8    9e-20   Solanum lycopersicum
ref|XP_010458564.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  98.2    9e-20   Camelina sativa [gold-of-pleasure]
gb|ABK91082.1|  putative glucose-6-phosphate translocator             97.8    1e-19   Sorghum bicolor [broomcorn]
ref|XP_004957888.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  97.4    1e-19   
gb|ABK91094.1|  putative glucose-6-phosphate translocator             97.4    1e-19   Sorghum bicolor [broomcorn]
ref|XP_008667831.1|  PREDICTED: uncharacterized protein LOC100279...  97.4    1e-19   Zea mays [maize]
ref|XP_002889879.1|  predicted protein                                97.4    2e-19   
ref|XP_004957889.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  97.1    2e-19   
gb|ABO87607.1|  chloroplast glucose-6-phosphate/phosphate translo...  96.3    3e-19   Pisum sativum [garden pea]
gb|KFK31943.1|  hypothetical protein AALP_AA6G180100                  95.1    1e-18   Arabis alpina [alpine rockcress]
ref|XP_004972694.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  95.1    1e-18   Setaria italica
ref|NP_001147439.1|  glucose-6-phosphate/phosphate translocator 2     95.1    1e-18   
ref|XP_008812143.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  94.7    2e-18   Phoenix dactylifera
tpg|DAA62951.1|  TPA: glucose-6-phosphate/phosphate translocator 2    93.6    4e-18   
gb|ABC95747.1|  glucose-6-phosphate/phosphate translocator            90.1    7e-18   Hordeum vulgare [barley]
gb|AIR93780.1|  glucose 6-phosphate phosphate translocator            92.0    1e-17   Kalanchoe fedtschenkoi [lavender-scallops]
ref|NP_001061152.1|  Os08g0187800                                     92.0    1e-17   
ref|XP_003573402.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  91.7    2e-17   Brachypodium distachyon [annual false brome]
gb|EEC83014.1|  hypothetical protein OsI_28073                        91.7    2e-17   Oryza sativa Indica Group [Indian rice]
gb|AAK54618.1|AF375053_1  glucose-6-phosphate/phosphate translocator  91.3    2e-17   Oryza sativa [red rice]
ref|XP_010229653.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  91.7    4e-17   
dbj|BAJ93997.1|  predicted protein                                    90.5    4e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABC95693.1|  glucose-6-phosphate/phosphate translocator            87.4    5e-17   Triticum dicoccoides [wild emmer wheat]
ref|XP_001778585.1|  predicted protein                                89.4    5e-17   
gb|ABC95740.1|  glucose-6-phosphate/phosphate translocator            87.4    5e-17   Aegilops longissima
gb|ABC95648.1|  glucose-6-phosphate/phosphate translocator            87.4    5e-17   Triticum monococcum [einkorn wheat]
ref|XP_002984083.1|  hypothetical protein SELMODRAFT_45116            89.0    6e-17   
gb|ABC95650.1|  glucose-6-phosphate/phosphate translocator            87.0    7e-17   Triticum urartu
gb|ABD47369.1|  glucose-6-phosphate/phosphate translocator            87.0    7e-17   Triticum timopheevii subsp. araraticum
ref|XP_002960055.1|  hypothetical protein SELMODRAFT_70870            89.0    7e-17   
gb|ABC95667.1|  glucose-6-phosphate/phosphate translocator            86.7    1e-16   Triticum dicoccoides [wild emmer wheat]
gb|ABC95653.1|  glucose-6-phosphate/phosphate translocator            86.7    1e-16   Triticum dicoccoides [wild emmer wheat]
gb|ABC95689.1|  glucose-6-phosphate/phosphate translocator            86.7    1e-16   Triticum dicoccoides [wild emmer wheat]
gb|ACG36927.1|  glucose-6-phosphate/phosphate translocator 2          89.0    1e-16   Zea mays [maize]
gb|EPS63359.1|  hypothetical protein M569_11424                       88.2    1e-16   Genlisea aurea
ref|XP_001775355.1|  predicted protein                                88.6    1e-16   
gb|ABC95675.1|  glucose-6-phosphate/phosphate translocator            86.3    1e-16   Triticum dicoccoides [wild emmer wheat]
ref|XP_001764779.1|  predicted protein                                87.4    2e-16   
ref|NP_001131942.1|  uncharacterized protein LOC100193334             88.6    2e-16   Zea mays [maize]
gb|ABC95746.1|  glucose-6-phosphate/phosphate translocator            85.5    2e-16   Aegilops tauschii
ref|XP_006657775.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  87.0    3e-16   Oryza brachyantha
gb|AAP80864.1|  glucose-6-phosphate/phosphate translocator            87.8    3e-16   Triticum aestivum [Canadian hard winter wheat]
gb|AFW61083.1|  glucose-6-phosphate/phosphate translocator 2          88.2    4e-16   
gb|EMS53161.1|  Glucose-6-phosphate/phosphate translocator 1, chl...  87.8    7e-16   Triticum urartu
gb|KHN03064.1|  Glucose-6-phosphate/phosphate translocator 1, chl...  84.0    2e-15   Glycine soja [wild soybean]
ref|XP_002960052.1|  hypothetical protein SELMODRAFT_270155           85.5    2e-15   Selaginella moellendorffii
ref|XP_002984086.1|  hypothetical protein SELMODRAFT_156336           85.5    2e-15   Selaginella moellendorffii
gb|EMT25193.1|  Glucose-6-phosphate/phosphate translocator 1, chl...  85.9    3e-15   
ref|XP_001755644.1|  predicted protein                                82.4    1e-14   
gb|EMT13790.1|  Glucose-6-phosphate/phosphate translocator 2, chl...  80.9    1e-13   
dbj|BAG91782.1|  unnamed protein product                              79.0    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ACN40020.1|  unknown                                               79.0    3e-13   Picea sitchensis
gb|ABK24716.1|  unknown                                               79.3    4e-13   Picea sitchensis
gb|EEE67296.1|  hypothetical protein OsJ_24501                        78.2    1e-12   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC57673.1|  putative glucose-6-phosphate/phosphate- transloc...  77.8    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82167.1|  hypothetical protein OsI_26253                        77.8    1e-12   Oryza sativa Indica Group [Indian rice]
gb|EEC82168.1|  hypothetical protein OsI_26255                        77.4    2e-12   Oryza sativa Indica Group [Indian rice]
gb|AEJ36128.1|  triosephosphate translocator                          70.9    9e-12   Trifolium repens [creeping white clover]
gb|AEJ36127.1|  triosephosphate translocator                          68.6    6e-11   Trigonella kotschyi
gb|ABY82455.1|  triosephosphate translocator                          67.8    1e-10   Galega orientalis
gb|AEJ36123.1|  triosephosphate translocator                          66.6    3e-10   Medicago lanigera
gb|AEJ36124.1|  triosephosphate translocator                          66.6    3e-10   Medicago monantha
gb|AEJ36113.1|  triosephosphate translocator                          64.7    1e-09   Peteria thompsoniae
gb|AEJ36125.1|  triosephosphate translocator                          64.7    2e-09   Medicago arabica
gb|AEJ36115.1|  triosephosphate translocator                          64.7    2e-09   Wisteria floribunda [Japanese wistaria]
ref|XP_001751511.1|  predicted protein                                67.8    2e-09   
ref|XP_002965611.1|  hypothetical protein SELMODRAFT_83926            68.2    3e-09   
ref|XP_003545984.2|  PREDICTED: xylulose 5-phosphate/phosphate tr...  68.2    3e-09   Glycine max [soybeans]
ref|XP_002962396.1|  hypothetical protein SELMODRAFT_79231            67.8    3e-09   
gb|ABY82451.1|  triosephosphate translocator                          63.9    3e-09   Vicia faba [broad bean]
gb|ABY82437.1|  triosephosphate translocator                          63.5    4e-09   Caragana arborescens [Siberian peashrub]
gb|ABY82435.1|  triosephosphate translocator                          63.2    5e-09   Olneya tesota [desert ironwood]
gb|AEJ36114.1|  triosephosphate translocator                          63.2    5e-09   Coursetia glandulosa
gb|ABS58595.1|  glucose-6-phosphate/phosphate translocator            63.5    9e-09   Scutellaria baicalensis [Baikal skullcap]
gb|KHN45092.1|  Xylulose 5-phosphate/phosphate translocator, chlo...  66.2    1e-08   Glycine soja [wild soybean]
ref|NP_192304.2|  Nucleotide/sugar transporter family protein         65.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28223.1|  similar to chloroplast triose phosphate transloca...  64.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AEJ36129.1|  triosephosphate translocator                          62.4    1e-08   Cicer arietinum [garbanzo]
gb|AEJ36126.1|  triosephosphate translocator                          62.0    1e-08   Trigonella foenum-graecum [fenugreek]
gb|AEJ36116.1|  triosephosphate translocator                          61.6    2e-08   Astragalus nothoxys
ref|XP_002523987.1|  Glucose-6-phosphate/phosphate translocator 1...  65.1    2e-08   Ricinus communis
gb|ABY82440.1|  triosephosphate translocator                          61.2    2e-08   Alhagi maurorum [camel thorn]
gb|ABY82434.1|  triosephosphate translocator                          61.2    2e-08   
gb|AEJ36100.1|  triosephosphate translocator                          61.2    3e-08   
gb|AGN29537.1|  triosephosphate translocator                          61.2    3e-08   
gb|ABY82439.1|  triosephosphate translocator                          60.5    4e-08   
gb|AGN29548.1|  triosephosphate translocator                          60.1    7e-08   
gb|ABY82442.1|  triosephosphate translocator                          60.1    8e-08   
gb|AGN29545.1|  triosephosphate translocator                          59.7    1e-07   
gb|AEJ36122.1|  triosephosphate translocator                          59.7    1e-07   
gb|AEJ36120.1|  triosephosphate translocator                          59.3    1e-07   
gb|AGN29544.1|  triosephosphate translocator                          59.3    1e-07   
gb|ABY82436.1|  triosephosphate translocator                          59.3    1e-07   
gb|ABY82431.1|  triosephosphate translocator                          58.9    2e-07   
gb|AEJ36102.1|  triosephosphate translocator                          58.2    3e-07   
ref|XP_002319749.2|  hypothetical protein POPTR_0013s06910g           61.6    3e-07   
gb|ABY82444.1|  triosephosphate translocator                          58.2    3e-07   
gb|ABY82453.1|  triosephosphate translocator                          58.2    3e-07   
gb|AEJ36106.1|  triosephosphate translocator                          58.2    4e-07   
gb|AGN29554.1|  triosephosphate translocator                          57.8    4e-07   
gb|AEJ36121.1|  triosephosphate translocator                          57.8    4e-07   
gb|AEJ36111.1|  triosephosphate translocator                          57.8    5e-07   
gb|AGN29541.1|  triosephosphate translocator                          57.8    5e-07   
gb|ABO87612.1|  chloroplast pentose phosphate transporter             60.8    5e-07   
ref|XP_008379228.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  60.8    5e-07   
gb|AEJ36118.1|  triosephosphate translocator                          57.4    5e-07   
gb|AGN29552.1|  triosephosphate translocator                          57.4    6e-07   
gb|AEJ36107.1|  triosephosphate translocator                          57.4    6e-07   
gb|AGN29553.1|  triosephosphate translocator                          57.4    6e-07   
gb|AGN29542.1|  triosephosphate translocator                          57.4    7e-07   
gb|ABY82443.1|  triosephosphate translocator                          57.0    7e-07   
gb|ABY82433.1|  triosephosphate translocator                          57.4    7e-07   
ref|XP_007020965.1|  Uncharacterized protein TCM_030979               56.2    9e-07   
ref|XP_011004949.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  60.5    9e-07   
ref|XP_002264736.2|  PREDICTED: xylulose 5-phosphate/phosphate tr...  60.1    1e-06   
ref|XP_011029327.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  60.1    1e-06   
gb|AEJ36119.1|  triosephosphate translocator                          56.6    1e-06   
gb|AGN29560.1|  triosephosphate translocator                          56.6    1e-06   
gb|AEJ36110.1|  triosephosphate translocator                          56.2    2e-06   
gb|AGN29555.1|  triosephosphate translocator                          56.2    2e-06   
gb|KFK25984.1|  hypothetical protein AALP_AA8G188000                  59.3    2e-06   
gb|AGN29551.1|  triosephosphate translocator                          55.8    2e-06   
gb|AGN29558.1|  triosephosphate translocator                          55.5    3e-06   
ref|XP_003537155.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  58.9    3e-06   
gb|KHN13446.1|  Xylulose 5-phosphate/phosphate translocator, chlo...  58.9    3e-06   
gb|AEJ36103.1|  triosephosphate translocator                          55.5    3e-06   
gb|EJK73151.1|  hypothetical protein THAOC_05244                      58.5    3e-06   
ref|XP_004304638.2|  PREDICTED: phosphoenolpyruvate/phosphate tra...  58.5    3e-06   
gb|EJK60971.1|  hypothetical protein THAOC_18603                      58.5    3e-06   
gb|AEJ36104.1|  triosephosphate translocator                          55.5    3e-06   
gb|KHN23517.1|  Phosphoenolpyruvate/phosphate translocator 2, chl...  58.5    3e-06   
ref|XP_010097682.1|  Xylulose 5-phosphate/phosphate translocator      58.2    4e-06   
gb|AEJ36108.1|  triosephosphate translocator                          55.1    4e-06   
gb|AGN29557.1|  triosephosphate translocator                          55.1    4e-06   
ref|XP_008356880.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  58.2    5e-06   
ref|XP_008347069.1|  PREDICTED: LOW QUALITY PROTEIN: xylulose 5-p...  58.2    5e-06   
ref|XP_002298531.2|  hypothetical protein POPTR_0001s35130g           58.2    5e-06   
ref|XP_001785209.1|  predicted protein                                58.2    5e-06   
ref|NP_001242209.1|  uncharacterized protein LOC100819280             57.8    5e-06   
gb|AEJ36101.1|  triosephosphate translocator                          54.7    5e-06   
ref|XP_002523986.1|  Glucose-6-phosphate/phosphate translocator 2...  57.8    6e-06   
ref|XP_006437350.1|  hypothetical protein CICLE_v10031652mg           57.8    6e-06   
gb|ABY82448.1|  triosephosphate translocator                          54.3    7e-06   
ref|XP_003078079.1|  Glucose-6-phosphate/phosphate and phosphoeno...  57.4    7e-06   
ref|XP_007512721.1|  predicted protein                                57.4    9e-06   
ref|XP_008232176.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  57.4    9e-06   
ref|XP_010674963.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  57.0    9e-06   
gb|AGN29559.1|  triosephosphate translocator                          53.9    9e-06   
ref|XP_006484740.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  57.0    1e-05   
ref|XP_005707012.1|  sugar-phosphate:phosphate translocator, DMT ...  56.6    1e-05   
gb|AES97013.2|  triose phosphate/phosphate translocator               56.6    1e-05   
ref|XP_004307178.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  56.6    1e-05   
ref|XP_004486439.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  56.6    1e-05   
dbj|BAJ98228.1|  predicted protein                                    56.2    2e-05   
ref|XP_009335044.1|  PREDICTED: LOW QUALITY PROTEIN: xylulose 5-p...  56.6    2e-05   
ref|XP_002282424.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  56.2    2e-05   
gb|ABY82449.1|  triosephosphate translocator                          53.1    2e-05   
ref|XP_004497714.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  56.2    2e-05   
ref|XP_004489250.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  55.8    2e-05   
ref|XP_009334107.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  55.8    2e-05   
ref|XP_007219467.1|  hypothetical protein PRUPE_ppa021368mg           56.2    2e-05   
ref|XP_009348960.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  55.8    2e-05   
ref|XP_009759570.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  55.8    2e-05   
ref|XP_010492724.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  55.8    2e-05   
ref|XP_011097424.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  55.5    3e-05   
ref|XP_008438208.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  55.5    3e-05   
ref|XP_007031528.1|  Phosphoenolpyruvate/phosphate translocator 2...  55.5    3e-05   
emb|CDP11321.1|  unnamed protein product                              55.5    3e-05   
ref|XP_011047340.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  55.5    3e-05   
ref|XP_011047342.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  55.5    3e-05   
ref|XP_011047341.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  55.5    3e-05   
ref|XP_009630413.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  55.5    3e-05   
ref|XP_007031527.1|  Phosphoenolpyruvate/phosphate translocator 2...  55.5    4e-05   
ref|XP_002871776.1|  hypothetical protein ARALYDRAFT_909761           55.5    4e-05   
gb|KJB75889.1|  hypothetical protein B456_012G063100                  55.1    4e-05   
gb|KJB75891.1|  hypothetical protein B456_012G063100                  55.1    4e-05   
ref|XP_006854238.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  55.1    4e-05   
gb|KJB75888.1|  hypothetical protein B456_012G063100                  55.1    4e-05   
gb|AEJ36112.1|  triosephosphate translocator                          52.4    4e-05   
gb|ABY82438.1|  triosephosphate translocator                          52.0    4e-05   
ref|XP_010033295.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  55.1    5e-05   
ref|XP_010549739.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  55.1    5e-05   
ref|XP_010033296.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  54.7    5e-05   
emb|CEG01787.1|  Triose-phosphate transporter domain                  54.7    5e-05   
ref|XP_010091566.1|  Triose phosphate/phosphate translocator TPT      54.7    6e-05   
gb|ABY82452.1|  triosephosphate translocator                          51.6    6e-05   
gb|AAK50101.1|AF372964_1  AT5g17630/K10A8_110                         54.7    6e-05   
ref|XP_007148882.1|  hypothetical protein PHAVU_005G022300g           54.7    6e-05   
ref|NP_197265.1|  nucleotide/sugar transporter family protein         54.7    7e-05   
ref|XP_010244200.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  54.7    7e-05   
gb|AAG48163.1|AF209211_1  phosphate/pentose phosphate translocator    54.3    7e-05   
ref|XP_007151011.1|  hypothetical protein PHAVU_004G0113001g          53.5    7e-05   
ref|XP_006354560.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  54.3    7e-05   
ref|XP_002960623.1|  hypothetical protein SELMODRAFT_73397            54.3    7e-05   
ref|XP_008232162.1|  PREDICTED: LOW QUALITY PROTEIN: xylulose 5-p...  54.3    7e-05   
ref|XP_002521443.1|  Triose phosphate/phosphate translocator, non...  54.3    8e-05   
ref|XP_009610913.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  54.3    8e-05   
ref|XP_011093419.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  54.3    8e-05   
ref|XP_010691923.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  53.9    9e-05   
gb|KCW73293.1|  hypothetical protein EUGRSUZ_E01754                   53.9    9e-05   
ref|XP_010056521.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  53.9    9e-05   
ref|XP_009341641.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  53.9    1e-04   
ref|XP_005791213.1|  hypothetical protein EMIHUDRAFT_440029           53.9    1e-04   
ref|XP_003618180.1|  Phosphate/phosphoenolpyruvate translocator       53.9    1e-04   
ref|XP_006289865.1|  hypothetical protein CARUB_v10003476mg           53.5    1e-04   
ref|XP_005757540.1|  hypothetical protein EMIHUDRAFT_438986           53.5    1e-04   
gb|KDO36428.1|  hypothetical protein CISIN_1g041338mg                 53.1    1e-04   
gb|EYU22374.1|  hypothetical protein MIMGU_mgv1a006886mg              53.5    1e-04   
ref|XP_001416614.1|  DMT family transporter: glucose-6-phosphate/...  53.1    1e-04   
ref|XP_001694243.1|  phosphate/phosphoenolpyruvate translocator       53.5    1e-04   
ref|XP_003594481.1|  Glucose 6 phosphate/phosphate translocator-l...  53.1    2e-04   
gb|EPS71045.1|  hypothetical protein M569_03710                       53.1    2e-04   
ref|XP_003566228.1|  PREDICTED: triose phosphate/phosphate transl...  53.1    2e-04   
ref|XP_010420492.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  53.1    2e-04   
ref|XP_006470290.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  53.1    2e-04   
ref|XP_004133935.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  52.8    2e-04   
ref|XP_004229531.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  52.8    2e-04   
ref|XP_007029845.1|  Nucleotide/sugar transporter family protein      52.8    3e-04   
ref|XP_004298952.1|  PREDICTED: triose phosphate/phosphate transl...  52.4    3e-04   
gb|ABY82456.1|  triosephosphate translocator                          49.7    3e-04   
ref|XP_008438491.1|  PREDICTED: triose phosphate/phosphate transl...  52.4    3e-04   
gb|EYU42271.1|  hypothetical protein MIMGU_mgv1a007241mg              52.4    3e-04   
ref|XP_010453962.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  52.4    3e-04   
gb|ABY82454.1|  triosephosphate translocator                          49.3    3e-04   
ref|XP_002512091.1|  Triose phosphate/phosphate translocator, chl...  52.4    3e-04   
emb|CDP02092.1|  unnamed protein product                              52.4    3e-04   
ref|XP_004152480.1|  PREDICTED: triose phosphate/phosphate transl...  52.4    3e-04   
ref|XP_010108795.1|  Phosphoenolpyruvate/phosphate translocator 2     52.0    4e-04   
gb|AAK27373.1|  triose phosphate/phosphate translocator               52.0    4e-04   
ref|XP_009107536.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  52.0    4e-04   
emb|CDY38448.1|  BnaA10g17100D                                        52.0    4e-04   
ref|XP_006400306.1|  hypothetical protein EUTSA_v10015991mg           52.0    4e-04   
gb|AGN29546.1|  triosephosphate translocator                          48.9    5e-04   
emb|CDY16905.1|  BnaC09g40320D                                        51.6    5e-04   
ref|XP_009402961.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  52.0    5e-04   
gb|AAF86906.1|AF223358_1  triose phosphate/phosphate translocator...  51.6    5e-04   
gb|KJB80747.1|  hypothetical protein B456_013G113700                  51.6    5e-04   
gb|ABO87604.1|  chloroplast pentose phosphate translocator            51.2    6e-04   
gb|KHN09965.1|  Triose phosphate/phosphate translocator, chloropl...  51.2    6e-04   
gb|EEE54205.1|  hypothetical protein OsJ_01049                        51.2    6e-04   
ref|XP_009799738.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  51.2    6e-04   
ref|XP_006645543.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  51.2    7e-04   
ref|XP_003542721.1|  PREDICTED: triose phosphate/phosphate transl...  51.2    7e-04   
ref|XP_004967339.1|  PREDICTED: triose phosphate/phosphate transl...  51.2    7e-04   
emb|CBI34895.3|  unnamed protein product                              51.6    7e-04   
ref|XP_007138065.1|  hypothetical protein PHAVU_009G177600g           51.2    7e-04   
ref|XP_002454816.1|  hypothetical protein SORBIDRAFT_04g037980        51.2    7e-04   
ref|XP_011070947.1|  PREDICTED: triose phosphate/phosphate transl...  51.2    7e-04   
ref|XP_011070946.1|  PREDICTED: triose phosphate/phosphate transl...  51.2    8e-04   
ref|XP_009765626.1|  PREDICTED: triose phosphate/phosphate transl...  51.2    8e-04   
ref|NP_001042544.1|  Os01g0239200                                     50.8    9e-04   
ref|XP_009601375.1|  PREDICTED: triose phosphate/phosphate transl...  50.8    9e-04   
ref|XP_012070308.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...  50.8    9e-04   
gb|EYU28857.1|  hypothetical protein MIMGU_mgv1a021623mg              50.8    0.001   
ref|XP_008446431.1|  PREDICTED: triose phosphate/phosphate transl...  50.8    0.001   
ref|XP_002276496.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  50.8    0.001   
ref|XP_007215760.1|  hypothetical protein PRUPE_ppa009490mg           50.4    0.001   
ref|XP_007215759.1|  hypothetical protein PRUPE_ppa009490mg           50.4    0.001   
ref|XP_006837125.1|  PREDICTED: triose phosphate/phosphate transl...  50.8    0.001   



>ref|XP_009601121.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=398

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 127/158 (80%), Gaps = 4/158 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPK--SPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MIS V+QS  + + GSDF R K  +     +  +LPPLPA+ P R S +SL++P++VSSV
Sbjct  1    MISTVKQSA-VTLNGSDFNRSKFQTLTSLRRFSLLPPLPAMNPRRNSGVSLSKPIYVSSV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E FG+L+ RS+G D EK  LV CKAYEADR++PI+ P +K+E AR+VKIG+YFATWW LN
Sbjct  60   EKFGTLR-RSKGHDQEKSCLVKCKAYEADRAEPIDGPESKTEVARRVKIGVYFATWWFLN  118

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            V+FNIYNKKVLNA+PFPWLTSTLSLAAGSLIMLISWA+
Sbjct  119  VIFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLISWAV  156



>ref|XP_009785267.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=398

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 127/158 (80%), Gaps = 4/158 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPK--SPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MIS V+QS  + + GSDF R K  +     +  +LPPLPA+ P + S +SL++P++VSSV
Sbjct  1    MISTVKQSA-VTLNGSDFNRSKFQTLTSLRRFSLLPPLPAMNPSQSSGVSLSKPIYVSSV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E FG+L+ RS+G D EK  LV CKAYEADR++PI+ P +K+E AR+VKIG+YFATWW LN
Sbjct  60   EKFGTLR-RSKGHDQEKSCLVKCKAYEADRAEPIDGPESKTEVARRVKIGVYFATWWFLN  118

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            V+FNIYNKKVLNA+PFPWLTSTLSLAAGSLIMLISWA+
Sbjct  119  VIFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLISWAV  156



>ref|XP_006366041.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Solanum tuberosum]
Length=396

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 123/158 (78%), Gaps = 6/158 (4%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSP--APAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MIS V+QS    I G DF R KS   A + ++ VLPPLPA+K  R S +S+++PV VSSV
Sbjct  1    MISTVKQSA-FTINGCDFIRSKSQSLASSRRISVLPPLPAMKSRRSSGVSISKPVFVSSV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+FG LK   R ++     LV CKAYEADR++PIE P +K+E ARK+KIG+YFATWW LN
Sbjct  60   ESFGGLK---RSNEKTDSGLVKCKAYEADRAEPIEGPESKTEVARKMKIGVYFATWWFLN  116

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            V+FNIYNKKVLNA+PFPWLTSTLSLAAGSLIMLISWAL
Sbjct  117  VIFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLISWAL  154



>emb|CDP05779.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 128/167 (77%), Gaps = 12/167 (7%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKP-CRGSVLSLARPVHVSSVE  678
            M+S+++Q   +   GSD FRP+S  P+ +  VLPPLPAL      SV+SL++P+ VS VE
Sbjct  1    MMSSLKQP-VVHFHGSDAFRPQSSVPSRRFSVLPPLPALNTRWSSSVVSLSKPLFVSKVE  59

Query  679  TF---GSLK-ERSRGD----DH--EKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGI  828
            +F   G+LK   S GD    DH  +KR L+ C+AYEAD+S PI++  A+SEAAR+VKIG+
Sbjct  60   SFSPLGTLKRSSSTGDAGDNDHVPQKRDLIICRAYEADKSIPIDDSQARSEAARRVKIGV  119

Query  829  YFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            YFATWW LNV+FNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWAL
Sbjct  120  YFATWWTLNVIFNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWAL  166



>ref|XP_004244144.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Solanum lycopersicum]
Length=396

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAP--KLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            M+S V+Q+    I G DF R KS + A   ++ +LPPLPA+K  R S +S+++PV VSSV
Sbjct  1    MMSTVKQAA-FTINGCDFIRSKSQSLASTRRISLLPPLPAMKSRRSSGVSVSKPVFVSSV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+FG LK   R ++     LV CKAYEADR++P+E P +K+E ARK+KIG+YFATWW LN
Sbjct  60   ESFGGLK---RSNEKTDSGLVKCKAYEADRAEPMEGPESKAELARKMKIGVYFATWWFLN  116

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            V+FNIYNKKVLNA+PFPWLTSTLSLAAGSLIMLISW L
Sbjct  117  VIFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLISWTL  154



>ref|XP_011095359.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Sesamum indicum]
Length=391

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 121/157 (77%), Gaps = 9/157 (6%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MIS+++Q   L +  S+F   +    A    VLP LPA+K  RG+V+SL++P+HVS VE+
Sbjct  1    MISSLKQPA-LPLHDSNFRHSRRNFLARHSPVLPSLPAVKTSRGAVVSLSKPLHVSKVES  59

Query  682  FGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNV  858
            F   KE+       K +L+TCKAYEADRS+PI E A AKSEAARK+KIGIYFATWW LNV
Sbjct  60   FSINKEK-------KPSLITCKAYEADRSKPIVESAEAKSEAARKLKIGIYFATWWGLNV  112

Query  859  VFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            +FNIYNKKVLNAYPFPWLTSTLSLAAGS+IML+SWAL
Sbjct  113  IFNIYNKKVLNAYPFPWLTSTLSLAAGSIIMLVSWAL  149



>ref|XP_012070764.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X2 [Jatropha curcas]
 gb|KDP39078.1| hypothetical protein JCGZ_00835 [Jatropha curcas]
Length=392

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 118/157 (75%), Gaps = 10/157 (6%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI  V+QS  L  I GS+  FR K+P    +   LP LPA K  + +VL++++P+HVSS+
Sbjct  1    MICTVKQSALLPTINGSETIFRRKNPFTTQRSLFLPSLPAKKSPK-TVLAVSKPLHVSSI  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   K        +K +L+TCKAYEADRSQPI+    KSEAARKVKIGIYFATWWALN
Sbjct  60   ESFALPKP-------QKESLITCKAYEADRSQPIDAAETKSEAARKVKIGIYFATWWALN  112

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+PFPWLTSTLSLA GSLIML+SWA
Sbjct  113  VVFNIYNKKVLNAFPFPWLTSTLSLACGSLIMLVSWA  149



>ref|XP_012070763.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X1 [Jatropha curcas]
Length=396

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 118/157 (75%), Gaps = 10/157 (6%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI  V+QS  L  I GS+  FR K+P    +   LP LPA K  + +VL++++P+HVSS+
Sbjct  1    MICTVKQSALLPTINGSETIFRRKNPFTTQRSLFLPSLPAKKSPK-TVLAVSKPLHVSSI  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   K        +K +L+TCKAYEADRSQPI+    KSEAARKVKIGIYFATWWALN
Sbjct  60   ESFALPKP-------QKESLITCKAYEADRSQPIDAAETKSEAARKVKIGIYFATWWALN  112

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+PFPWLTSTLSLA GSLIML+SWA
Sbjct  113  VVFNIYNKKVLNAFPFPWLTSTLSLACGSLIMLVSWA  149



>ref|XP_011009303.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X2 [Populus euphratica]
Length=392

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 117/157 (75%), Gaps = 10/157 (6%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V+QS     I GSD  FR K+P+   +  +LP L   K  +  VLS+++P+HVS V
Sbjct  1    MICSVKQSVITPTINGSDTIFRRKNPSAIQRSLILPSLNGNKSSK-PVLSMSKPLHVSKV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   K        +KR+L+TC AYEADRS+PIE P  KSEAA+KVKIGIYFATWWALN
Sbjct  60   ESFALSKP-------QKRSLITCNAYEADRSEPIEAPVVKSEAAKKVKIGIYFATWWALN  112

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  113  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLISWA  149



>ref|XP_011009302.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X1 [Populus euphratica]
Length=400

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 117/157 (75%), Gaps = 10/157 (6%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V+QS     I GSD  FR K+P+   +  +LP L   K  +  VLS+++P+HVS V
Sbjct  1    MICSVKQSVITPTINGSDTIFRRKNPSAIQRSLILPSLNGNKSSK-PVLSMSKPLHVSKV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   K        +KR+L+TC AYEADRS+PIE P  KSEAA+KVKIGIYFATWWALN
Sbjct  60   ESFALSKP-------QKRSLITCNAYEADRSEPIEAPVVKSEAAKKVKIGIYFATWWALN  112

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  113  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLISWA  149



>ref|XP_006370658.1| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
 gb|ERP67227.1| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
Length=400

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 115/157 (73%), Gaps = 10/157 (6%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V+QS     I GSD  FR K+P+   +  +LP L   K  +  VLS+++P+HVS V
Sbjct  1    MICSVKQSVITPTINGSDTIFRRKNPSAIQRSLILPSLNGNKSSK-PVLSMSKPLHVSKV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   K        +KR+L+TC AYEADRS+PIE P  KSEAA+KVKIGIYFA WWALN
Sbjct  60   ESFALSKP-------QKRSLITCNAYEADRSEPIEAPEVKSEAAKKVKIGIYFAVWWALN  112

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSL+M ISWA
Sbjct  113  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMFISWA  149



>gb|EYU19234.1| hypothetical protein MIMGU_mgv1a007836mg [Erythranthe guttata]
Length=394

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 114/158 (72%), Gaps = 8/158 (5%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPAL-KPCRGSVLSLARPVHVSSVE  678
            MIS+++QS   ++ GS F +P+   P        P  A  KP R   +SL++P+HVS V 
Sbjct  1    MISSLKQSA-FSLHGSSFLQPRRNFPTHHSAAALPSLAAAKPLRSKTISLSKPLHVSKVG  59

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPI-EEPAAKSEAARKVKIGIYFATWWALN  855
            +F  + E  R     + + VTCKAYEADRS+PI E P  KSEAARK+KIGIYFATWW LN
Sbjct  60   SFSVVDEEER-----RSSPVTCKAYEADRSEPILESPEVKSEAARKLKIGIYFATWWGLN  114

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            V+FNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWAL
Sbjct  115  VIFNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWAL  152



>ref|XP_011030834.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Populus euphratica]
Length=391

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 11/157 (7%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +++QS     I GSD  FR K+ +   +  +LP L A K     VLS+++P+HVS V
Sbjct  1    MICSIKQSTMTPTINGSDTIFRRKNMSAIQRSLILPSLNANK--SKPVLSMSKPLHVSKV  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   K        +KR L+TCKAYEADRS+PIE    KSEAA++VKIGIYFATWWALN
Sbjct  59   ESFALSKP-------QKRTLITCKAYEADRSEPIEASEVKSEAAKRVKIGIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSL+M+ISWA
Sbjct  112  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMMISWA  148



>ref|XP_002523008.1| Glucose-6-phosphate/phosphate translocator 1, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF39438.1| Glucose-6-phosphate/phosphate translocator 1, chloroplast precursor, 
putative [Ricinus communis]
Length=392

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 112/157 (71%), Gaps = 10/157 (6%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI  ++QS     I GSD  FR K   P      LP L   K  R S+LSL++P+HVSS+
Sbjct  1    MICTIKQSVVTPTINGSDAIFRRKVQPPTRGSLFLPSLSIQKSQR-SLLSLSKPLHVSSI  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+       S     ++ +L+TCKAYEADRSQPI+    KSEAARKVKIGIYFATWWALN
Sbjct  60   ES-------SFAVPSKESSLITCKAYEADRSQPIDTTEGKSEAARKVKIGIYFATWWALN  112

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSLIMLISWA
Sbjct  113  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLIMLISWA  149



>ref|XP_004294354.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=391

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 117/158 (74%), Gaps = 13/158 (8%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +++QS P    G D + RP++         LP LP LK  + SVLS+ +P+H+SS+E
Sbjct  1    MICSLKQS-PAITSGCDVYLRPRTLPAVQGSLHLPSLP-LKNFQRSVLSVQKPLHISSLE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA--AKSEAARKVKIGIYFATWWAL  852
            +FGSLK R+        +L+ C+AYEAD+S+PIE P    +SEAA+K+KIG+YFA WWAL
Sbjct  59   SFGSLKSRT--------SLIKCQAYEADQSEPIELPKVDTRSEAAKKLKIGVYFAMWWAL  110

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIML+SWA
Sbjct  111  NVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLVSWA  148



>ref|XP_006377841.1| hypothetical protein POPTR_0011s13920g [Populus trichocarpa]
 gb|ERP55638.1| hypothetical protein POPTR_0011s13920g [Populus trichocarpa]
Length=378

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 11/157 (7%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +++QS     I GSD  FR K+ +   +  +LP L A K     VLS+++P+HVS V
Sbjct  1    MICSIKQSTITPTINGSDTIFRRKNMSAIQRSLILPSLNANKS--KPVLSMSKPLHVSKV  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   +        +KR ++TCKAYEADRS+PIE    KSEAA++VKIGIYFATWWALN
Sbjct  59   ESFALSRP-------QKRTMITCKAYEADRSEPIEASEVKSEAAKRVKIGIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSL+M+ISWA
Sbjct  112  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMMISWA  148



>ref|XP_002316985.2| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
 gb|EEE97597.2| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
Length=391

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 11/157 (7%)
 Frame = +1

Query  502  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +++QS     I GSD  FR K+ +   +  +LP L A K     VLS+++P+HVS V
Sbjct  1    MICSIKQSTITPTINGSDTIFRRKNMSAIQRSLILPSLNANK--SKPVLSMSKPLHVSKV  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+F   +        +KR ++TCKAYEADRS+PIE    KSEAA++VKIGIYFATWWALN
Sbjct  59   ESFALSRP-------QKRTMITCKAYEADRSEPIEASEVKSEAAKRVKIGIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSL+M+ISWA
Sbjct  112  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMMISWA  148



>ref|XP_011097912.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Sesamum indicum]
Length=391

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 118/159 (74%), Gaps = 13/159 (8%)
 Frame = +1

Query  502  MISAV--RQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MIS+V  +Q   L+I GSDF + +     P+    P  PA +P R  VLSL++P+H+S V
Sbjct  1    MISSVSVKQPTGLSIHGSDFLQARRKF-LPRHS--PVFPA-EPRRTFVLSLSKPLHISKV  56

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI-EEPAAKSEAARKVKIGIYFATWWAL  852
            E+F +      G +  +R  + CKAYEA+RS+PI E P A+SEAAR+VKIGIYFATWW L
Sbjct  57   ESFSA----DAGTEGSRR--IVCKAYEAERSEPIGESPEARSEAARRVKIGIYFATWWGL  110

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            NV+FNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWAL
Sbjct  111  NVIFNIYNKKVLNAYPFPWLTSTLSLAAGSLIMLISWAL  149



>ref|XP_007213874.1| hypothetical protein PRUPE_ppa006795mg [Prunus persica]
 gb|EMJ15073.1| hypothetical protein PRUPE_ppa006795mg [Prunus persica]
Length=395

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 115/162 (71%), Gaps = 17/162 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +V+Q   +   GSD F R  +  P  +  +LP LP  K  R SV+S+ + +HVS++E
Sbjct  1    MICSVKQYSTIT-NGSDIFLRQSTRPPMQRSLLLPSLPVQKSQR-SVISVQKALHVSAIE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFAT  840
            +FGS K R+        +L+ C+AYEADRSQPIE      +   +SEAA+K+KIG+YFA 
Sbjct  59   SFGSPKPRT--------SLIKCQAYEADRSQPIESNIELPKADTRSEAAKKLKIGVYFAM  110

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WWALNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIMLISWA
Sbjct  111  WWALNVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLISWA  152



>ref|XP_011660235.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66695.1| hypothetical protein Csa_1G660150 [Cucumis sativus]
Length=396

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 111/161 (69%), Gaps = 16/161 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI AV+Q     I  SD   R K+  P+ +   LPPLP  KP R S +S+ + VHVSS+E
Sbjct  1    MICAVKQCSR-GIHCSDGVIRSKTSVPSQRSSFLPPLPVQKP-RNSAISVYKAVHVSSLE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFAT  840
             FG+L  R       K  L+ C+AYEA+RSQPIE      +    SEAA+KVKIG YFA 
Sbjct  59   NFGTLGVR-------KANLIKCEAYEAERSQPIESSIELPQSQVPSEAAKKVKIGSYFAL  111

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            WWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSLIMLISW
Sbjct  112  WWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLIMLISW  152



>ref|XP_008454525.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis melo]
Length=396

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 111/161 (69%), Gaps = 16/161 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI AV+Q    AI  SD   R K+  P+     LPPLP  KP R S +S+ + VHVSS+E
Sbjct  1    MICAVKQCSR-AIHCSDGAIRSKTSVPSRGSSFLPPLPVQKP-RNSAISVHKAVHVSSLE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFAT  840
             FG+L  R       K  L+ C+AYEA+RSQPIE      +    SEAA+KVKIG YFA 
Sbjct  59   NFGTLGVR-------KANLIKCEAYEAERSQPIESSIELPQSQVPSEAAKKVKIGSYFAL  111

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            WWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSLIMLISW
Sbjct  112  WWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLIMLISW  152



>ref|XP_008226825.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Prunus mume]
Length=395

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 114/162 (70%), Gaps = 17/162 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +V+Q   +   GSD F R  +  P  +  +LP LP  K  R SV+S+ + +HVS++E
Sbjct  1    MICSVKQYSTIT-NGSDIFLRQSTRPPMQRSLLLPSLPVQKSQR-SVISVQKALHVSAIE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFAT  840
            +F S K R+        +L+ C+AYEADRSQPIE      +   +SEAA+K+KIG+YFA 
Sbjct  59   SFRSPKPRT--------SLIKCQAYEADRSQPIESNIELPKADTRSEAAKKLKIGVYFAM  110

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WWALNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIMLISWA
Sbjct  111  WWALNVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLISWA  152



>gb|KDO50251.1| hypothetical protein CISIN_1g0163482mg, partial [Citrus sinensis]
Length=242

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 114/157 (73%), Gaps = 11/157 (7%)
 Frame = +1

Query  502  MISAVRQSGPLA-IRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MIS+++ + P A I GSD  FR +  +P  +   LPPL  +     S  SL+RP+H+S+V
Sbjct  1    MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPL-QVDSSSKSEFSLSRPLHISNV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
              F  ++         +++L+ CKAYEA++SQPIE   AKS AA+KVKIGIYFATWWALN
Sbjct  60   SCFEPVRV--------QKSLIKCKAYEAEQSQPIEREEAKSAAAQKVKIGIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  112  VVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  148



>ref|XP_008463436.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis melo]
Length=396

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 106/161 (66%), Gaps = 16/161 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS++ QS    I GSD   R  SP P  +    P LPA KP   SV+ +   +H+SSV 
Sbjct  1    MISSLTQSAK-PINGSDVILRRSSPVPIRRFSYSPSLPAQKP-HNSVVCMKNALHISSVS  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEP------AAKSEAARKVKIGIYFAT  840
             FG+L         +KR   TCKAYEADRSQPIE           SEAA+KVKIG+YFA 
Sbjct  59   KFGTLGT-------QKRDFNTCKAYEADRSQPIESNIELTVVEQPSEAAKKVKIGLYFAL  111

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            WW LNVVFNIYNKKVLNAYP+PWLTSTLSLA GSLIML+SW
Sbjct  112  WWGLNVVFNIYNKKVLNAYPYPWLTSTLSLAVGSLIMLVSW  152



>gb|ACJ84766.1| unknown [Medicago truncatula]
Length=218

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDF-FRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVS--S  672
            MIS++RQ G + I GSD   R +          LP L   K  R SV+S+ +P+H++   
Sbjct  1    MISSLRQPG-IVITGSDAGLRKRHATLVQPQSFLPSLVGGKSQR-SVISMKKPLHIACAG  58

Query  673  VETFGSLKE---RSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATW  843
            V  FGS+K     S     EK  LV C+AYEADRS+ +E     SEAA+KVKIGIYFATW
Sbjct  59   VGNFGSVKNFEFESEKKSFEKGDLVKCEAYEADRSE-VEGAETPSEAAKKVKIGIYFATW  117

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  118  WALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  158



>gb|EPS72032.1| glucose-6-phosphate/phosphate translocator 1, chloroplastic, 
partial [Genlisea aurea]
Length=313

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 105/147 (71%), Gaps = 12/147 (8%)
 Frame = +1

Query  535  AIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGD  714
            ++ GS+F   +   PA +   L P    +P R S+++L+RP+++S  E+F      S GD
Sbjct  1    SVNGSNFLPSRRRFPAAQSLTLTPFTLGEPRRTSIVNLSRPLYISKAESF------SGGD  54

Query  715  DHEKRALVTCKAYEADRSQPIEEPAA--KSEAARKVKIGIYFATWWALNVVFNIYNKKVL  888
                RA + C AYEADRS+PI   AA  +SE+AR+VKIGIYFATWW LNV+FNIYNKKVL
Sbjct  55   ----RASIACNAYEADRSEPITGAAASERSESARRVKIGIYFATWWGLNVIFNIYNKKVL  110

Query  889  NAYPFPWltstlslaagslIMLISWAL  969
            N YPFPWLTSTLSLAAGSLIML+SW L
Sbjct  111  NVYPFPWLTSTLSLAAGSLIMLVSWTL  137



>ref|XP_004152937.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Cucumis sativus]
 gb|KGN56144.1| hypothetical protein Csa_3G078260 [Cucumis sativus]
Length=396

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 106/161 (66%), Gaps = 16/161 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS++ QS   +I GSD   R  SP P  +    P LPA KP   SV+ +   +H+SSV 
Sbjct  1    MISSLTQSAK-SINGSDVILRRSSPVPIRRFSCSPSLPAQKP-HSSVVCVKNALHISSVS  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEE------PAAKSEAARKVKIGIYFAT  840
             FG+L  R       K     CKAYEADRSQPIE           SEAA+KVKIG+YFA 
Sbjct  59   NFGTLGTR-------KSDFNACKAYEADRSQPIESNIELTVADQPSEAAKKVKIGLYFAL  111

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            WW+LNVVFNIYNKKVLNAYP+PWLTSTLSLA GSLIML+SW
Sbjct  112  WWSLNVVFNIYNKKVLNAYPYPWLTSTLSLAVGSLIMLVSW  152



>gb|KCW67182.1| hypothetical protein EUGRSUZ_F00969 [Eucalyptus grandis]
Length=289

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 113/156 (72%), Gaps = 11/156 (7%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVH-VSSV  675
            MI + RQS    + GS+     K   P+ +  +LPPL   K  R +V+SL+RP+H V+SV
Sbjct  1    MICSARQSLS-PVHGSEVLLSQKRVFPSSRSSLLPPLRTQKSSR-AVVSLSRPLHIVASV  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
            E+FG    R      E + L+ C+AYEAD+S+PIE   A SEAA+KVKIGIYFATWWALN
Sbjct  59   ESFGPSPRR------EGKDLIKCEAYEADQSKPIEA-GAGSEAAKKVKIGIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            VVFNIYNKKVLNAYP+PWLTSTLSLA GSL+ML+SW
Sbjct  112  VVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLVSW  147



>ref|XP_009342585.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 16/163 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V+Q   +   GSD F  R   P P  +   LP LPA +P R S +SL + +HVS++
Sbjct  1    MICSVKQYTGVT-NGSDIFLRRSTRPPPVQRSLFLPSLPAHQPHR-SGISLQKALHVSAI  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA------AKSEAARKVKIGIYFA  837
             + G+L + +R       +++ C+A+EADRSQPIE         AK EAA+K+KIG+YFA
Sbjct  59   GSLGALPKPTR------MSVIKCQAFEADRSQPIESNIELPKVDAKVEAAKKLKIGVYFA  112

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
             WWALNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIML+SWA
Sbjct  113  MWWALNVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLVSWA  155



>ref|XP_006452222.1| hypothetical protein CICLE_v10008564mg [Citrus clementina]
 gb|ESR65462.1| hypothetical protein CICLE_v10008564mg [Citrus clementina]
Length=391

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 114/157 (73%), Gaps = 11/157 (7%)
 Frame = +1

Query  502  MISAVRQSGPLA-IRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MIS+++ + P A I GSD  FR +  +P  +   LPPL  +     S  SL+RP+H+S+V
Sbjct  1    MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPL-QVDSSSKSEFSLSRPLHISNV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
              F  ++ +        ++L+ CKAYEA++SQPIE   AKS AA+KVKIGIYFATWWALN
Sbjct  60   SCFEPVRVQ--------KSLIKCKAYEAEQSQPIEREEAKSAAAQKVKIGIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  112  VVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  148



>ref|XP_009358127.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 112/163 (69%), Gaps = 16/163 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V+Q   +   GSD F  R   P P  +   LP LPA +P R  + SL + +HVS++
Sbjct  1    MICSVKQYTGVT-NGSDIFLRRSTRPPPVQRSLFLPSLPAHQPHRSGI-SLQKALHVSAI  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA------AKSEAARKVKIGIYFA  837
             + G+L + +R       +++ C+A+EADRSQPIE         AK EAA+K+KIG+YFA
Sbjct  59   GSLGALPKPTR------MSVIKCQAFEADRSQPIESNIELPKVDAKVEAAKKLKIGVYFA  112

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
             WWALNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIML+SWA
Sbjct  113  MWWALNVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLVSWA  155



>ref|XP_006493943.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Citrus sinensis]
Length=391

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 113/157 (72%), Gaps = 11/157 (7%)
 Frame = +1

Query  502  MISAVRQSGPLA-IRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MIS+++ + P A I GSD  FR +  +P  +   LPPL  +     S  SL+RP+H+S+V
Sbjct  1    MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPL-QVDSSSKSEFSLSRPLHISNV  59

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALN  855
              F  ++ +        ++L  CKAYEA++SQPIE   AKS AA+KVKIGIYFATWWALN
Sbjct  60   SCFEPVRVQ--------KSLTKCKAYEAEQSQPIEREEAKSAAAQKVKIGIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  112  VVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  148



>ref|XP_010060420.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW67181.1| hypothetical protein EUGRSUZ_F00969 [Eucalyptus grandis]
Length=390

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 114/157 (73%), Gaps = 13/157 (8%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVH-VSS  672
            MI + RQS  P  + GS+     K   P+ +  +LPPL   K  R +V+SL+RP+H V+S
Sbjct  1    MICSARQSLSP--VHGSEVLLSQKRVFPSSRSSLLPPLRTQKSSR-AVVSLSRPLHIVAS  57

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWAL  852
            VE+FG    R      E + L+ C+AYEAD+S+PIE   A SEAA+KVKIGIYFATWWAL
Sbjct  58   VESFGPSPRR------EGKDLIKCEAYEADQSKPIEA-GAGSEAAKKVKIGIYFATWWAL  110

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            NVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+ML+SW
Sbjct  111  NVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLVSW  147



>ref|XP_003599946.1| Glucose-6-phosphate/phosphate-translocator [Medicago truncatula]
 gb|AES70197.1| glucose-6-phosphate/phosphate translocator-like protein [Medicago 
truncatula]
 gb|AFK43777.1| unknown [Medicago truncatula]
Length=401

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDF-FRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVS--S  672
            MIS++RQ G + I GSD   R +          LP L   K  R SV+S+ +P+H++   
Sbjct  1    MISSLRQPG-IVITGSDAGLRKRHATLVQPQSFLPSLVGGKSQR-SVISMKKPLHIACAG  58

Query  673  VETFGSLKE---RSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATW  843
            V  FGS+K     S     EK  LV C+AYEADRS+ +E     SEAA+KVKIGIYFATW
Sbjct  59   VGNFGSVKNFEFESEKKSFEKGDLVKCEAYEADRSE-VEGAETPSEAAKKVKIGIYFATW  117

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  118  WALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  158



>ref|XP_008365529.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Malus domestica]
 ref|XP_008345056.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Malus domestica]
Length=398

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 111/163 (68%), Gaps = 16/163 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V+Q   +   GSD F  R   P P  +   LP LPA +  R  + S+ + +HVS++
Sbjct  1    MICSVKQYTGVT-NGSDIFLRRSTRPPPVQRSLFLPXLPAHQXQRSGI-SVQKALHVSAI  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA------AKSEAARKVKIGIYFA  837
             T G+L + +R       ++V C+A+EADRSQPIE         AK EAA+K+KIG+YFA
Sbjct  59   ATLGALPKPTR------MSVVKCQAFEADRSQPIESSVELPKVDAKLEAAKKLKIGVYFA  112

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
             WWALNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIML+SWA
Sbjct  113  MWWALNVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLVSWA  155



>ref|XP_004500037.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=399

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDF-FRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVS--S  672
            MIS++RQ   +AI GSD   R +          LP L   K  R S++S+ +P+H++   
Sbjct  1    MISSLRQQPSIAISGSDVVLRKRHGTLVQPQSFLPSLVRGKSQR-SLVSVQKPLHLACVG  59

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWAL  852
            V  FGS+K            LV C+AYEADRS+ +E  A  SEAA+KVKIGIYFATWWAL
Sbjct  60   VGNFGSVKSFDSVKGFGSDDLVKCEAYEADRSE-VEGAATPSEAAKKVKIGIYFATWWAL  118

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  119  NVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  156



>ref|XP_004500035.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004500036.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=412

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDF-FRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVS--S  672
            MIS++RQ   +AI GSD   R +          LP L   K  R S++S+ +P+H++   
Sbjct  1    MISSLRQQPSIAISGSDVVLRKRHGTLVQPQSFLPSLVRGKSQR-SLVSVQKPLHLACVG  59

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWAL  852
            V  FGS+K            LV C+AYEADRS+ +E  A  SEAA+KVKIGIYFATWWAL
Sbjct  60   VGNFGSVKSFDSVKGFGSDDLVKCEAYEADRSE-VEGAATPSEAAKKVKIGIYFATWWAL  118

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  119  NVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  156



>gb|KJB81792.1| hypothetical protein B456_013G161500 [Gossypium raimondii]
Length=390

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 96/126 (76%), Gaps = 12/126 (10%)
 Frame = +1

Query  595  VLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  774
            +LPPL      + + LSL++P+HVS+VE  G           +K  ++ C+AYEAD+SQP
Sbjct  32   ILPPLVFQNNSKRTNLSLSKPLHVSAVEIIG----------KDKEPVIKCRAYEADKSQP  81

Query  775  IEEPA--AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslI  948
            IE  A   KSEAA++VKIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+
Sbjct  82   IEAAAEEVKSEAAKRVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLM  141

Query  949  MLISWA  966
            MLISWA
Sbjct  142  MLISWA  147



>gb|KHM99601.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Glycine 
soja]
Length=395

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 110/156 (71%), Gaps = 5/156 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF-RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS++RQ   + I GSD   R +   P      LP L   K  R S++S+ +P+H+++  
Sbjct  1    MISSLRQP-VVGISGSDLLLRQRHATPIKARSFLPSLSREKGQR-SLVSVQKPLHIAASL  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALNV  858
              G+     + DD ++  LV C+AYEADRS+ +E  +  SEAA+KVKIGIYFATWWALNV
Sbjct  59   GVGNFVSV-KSDDDKRGDLVKCEAYEADRSE-VEGASTPSEAAKKVKIGIYFATWWALNV  116

Query  859  VFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  117  VFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  152



>ref|XP_007146406.1| hypothetical protein PHAVU_006G037800g [Phaseolus vulgaris]
 gb|ESW18400.1| hypothetical protein PHAVU_006G037800g [Phaseolus vulgaris]
Length=393

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 109/159 (69%), Gaps = 13/159 (8%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF-RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV-  675
            MIS++RQ   + I GSD   R +   P      LP L   K  +GS++S+ +P+H++S  
Sbjct  1    MISSLRQP-VVGISGSDLLLRQRHATPVKARSFLPSLSREKG-QGSLVSVHKPLHIASSL  58

Query  676  --ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWA  849
                F S K   RGD      LV C+AYEADRS+ +E     SEAA+KVKIGIYFATWWA
Sbjct  59   GGGNFVSGKSDGRGD------LVKCEAYEADRSE-VEATNTPSEAAKKVKIGIYFATWWA  111

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            LNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  112  LNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  150



>ref|XP_007020963.1| Glucose 6-phosphate/phosphate translocator 1 isoform 1 [Theobroma 
cacao]
 gb|EOY12488.1| Glucose 6-phosphate/phosphate translocator 1 isoform 1 [Theobroma 
cacao]
Length=391

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 99/135 (73%), Gaps = 11/135 (8%)
 Frame = +1

Query  565  KSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTC  744
            +SP+   +    P L   K  + + LS+++P+H+SS+E F            EK+ L+ C
Sbjct  24   RSPSAICRSFFSPSLDLQKNPKLTSLSVSKPLHISSIEGF----------VKEKKPLIQC  73

Query  745  KAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltst  921
            KAYEADRSQPIE     KSEAA++VKIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTST
Sbjct  74   KAYEADRSQPIEAAGEVKSEAAKRVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTST  133

Query  922  lslaagslIMLISWA  966
            LSLA GSL+MLISWA
Sbjct  134  LSLACGSLMMLISWA  148



>gb|KJB81793.1| hypothetical protein B456_013G161500 [Gossypium raimondii]
Length=439

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 96/126 (76%), Gaps = 12/126 (10%)
 Frame = +1

Query  595  VLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  774
            +LPPL      + + LSL++P+HVS+VE  G           +K  ++ C+AYEAD+SQP
Sbjct  32   ILPPLVFQNNSKRTNLSLSKPLHVSAVEIIGK----------DKEPVIKCRAYEADKSQP  81

Query  775  IEEPA--AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslI  948
            IE  A   KSEAA++VKIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+
Sbjct  82   IEAAAEEVKSEAAKRVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLM  141

Query  949  MLISWA  966
            MLISWA
Sbjct  142  MLISWA  147



>ref|XP_003551900.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Glycine max]
Length=394

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 112/160 (70%), Gaps = 14/160 (9%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF-RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSS--  672
            MIS++RQ   + I GSD   R +   P      LP L   K  +GS++S+ +P+H+ +  
Sbjct  1    MISSLRQP-VVGISGSDLLLRQRHATPIKARSFLPSLSREKG-QGSLVSVQKPLHIGASL  58

Query  673  -VETFGSLK-ERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWW  846
             V  F S+K +  RGD      LV C+AYEADRS+ +E  +  SEAA+KVKIGIYFATWW
Sbjct  59   GVGNFVSVKSDAKRGD------LVKCEAYEADRSE-VEGASTPSEAAKKVKIGIYFATWW  111

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  112  ALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  151



>gb|KHG04645.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic -like 
protein [Gossypium arboreum]
Length=439

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 12/126 (10%)
 Frame = +1

Query  595  VLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  774
            +LPPL      + + LSL++P+HVS+VE  G           +K  ++ C+AYEAD+SQP
Sbjct  32   ILPPLVFQNNSKRTNLSLSKPLHVSAVEIIGK----------DKEPVIKCRAYEADKSQP  81

Query  775  IEEPA--AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslI  948
            I+  A   KSEAA++VKIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+
Sbjct  82   IQAAAQEVKSEAAKRVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLM  141

Query  949  MLISWA  966
            MLISWA
Sbjct  142  MLISWA  147



>gb|AAX47109.1| putative plastid glucose 6 phosphate/phosphate translocator [Glycine 
max]
Length=402

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 111/160 (69%), Gaps = 14/160 (9%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDF-FRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSS--  672
            MIS++RQ   + I GSD   R +   P      LP L   K  +GS++S+ +P+H+ +  
Sbjct  1    MISSLRQP-VVGISGSDLPLRQRHATPIKARSFLPSLSREK-GQGSLVSVQKPLHIGASL  58

Query  673  -VETFGSLK-ERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWW  846
             V  F S+K +  RGD      LV C+AYEADRS+ +E  +  SEAA+KVKIGIYFATWW
Sbjct  59   GVGNFASVKSDAKRGD------LVKCEAYEADRSE-VEGASTPSEAAKKVKIGIYFATWW  111

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLI WA
Sbjct  112  ALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLIXWA  151



>ref|XP_010276000.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010276002.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010276003.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
Length=399

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 111/163 (68%), Gaps = 15/163 (9%)
 Frame = +1

Query  502  MISAVRQSGP-LAIRGSDFFRPKSPAPAPKLCVLPP-LPALKPCRGSVLSLARPVHVSSV  675
            M+ +VR SG  L +      RPKS  P  ++ + P  L A KP  G  L   +P+++SS+
Sbjct  1    MMCSVRPSGTTLTVSDVSRLRPKSSVPQSRISLFPSMLSAKKPDSG--LWTRKPLYISSL  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFA  837
            + FGS +         ++ ++ CKAYEADRSQPI+      +  A+S AA+K+KIGIYFA
Sbjct  59   QGFGSFE-----GAKPRKPIIECKAYEADRSQPIDANIELPDQKARSAAAQKLKIGIYFA  113

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
             WWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  114  IWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWA  156



>ref|XP_009378791.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 16/162 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V+Q   +   G D F  R   P P  +  + P L   K  R SV+S+ + +HVS++
Sbjct  1    MICSVKQYSAVT-NGPDIFLRRSTRPTPVQRSLLFPSLQGQKTQR-SVISVQKALHVSAI  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA------AKSEAARKVKIGIYFA  837
             + G L   +R   ++      C+A+EADRSQPIE         AK EAA+K+KIG+YFA
Sbjct  59   RSLGGLPTPTRTSVNK------CQAFEADRSQPIESNVDLANVDAKVEAAKKLKIGVYFA  112

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
             WWALNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIML+SW
Sbjct  113  MWWALNVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLVSW  154



>ref|XP_003519000.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Glycine max]
 gb|ACU23286.1| unknown [Glycine max]
Length=395

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 110/156 (71%), Gaps = 5/156 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKL-CVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS++RQ   + I GSD    +  A   K    LP L   K  R S++S+ +P+H+++  
Sbjct  1    MISSLRQP-VVGISGSDLLLRQRHATLIKARSFLPSLSREKGQR-SLVSVQKPLHIAASL  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALNV  858
              G+     + DD ++  LV C+AYEADRS+ +E  +  SEAA+KVKIGIYFATWWALNV
Sbjct  59   GVGNFVSV-KSDDDKRGDLVKCEAYEADRSE-VEGASTPSEAAKKVKIGIYFATWWALNV  116

Query  859  VFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  117  VFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  152



>gb|AAC08525.1| glucose-6-phosphate/phosphate-translocator precursor [Pisum sativum]
 gb|ABO14803.1| plastid phosphate translocator [Vicia narbonensis]
Length=401

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 105/159 (66%), Gaps = 5/159 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKL--CVLPPLPALKPCRGSVLSLARPVHVS--  669
            MIS++RQ   ++I GSD    K  A   +L      P  + +  + SV+S  +P+H++  
Sbjct  1    MISSLRQP-SISISGSDVVLRKRHATLIQLRPQSFSPFSSREKSQRSVVSTKKPLHLACL  59

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWA  849
             V  FGS+K         +  LV C AYEADRS+        SEAA+KVKIGIYFATWWA
Sbjct  60   GVGNFGSVKNFESEASFGQSDLVKCGAYEADRSEVEGGDGTPSEAAKKVKIGIYFATWWA  119

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            LNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  120  LNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  158



>ref|XP_003545023.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Glycine max]
Length=395

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPK--SPAPAPKLCVL-PPLPALKPCRGSVLSLARPVHVSS  672
            MI  V+Q   ++IRGSD F  K  SP+   + C L  P    K    S++S+ +P+H+S 
Sbjct  1    MICTVKQP-VISIRGSDLFLRKKCSPSTPVQSCSLVSPSSKEKNSLRSLVSVQKPLHLSR  59

Query  673  V---ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATW  843
            V   +  GSL  R R D       VTC+AYEADRS+ +    A SEAA+KVKIGIYFATW
Sbjct  60   VGFGDFVGSLVRRERAD------FVTCEAYEADRSK-VGGAGAPSEAAKKVKIGIYFATW  112

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSLIML  WA
Sbjct  113  WALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLIMLFCWA  153



>ref|XP_010267729.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
Length=399

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 111/164 (68%), Gaps = 17/164 (10%)
 Frame = +1

Query  502  MISAVRQSGP-LAIRGSDFFRPKSPAPAPKLCVLPPLPALK-PCRGSVLSLARPVHVSSV  675
            M+ +VRQS   L +      RP +P    +L +L P+   K P  G  LS  +P+++SS+
Sbjct  1    MMCSVRQSTAILTVSDLSKSRPNAPTSQSRLSLLSPVSIAKGPNFG--LSARKPLYISSL  58

Query  676  ETFGSLK-ERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYF  834
            + F S + ER R   +E      CKAYEADRS PI+      +  A+S AA+K+KIGIYF
Sbjct  59   QGFRSFEGERPRNSVNE------CKAYEADRSDPIDANVEIPDQTARSAAAQKLKIGIYF  112

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  113  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWA  156



>ref|XP_004491386.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Cicer arietinum]
Length=380

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 16/158 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVS--SV  675
            MIS+V+Q   ++I GS+    K         ++P +   KP R  ++S+ +P+H+S   V
Sbjct  1    MISSVKQPS-MSIIGSNVVLQKKGHSHS---IVPFISREKPQR-CIVSVQKPLHLSCVGV  55

Query  676  ETF-GSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWAL  852
            E F GS++        E+  LVTC+AYEADRS+ +E   A +EAA+KVKIGIYFATWWAL
Sbjct  56   ENFIGSVRV-------ERSDLVTCEAYEADRSE-VEGVGATAEAAKKVKIGIYFATWWAL  107

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFN+YNKKVLNAYP+PWLTSTLSLA  SL+MLISWA
Sbjct  108  NVVFNVYNKKVLNAYPYPWLTSTLSLACASLMMLISWA  145



>gb|KJB13621.1| hypothetical protein B456_002G085200 [Gossypium raimondii]
Length=390

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 12/116 (10%)
 Frame = +1

Query  622  PCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEP-AAKS  798
            P R +VL +++P+H+SSVE+ G           EK+ ++ C AYEAD+S+PIE     KS
Sbjct  43   PKRTNVL-VSKPLHISSVESIGK----------EKKPVIQCNAYEADKSEPIEAAEQVKS  91

Query  799  EAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            EAA++VKIGIYFATWW LNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  92   EAAKRVKIGIYFATWWGLNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  147



>gb|KHN38297.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Glycine 
soja]
Length=396

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 105/163 (64%), Gaps = 18/163 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFR-----PKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHV  666
            MI  V+Q   ++IR SD F      P +P  +  +     LP  K    S++S+ +P+H+
Sbjct  1    MICTVKQPA-ISIRVSDIFLRKKGLPSTPVQSCSIVSPSSLPREKNSLRSLVSVQKPLHL  59

Query  667  SSV---ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFA  837
            S V   +  GSL  R RGD       VTC AYEADRS   E   A S+AA+KVKIGIYFA
Sbjct  60   SRVGFGDFVGSLVRRERGD------FVTCDAYEADRS---EVGGAPSKAAKKVKIGIYFA  110

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            TWW LNVVFNIYNKKVLNA+P+PWLTSTLSLA GSLIML  WA
Sbjct  111  TWWVLNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLIMLFCWA  153



>ref|XP_003519563.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Glycine max]
Length=395

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 105/163 (64%), Gaps = 18/163 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFR-----PKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHV  666
            MI  V+Q   ++IR SD F      P +P  +  +     LP  K    S++S+ +P+H+
Sbjct  1    MICTVKQPA-ISIRVSDIFLRKKGLPSTPVQSCSIVSPSSLPREKNSLRSLVSVQKPLHL  59

Query  667  SSV---ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFA  837
            S V   +  GSL  R RGD       VTC AYEADRS   E   A S+AA+KVKIGIYFA
Sbjct  60   SRVGFGDFVGSLVRRERGD------FVTCDAYEADRS---EVGGAPSKAAKKVKIGIYFA  110

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            TWW LNVVFNIYNKKVLNA+P+PWLTSTLSLA GSLIML  WA
Sbjct  111  TWWVLNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLIMLFCWA  153



>gb|KHG14046.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic -like 
protein [Gossypium arboreum]
Length=388

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 12/109 (11%)
 Frame = +1

Query  640  LSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVK  819
            LS+++P+H+SS+E             +EK+ +  CKAYEAD+SQPIE    KSEAA+++K
Sbjct  49   LSVSKPLHISSIEKI-----------NEKKTVFECKAYEADKSQPIEVEV-KSEAAKRLK  96

Query  820  IGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            IGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  97   IGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  145



>ref|XP_010931815.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Elaeis guineensis]
Length=399

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 109/159 (69%), Gaps = 7/159 (4%)
 Frame = +1

Query  502  MISAVRQ-SGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS+++Q +G L +  +D  R KS  P PKL +LP + A+K    S LS  +P++++S E
Sbjct  1    MISSLKQPAGALGV--TDLVRSKSAVPGPKLAILPSITAVKNPNLS-LSSRKPLYLASPE  57

Query  679  TFGSLKERSRGDDHEKRAL-VTCKAYEADRSQPIE--EPAAKSEAARKVKIGIYFATWWA  849
             FG           + R L    +AYEAD S+ +E  +    S AA+KVKIGIYFATWWA
Sbjct  58   GFGFSSRDGFLSAAKPRGLGFKREAYEADSSENVEISQQETPSAAAQKVKIGIYFATWWA  117

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            LNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  118  LNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWA  156



>ref|XP_002281493.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Vitis vinifera]
 gb|AJV90959.1| GPT1 [Vitis vinifera]
Length=389

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 19/160 (12%)
 Frame = +1

Query  502  MISAVRQS--GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +++QS     A+  SDF++ KSP  +  L          P      S  +P+H++ V
Sbjct  1    MICSIKQSVSSLQALTRSDFYQRKSPVKSLSL----------PSVVGGTSPVKPLHLAPV  50

Query  676  ETFG-SLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAK--SEAARKVKIGIYFATWW  846
               G  L E    D   +R L+ C+AYEADRS+P+E    K  SEAA+KVKIG+YFATWW
Sbjct  51   RGLGFGLIE----DLRVRRPLIRCEAYEADRSEPVESDVVKGRSEAAKKVKIGLYFATWW  106

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  107  ALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWA  146



>gb|KHG27528.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic -like 
protein [Gossypium arboreum]
Length=387

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 90/116 (78%), Gaps = 12/116 (10%)
 Frame = +1

Query  622  PCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEP-AAKS  798
            P R +VL +++P+H+SSVE  G           EK+ ++ C AYEAD+S+PIE     KS
Sbjct  43   PKRTNVL-VSKPLHISSVECTGK----------EKKPIIQCNAYEADKSEPIEAAEQVKS  91

Query  799  EAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            EAA++VKIGIYFATWW LNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  92   EAAKRVKIGIYFATWWGLNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  147



>gb|KJB62604.1| hypothetical protein B456_009G425600 [Gossypium raimondii]
Length=405

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 12/109 (11%)
 Frame = +1

Query  640  LSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVK  819
            LS+++P+H+SS+E             +EK+ +  CKAYEAD+SQPIE    KSEAA+++K
Sbjct  49   LSVSKPLHISSIEKI-----------NEKKPVFECKAYEADKSQPIEVEV-KSEAAKRLK  96

Query  820  IGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            IGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  97   IGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  145



>ref|XP_008784551.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Phoenix dactylifera]
Length=399

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = +1

Query  502  MISAVRQSGPLAIRG-SDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS++ Q  P A  G +D  R KS AP PKL VLP + A+K    S LS  +P++++S E
Sbjct  1    MISSLTQ--PAAAFGVADLVRSKSAAPRPKLDVLPSIAAVKTPNFS-LSSRKPLYLASPE  57

Query  679  TFGSLKERSRGDDHEKRAL-VTCKAYEADRSQPIE--EPAAKSEAARKVKIGIYFATWWA  849
             FG           + R L    +AYEAD S+ +E      +S AA+KVKIGIYFATWWA
Sbjct  58   GFGFSSRDGFLSTAKPRGLGFKREAYEADSSENVEISHQETRSAAAQKVKIGIYFATWWA  117

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            LNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  118  LNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWA  156



>gb|KJB62603.1| hypothetical protein B456_009G425600 [Gossypium raimondii]
Length=388

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 12/109 (11%)
 Frame = +1

Query  640  LSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVK  819
            LS+++P+H+SS+E             +EK+ +  CKAYEAD+SQPIE    KSEAA+++K
Sbjct  49   LSVSKPLHISSIEKI-----------NEKKPVFECKAYEADKSQPIEVEV-KSEAAKRLK  96

Query  820  IGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            IGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  97   IGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  145



>ref|XP_010694203.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 12/160 (8%)
 Frame = +1

Query  499  MMISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV-  675
            MMI++ +Q   ++    D  R KS  P  K     P+ +    R S L + +P+ +S+V 
Sbjct  1    MMITSFKQP-TISFTNPDVLRQKSHIPTSKFANFSPIIS----RKSDLLIQKPLQISTVN  55

Query  676  -ETFGSLKERSRGDDHEKRALVTCKAYEADRSQP--IEEPAAKSEAARKVKIGIYFATWW  846
             +  G     + G   E+++L+ C+AYEADRS+   +E P    EAARKVKIGIYFATWW
Sbjct  56   NKVQGLGFTNNFGLLRERKSLIKCEAYEADRSESPEVEVPG---EAARKVKIGIYFATWW  112

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSLIML+SW 
Sbjct  113  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAMGSLIMLVSWG  152



>ref|XP_009408271.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=393

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 107/160 (67%), Gaps = 15/160 (9%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MI AV+QS  LA+  +D  RPKS   AP++ +LP + A K      LS  +P+ + S+E 
Sbjct  1    MIYAVKQSA-LALGAADLVRPKSLLAAPRISILPSICAAKNSNFQ-LSTRKPLSLPSLEG  58

Query  682  FG---SLKERSRGDDHEKRALVTCKAYEADRSQPIE--EPAAKSEAARKVKIGIYFATWW  846
             G    +K R  G   E        A+EADRS+ IE     A+S A +K++IGIYFATWW
Sbjct  59   LGFPSVVKPRGLGFKRE--------AFEADRSENIEISHQEARSAAGQKLRIGIYFATWW  110

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  111  ALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLVSWA  150



>dbj|BAD91175.1| plastidic glucose 6-phoaphate/phosphate translocator2 [Mesembryanthemum 
crystallinum]
Length=388

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 96/134 (72%), Gaps = 17/134 (13%)
 Frame = +1

Query  577  PAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYE  756
            P  +    P LP+ K    S LS+ +P+HV+S+     LK R        + LV C AYE
Sbjct  25   PKTEQLSFPNLPSSKHEEISHLSVTKPLHVASL-----LKPR--------KHLVECNAYE  71

Query  757  ADRSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstl  924
            A+RSQP    IE P+ KSE A++VKIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTL
Sbjct  72   ANRSQPLDINIELPSVKSETAKRVKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTL  131

Query  925  slaagslIMLISWA  966
            SLAAGSL+MLISWA
Sbjct  132  SLAAGSLMMLISWA  145



>ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula]
Length=1051

 Score =   127 bits (319),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 88/160 (55%), Positives = 103/160 (64%), Gaps = 16/160 (10%)
 Frame = +1

Query  502  MISAVR--QSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPAL-KPCRGSVLSLARPVHVSS  672
            MIS V+   S P    GS  F P+     PKLC LP +  + K      LS  +P+++SS
Sbjct  1    MISQVKYTSSLPFTNFGSSNFIPR-----PKLCTLPIVQHVGKNTNNLSLSSLKPLYISS  55

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEE--PAAKSEAARKVKIGIYFATWW  846
             E F      S       R    C AYEADRSQP+E     A  +AA+K+KIG+YFATWW
Sbjct  56   TENF------SFSTTKLTRRETECHAYEADRSQPLEINIDIAGEQAAQKLKIGLYFATWW  109

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSLIMLISWA
Sbjct  110  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLIMLISWA  149



>ref|XP_008385998.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Malus domestica]
Length=398

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 101/162 (62%), Gaps = 16/162 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  675
            MI +V Q   +   GS+ F  R   P    +  + P L   K  R  V S+ R +H S +
Sbjct  1    MIXSVXQYSAVT-NGSBIFLRRSTRPTQVQRSLLFPSLQXQKTQR-XVXSVQRALHXSXI  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA------AKSEAARKVKIGIYFA  837
             +   L + +R   ++      C+A+EADRSQPIE         AK EAA+K+KIG+YFA
Sbjct  59   GSLVGLXKPTRTSVNK------CQAFEADRSQPIESNVDIANVDAKVEAAKKLKIGVYFA  112

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
             WWALNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIML+SW
Sbjct  113  MWWALNVVFNIYNKKVLNAYPFPWLTSTLSLACGSLIMLVSW  154



>gb|AES92596.2| glucose 6-phosphate/phosphate translocator 1 [Medicago truncatula]
Length=1029

 Score =   127 bits (318),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 88/160 (55%), Positives = 103/160 (64%), Gaps = 16/160 (10%)
 Frame = +1

Query  502  MISAVR--QSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPAL-KPCRGSVLSLARPVHVSS  672
            MIS V+   S P    GS  F P+     PKLC LP +  + K      LS  +P+++SS
Sbjct  1    MISQVKYTSSLPFTNFGSSNFIPR-----PKLCTLPIVQHVGKNTNNLSLSSLKPLYISS  55

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEE--PAAKSEAARKVKIGIYFATWW  846
             E F      S       R    C AYEADRSQP+E     A  +AA+K+KIG+YFATWW
Sbjct  56   TENF------SFSTTKLTRRETECHAYEADRSQPLEINIDIAGEQAAQKLKIGLYFATWW  109

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSLIMLISWA
Sbjct  110  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLIMLISWA  149



>ref|XP_010665533.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=390

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 90/115 (78%), Gaps = 13/115 (11%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI----EEPAAKSE  801
            S +S+ +P+HVSS+     LK+R        + LV C AYEA+ SQPI    E P+ +SE
Sbjct  42   SNISITKPLHVSSLSN-SLLKQR--------KNLVECNAYEANHSQPIDINIELPSVQSE  92

Query  802  AARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            AA++VKIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+MLISWA
Sbjct  93   AAQRVKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMLISWA  147



>ref|XP_002518517.1| Glucose-6-phosphate/phosphate translocator 2, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF43904.1| Glucose-6-phosphate/phosphate translocator 2, chloroplast precursor, 
putative [Ricinus communis]
Length=399

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 105/164 (64%), Gaps = 20/164 (12%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCR-----GSVLSLARPVHV  666
            MIS++  +    I  SDF   K+    P+     PLP +          S LS  +P+H+
Sbjct  4    MISSLNYTHTTFI-SSDFLPRKTSLLKPQFS---PLPIIHNSHRNQIFNSSLSSDKPLHI  59

Query  667  SSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVKIGIYF  834
            SS+E F   K+     +  + +L  C AYEADRS+P    IE P    +AA+K+KIG+YF
Sbjct  60   SSLENFTFSKK-----NQSRDSLTVCNAYEADRSRPLDINIELP--DEQAAQKIKIGVYF  112

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  113  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLISWA  156



>ref|XP_007153924.1| hypothetical protein PHAVU_003G076600g [Phaseolus vulgaris]
 gb|ESW25918.1| hypothetical protein PHAVU_003G076600g [Phaseolus vulgaris]
Length=389

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 97/149 (65%), Gaps = 13/149 (9%)
 Frame = +1

Query  538  IRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDD  717
            ++ S +      +P  +LC LP +  L+      +S  +P+H+SS   F    E      
Sbjct  5    VKYSAYLLTNPASPRSQLCTLPSIHNLQHTNQPSMSSLKPLHISSAHNFALPPEL-----  59

Query  718  HEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFATWWALNVVFNIYNK  879
              +R +  C+AYEADRS+P+E      +  A +E  +++KIG+YFATWWALNVVFNIYNK
Sbjct  60   --RRRVTACQAYEADRSRPLELNIELSDEEAGTETTQRLKIGLYFATWWALNVVFNIYNK  117

Query  880  KVLNAYPFPWltstlslaagslIMLISWA  966
            KVLNA+P+PWL STLSLAAGSL+MLISWA
Sbjct  118  KVLNAFPYPWLISTLSLAAGSLMMLISWA  146



>ref|XP_011628432.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Amborella trichopoda]
Length=394

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 16/161 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MIS    + P A   S   + +SP   P      PL   KP + S+ +  +P+++S++ +
Sbjct  1    MISLKHSAAPAA---SHLIQQRSPLKNPGSSSFAPLLPAKPSKSSMFT-GKPLYISAIRS  56

Query  682  FGSLKE-RSRGDDHEKRALVTCKAYEADRSQPIEEPAA-----KSEAARKVKIGIYFATW  843
              +  E +SRG        V C+AYEADRS+P+ E        +SEAA+K+KIGIYFATW
Sbjct  57   LCACTEQKSRGLK------VKCQAYEADRSEPLREIHVPDIQQRSEAAQKLKIGIYFATW  110

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+M++SWA
Sbjct  111  WALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMILSWA  151



>gb|ERN19519.1| hypothetical protein AMTR_s00062p00036220 [Amborella trichopoda]
Length=403

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 16/161 (10%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MIS    + P A   S   + +SP   P      PL   KP + S+ +  +P+++S++ +
Sbjct  1    MISLKHSAAPAA---SHLIQQRSPLKNPGSSSFAPLLPAKPSKSSMFT-GKPLYISAIRS  56

Query  682  FGSLKE-RSRGDDHEKRALVTCKAYEADRSQPIEEPAA-----KSEAARKVKIGIYFATW  843
              +  E +SRG        V C+AYEADRS+P+ E        +SEAA+K+KIGIYFATW
Sbjct  57   LCACTEQKSRGLK------VKCQAYEADRSEPLREIHVPDIQQRSEAAQKLKIGIYFATW  110

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+M++SWA
Sbjct  111  WALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMILSWA  151



>ref|XP_007142250.1| hypothetical protein PHAVU_008G265100g [Phaseolus vulgaris]
 gb|ESW14244.1| hypothetical protein PHAVU_008G265100g [Phaseolus vulgaris]
Length=397

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 104/162 (64%), Gaps = 15/162 (9%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKP---CRGSVLSLARPVHVS  669
            MIS V Q   ++I  SD   R K PA          +PA  P      S+ S+ +P+H+S
Sbjct  1    MISTVIQPA-ISIGASDVLLRQKGPALTSGHSCSLVVPASHPREKTLRSLFSVQKPLHLS  59

Query  670  SV---ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFAT  840
             V      GS   R RGD      L TC+AYEA+R + +E     SEAA+KVKIGIYFAT
Sbjct  60   CVGLGNFVGSPVRRERGD------LGTCRAYEAERPE-VEGAGDPSEAAKKVKIGIYFAT  112

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+MLISWA
Sbjct  113  WWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWA  154



>ref|XP_009617374.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Nicotiana tomentosiformis]
Length=387

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 100/158 (63%), Gaps = 19/158 (12%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            M  +++QS PL+I  SDF   +       L  LP +  ++ C     S  +P+++S V  
Sbjct  1    MACSIKQS-PLSITPSDFIPKRGFNFNSNLGFLPKIK-IQNCD---FSTKKPLYISCVTK  55

Query  682  FGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWA  849
            FGS+           R    CKAYEAD+SQP    IE P +   A ++VKI IYFATWWA
Sbjct  56   FGSIS----------RIGTICKAYEADKSQPLDVNIELPKSSEAATQRVKISIYFATWWA  105

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            LNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIML+SW
Sbjct  106  LNVVFNIYNKKVLNAYPFPWLTSTLSLATGSLIMLVSW  143



>ref|XP_004293269.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=402

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 103/162 (64%), Gaps = 15/162 (9%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MIS+VR   P     + F   +  +     C    LP ++  + S+L   +P+H+SS E+
Sbjct  1    MISSVRLRNP-TFTSAQFLSTQKCSLGKAECC--SLPNIQYPKQSMLCFHKPLHISSAES  57

Query  682  FGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFATW  843
            F  + +       +KR    C+AYEADRS+PIE      +  A+ E A+ ++I +YFATW
Sbjct  58   FALVAKT------QKRDSTRCEAYEADRSRPIEINIDLPDQQARKETAQTLRISVYFATW  111

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            WALNVVFNIYNKKVLN +PFPWLTSTLSLA GSL+MLISWA+
Sbjct  112  WALNVVFNIYNKKVLNVFPFPWLTSTLSLATGSLMMLISWAV  153



>ref|XP_002864355.1| glucose-6-phosphate transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40614.1| glucose-6-phosphate transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 109/161 (68%), Gaps = 22/161 (14%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            M+ + +Q+ P  I     FR    +   +  V    P+ +  + +VL++++P+H+SS+  
Sbjct  1    MVLSAKQTLPTKI---GLFRRNPSSSLRRSPVSLSFPSTELPKRTVLAVSKPLHLSSLR-  56

Query  682  FGSLKERSRGDDHEKRALVTCKAYEADRS--QPIEEPAA---KSEAARKVKIGIYFATWW  846
                          K  +V C+AYEADRS  QPI++ AA   KSEAA+K+KIGIYFATWW
Sbjct  57   -------------AKSPVVRCEAYEADRSEPQPIDDAAAAETKSEAAKKLKIGIYFATWW  103

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            ALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  104  ALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  144



>emb|CDY06630.1| BnaC02g13540D [Brassica napus]
Length=452

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 109/162 (67%), Gaps = 22/162 (14%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPP---LPALKPCRGSVLSLARPVHVSS  672
            M+ A +Q+    I  S+    ++P P+P L   PP    P+    + +VLSL+RP+H+SS
Sbjct  1    MVLAAKQTLSAKIGFSNPLLRRNP-PSPSLQRPPPSLSFPSTALPKRTVLSLSRPLHLSS  59

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRS--QPIEEPA-AKSEAARKVKIGIYFATW  843
            +                  + V C AYEAD+S  QPI+  A  KSEAA+K+KIGIYFATW
Sbjct  60   LRA---------------ESPVRCSAYEADKSEPQPIDAAAETKSEAAKKLKIGIYFATW  104

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            WALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  105  WALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  146



>ref|XP_006600314.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Glycine max]
Length=392

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 95/139 (68%), Gaps = 16/139 (12%)
 Frame = +1

Query  568  SPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCK  747
            S  P P+LC LP +  ++      LS  +P+++SS + F             +R +  C+
Sbjct  21   SHVPRPQLCALPSVHNVQQSTQPSLSSLKPLYISSTQNFA----------FRRRRVPECQ  70

Query  748  AYEADRSQPIE------EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPW  909
            AYEADRS+P+E      +  A  EA +++KIG+YFATWWALNVVFNIYNKKVLNA+P+PW
Sbjct  71   AYEADRSRPLELNIELPDEEAGIEATQRIKIGLYFATWWALNVVFNIYNKKVLNAFPYPW  130

Query  910  ltstlslaagslIMLISWA  966
            LTSTLSLAAGSL+MLISWA
Sbjct  131  LTSTLSLAAGSLMMLISWA  149



>ref|XP_009412013.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=399

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 104/160 (65%), Gaps = 9/160 (6%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLA--RPVHVSSV  675
            MIS+V+ S   AI  +D  R  S    P++  +P + A K   G  LSLA  +P+++ S 
Sbjct  1    MISSVKHSSA-AIGVTDLVRRGSSPVRPQMASIPLISATK---GPNLSLATRKPLYLVSP  56

Query  676  ETFGSLKERSRGDDHEKRAL-VTCKAYEADRSQPIEEPA--AKSEAARKVKIGIYFATWW  846
            E FG           E R   + C AYEADRS  +E      +S A++KVKIGIYFATWW
Sbjct  57   EGFGFGSRDGFMSAAEPRGFALRCGAYEADRSDSVEISGEETRSAASQKVKIGIYFATWW  116

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  117  ALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWA  156



>ref|XP_012091392.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Jatropha curcas]
 gb|KDP20779.1| hypothetical protein JCGZ_21250 [Jatropha curcas]
Length=396

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 104/164 (63%), Gaps = 20/164 (12%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCR-----GSVLSLARPVHV  666
            MIS++  + P A   SDF   K  A  P+     PLP ++  +      + L   +P+H+
Sbjct  1    MISSLNHT-PSAFTSSDFLPRKRSALRPQSS---PLPIIQNSQKGFSFDTSLISEKPLHI  56

Query  667  SSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVKIGIYF  834
            S+VE F            +K  L  C AYEADRS+P    IE P    +AA+++KIGIYF
Sbjct  57   STVENF-----TFAAKSGQKNPLTVCSAYEADRSRPLDINIELP--DEQAAQRIKIGIYF  109

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  110  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLISWA  153



>ref|XP_009420544.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=399

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MIS+V+QS   AI  +D    KSP+  P++  + PL A++    S+L+  +P++++S E 
Sbjct  1    MISSVKQSSA-AIGVADLVGRKSPSLRPRIASVAPLSAIRSPSLSLLT-RKPLYLASPEG  58

Query  682  FGSLKERSRGDDHEKRAL-VTCKAYEADRSQPIE--EPAAKSEAARKVKIGIYFATWWAL  852
            F            + R L   C+AYEAD S+ +E     ++S  A+KVKIGIYFATWWAL
Sbjct  59   FVFGFRDGIVSAAKPRGLAFKCEAYEADGSENVEVSHQESRSATAQKVKIGIYFATWWAL  118

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA
Sbjct  119  NVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWA  156



>gb|KHG03254.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic -like 
protein [Gossypium arboreum]
Length=397

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 106/165 (64%), Gaps = 21/165 (13%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSV----LSLARPVHVS  669
            M+S+++ S P +   + F   +   P P+     PLP +K    +      S  +P+HV+
Sbjct  1    MLSSIKLS-PSSFTSTGFLPKRRSIPTPQFS---PLPIIKSLHSAFPTQSFSSQKPLHVA  56

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIY  831
            S++        S+     K     C+AYEADRS+P++      +  A+ EAA+++KIGIY
Sbjct  57   SIDNLA----ISKNTQQRK---TECQAYEADRSRPLDINIELPDEDARLEAAKRIKIGIY  109

Query  832  FATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            FATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSL+ML+SWA
Sbjct  110  FATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLLMLVSWA  154



>gb|KHN03459.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=560

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 95/139 (68%), Gaps = 16/139 (12%)
 Frame = +1

Query  568  SPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCK  747
            S  P P+LC LP +  ++      LS  +P+++SS + F             +R +  C+
Sbjct  19   SHVPRPQLCALPSVHNVQQSTQPSLSSLKPLYISSTQNFA----------FRRRRVPECQ  68

Query  748  AYEADRSQPIE------EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPW  909
            AYEADRS+P+E      +  A  EA +++KIG+YFATWWALNVVFNIYNKKVLNA+P+PW
Sbjct  69   AYEADRSRPLELNIELPDEEAGIEATQRIKIGLYFATWWALNVVFNIYNKKVLNAFPYPW  128

Query  910  ltstlslaagslIMLISWA  966
            LTSTLSLAAGSL+MLISWA
Sbjct  129  LTSTLSLAAGSLMMLISWA  147



>gb|AAF86908.1|AF223360_1 glucose-6P/phosphate translocator precursor [Mesembryanthemum 
crystallinum]
Length=395

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 102/159 (64%), Gaps = 11/159 (7%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MI+ ++Q   ++    D  R K   P  +     PL      R S L + +P+HVSSV+ 
Sbjct  1    MITTLKQP-TISFSNPDVLRKKFQVPTSQFASFAPLIR----RKSDLLIQKPLHVSSVKG  55

Query  682  FGSLKERSRGDDHEKRALVTCKAYEADRSQPIE-EPA---AKSEAARKVKIGIYFATWWA  849
                     G   E++ L+ C+AYEAD S+PI+ EP       EAARKVKIGIYFA WWA
Sbjct  56   --LGFGLGDGLLRERKPLIKCEAYEADGSEPIKPEPVPVPIPGEAARKVKIGIYFAVWWA  113

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            LNVVFNIYNKKVLNA+P+PWLTSTLSLA GSLIM++SWA
Sbjct  114  LNVVFNIYNKKVLNAFPYPWLTSTLSLAMGSLIMVVSWA  152



>emb|CDP11791.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = +1

Query  613  ALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI-----  777
            A++ C    L   +P+++S+V  FG + E S+     + +LV C AYEA RSQPI     
Sbjct  39   AVRKCDNINLLSRKPLYISAVRNFGYIDE-SKETSKPRGSLVQCNAYEARRSQPIPISIE  97

Query  778  EEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
             +  A+  AA+K+KIGIYFATWW+LNV+FNIYNKKVLNA+PFPWLTSTLSLAAGSL+ML+
Sbjct  98   FDEEAQQAAAQKLKIGIYFATWWSLNVIFNIYNKKVLNAFPFPWLTSTLSLAAGSLLMLV  157

Query  958  SWA  966
            SWA
Sbjct  158  SWA  160



>ref|XP_010092109.1| Glucose-6-phosphate/phosphate translocator 1 [Morus notabilis]
 gb|EXB50260.1| Glucose-6-phosphate/phosphate translocator 1 [Morus notabilis]
Length=470

 Score =   119 bits (298),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 111/156 (71%), Gaps = 19/156 (12%)
 Frame = +1

Query  514  VRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSL  693
            V+Q  P    G  F RPK  +P PK   LP LP+L   R   +S+ +P+HVS++ T  SL
Sbjct  78   VKQFSP----GGVFLRPKPFSPTPK--SLPSLPSL---RRLTVSVQKPLHVSTITTTSSL  128

Query  694  KERSRGDDHEKRALVTCKAYEADRSQPIEEPAA-----KSEAARKVKIGIYFATWWALNV  858
              +       KR+L+ C AYEADRS+PIEE AA     +SEAA+KVKIG+YFA WW+LNV
Sbjct  129  SPKP-----TKRSLIECGAYEADRSKPIEEIAAPEAAARSEAAKKVKIGVYFAMWWSLNV  183

Query  859  VFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VFNIYNKKVLNAYP+PWLTSTLSLA GSLIMLISWA
Sbjct  184  VFNIYNKKVLNAYPYPWLTSTLSLACGSLIMLISWA  219



>ref|XP_010538047.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=389

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 14/122 (11%)
 Frame = +1

Query  607  LPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRS--QPIE  780
             PA +  + + L+++RP+++SS+                K++ + C AYEADRS  QPI+
Sbjct  37   FPATELPKRTALAVSRPLYLSSLV------------PRRKKSPMRCDAYEADRSEPQPID  84

Query  781  EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLIS  960
               AKSEAA++VKIG+YFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSLIML+S
Sbjct  85   AATAKSEAAKRVKIGVYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLIMLVS  144

Query  961  WA  966
            WA
Sbjct  145  WA  146



>gb|AAM63660.1| glucose-6-phosphate/phosphate translocator [Arabidopsis thaliana]
Length=388

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 19/127 (15%)
 Frame = +1

Query  607  LPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP--IE  780
             P+ +  + +VL++++P+H+SS     SLK +S         +V C+AYEADRS+P  I 
Sbjct  33   FPSTELPKRTVLAVSKPLHLSS-----SLKAKS--------PVVRCEAYEADRSEPHPIG  79

Query  781  EPAA----KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslI  948
            + AA    KSEAA+K+KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+
Sbjct  80   DDAAAAETKSEAAKKLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLM  139

Query  949  MLISWAL  969
            MLISWA+
Sbjct  140  MLISWAV  146



>gb|AJV90961.1| GPT2-b [Vitis vinifera]
Length=252

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 105/165 (64%), Gaps = 23/165 (14%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSL---ARPVHVSS  672
            MIS+++QS     R  DF       P  + CV        P   +V      A+P+++ S
Sbjct  1    MISSIKQSTGSFTR-CDFL------PRRQRCVAKSDVVSVPSSANVQGFKCSAKPLYICS  53

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYF  834
            VE FGS            ++   C+AYEA+RSQP++      +  A+SEAA+K+KIGIYF
Sbjct  54   VEGFGSRSI-------GSKSSSVCRAYEAERSQPLDLNIELSDQEARSEAAQKLKIGIYF  106

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA+
Sbjct  107  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWAV  151



>gb|KHN33046.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=396

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 104/158 (66%), Gaps = 13/158 (8%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRG-SVLSLARPVHVSSVE  678
            MIS+++ +   ++  S F   K P   P+L  LP +  ++   G S L   +P+++SS E
Sbjct  1    MISSMKCTAS-SLTCSAFSNRKIPIARPQLVTLPTINNVEQNTGLSQLCSQKPLYLSSTE  59

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAA--KSEAARKVKIGIYFATWWAL  852
                +K R   +         C+AYEADRS+P+E        EAA++ KIG+YFATWWAL
Sbjct  60   NLALVKRRRETE---------CQAYEADRSRPLEINIELPGEEAAQRFKIGLYFATWWAL  110

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+ML+SWA
Sbjct  111  NVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMLVSWA  148



>ref|XP_006594434.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Glycine max]
Length=391

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 17/160 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRG-SVLSLARPVHVSSVE  678
            MIS+++ +   ++  S F   K P   P+L  LP +  ++   G S L   +P+++SS E
Sbjct  1    MISSMKCTAS-SLTCSAFSNRKLPIARPQLVTLPTINNVEQNMGPSQLCSQKPLYLSSTE  59

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVKIGIYFATWW  846
                ++         +R +  C+AYEADRS+P    IE PA   EAA++ KIG+YFATWW
Sbjct  60   NLALVR---------RRRVTECQAYEADRSRPLEINIELPA--EEAAQRFKIGVYFATWW  108

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+ML+SWA
Sbjct  109  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMLVSWA  148



>ref|XP_006401535.1| hypothetical protein EUTSA_v10013772mg [Eutrema salsugineum]
 gb|ESQ42988.1| hypothetical protein EUTSA_v10013772mg [Eutrema salsugineum]
Length=389

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 20/125 (16%)
 Frame = +1

Query  607  LPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRS--QPIE  780
             P+ +  + + L+L++P+H+SS+                 ++ V C+AYEAD+S  QPI+
Sbjct  37   FPSTELPKRTALALSKPLHISSLRA---------------KSPVRCEAYEADKSEPQPID  81

Query  781  EPAA---KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIM  951
            + AA   KSEAA+K+KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+M
Sbjct  82   DSAAAETKSEAAKKLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMM  141

Query  952  LISWA  966
            LISWA
Sbjct  142  LISWA  146



>dbj|BAB08759.1| glucose-6-phosphate/phosphate translocator [Arabidopsis thaliana]
Length=391

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 19/127 (15%)
 Frame = +1

Query  607  LPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP--IE  780
             P+ +  + +VL++++P+H+SS     SL+ +S         +V C+AYEADRS+P  I 
Sbjct  33   FPSTELPKRTVLAVSKPLHLSS-----SLRAKS--------PVVRCEAYEADRSEPHPIG  79

Query  781  EPAA----KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslI  948
            + AA    KSEAA+K+KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+
Sbjct  80   DDAAAAETKSEAAKKLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLM  139

Query  949  MLISWAL  969
            MLISWA+
Sbjct  140  MLISWAV  146



>ref|NP_568812.1| glucose-6-phosphate/phosphate translocator 1 [Arabidopsis thaliana]
 sp|Q9M5A9.1|GPT1_ARATH RecName: Full=Glucose-6-phosphate/phosphate translocator 1, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF42936.1|AF233658_1 glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana]
 gb|AAL15310.1| AT5g54800/MBG8_6 [Arabidopsis thaliana]
 gb|AAN72224.1| At5g54800/MBG8_6 [Arabidopsis thaliana]
 dbj|BAE98621.1| glucose-6-phosphate/phosphate translocator [Arabidopsis thaliana]
 gb|AED96542.1| glucose-6-phosphate/phosphate translocator 1 [Arabidopsis thaliana]
Length=388

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 19/127 (15%)
 Frame = +1

Query  607  LPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP--IE  780
             P+ +  + +VL++++P+H+SS     SL+ +S         +V C+AYEADRS+P  I 
Sbjct  33   FPSTELPKRTVLAVSKPLHLSS-----SLRAKS--------PVVRCEAYEADRSEPHPIG  79

Query  781  EPAA----KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslI  948
            + AA    KSEAA+K+KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+
Sbjct  80   DDAAAAETKSEAAKKLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLM  139

Query  949  MLISWAL  969
            MLISWA+
Sbjct  140  MLISWAV  146



>ref|XP_002266056.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Vitis vinifera]
 emb|CBI23184.3| unnamed protein product [Vitis vinifera]
 gb|AJV90960.1| GPT2-a [Vitis vinifera]
Length=393

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 105/165 (64%), Gaps = 23/165 (14%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSL---ARPVHVSS  672
            MIS+++QS     R  DF       P  + CV        P   +V      A+P+++ S
Sbjct  1    MISSIKQSTGSFTR-CDFL------PRRQRCVAKSDVVSVPSSANVQGFKCSAKPLYICS  53

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYF  834
            VE FGS            ++   C+AYEA+RSQP++      +  A+SEAA+K+KIGIYF
Sbjct  54   VEGFGSRSI-------GSKSSSVCRAYEAERSQPLDLNIELSDQEARSEAAQKLKIGIYF  106

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA+
Sbjct  107  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWAV  151



>ref|XP_009589013.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=401

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = +1

Query  613  ALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI-----  777
            AL+ C  + +   +P+++S+V  FG++ E       +K  LV C AYEA R Q I     
Sbjct  38   ALQKCDKTNILSKKPLYISAVSGFGNVDESKESKSRDK--LVQCNAYEASRPQSIPISIE  95

Query  778  EEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
             +   +  AA+K+KIG+YFATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSLIML+
Sbjct  96   FDQETQDAAAQKLKIGLYFATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLV  155

Query  958  SWA  966
            SWA
Sbjct  156  SWA  158



>gb|KJB67150.1| hypothetical protein B456_010G178300 [Gossypium raimondii]
Length=397

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 105/165 (64%), Gaps = 21/165 (13%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSV----LSLARPVHVS  669
            M+S+++ S P +   + F   +   P P+     PLP +K    +      S  +P+ V+
Sbjct  1    MLSSIKLS-PSSFTSTGFLPNRRSIPTPQFS---PLPIIKSLHSAFPTHSFSSQKPLQVA  56

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIY  831
            S++        S+     K     C+AYEADRS+P++      +  A+ EAA+++KIGIY
Sbjct  57   SIDNLA----ISKNTQQRK---TECQAYEADRSRPLDIKIELPDEDARLEAAKRIKIGIY  109

Query  832  FATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            FATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSL+MLISWA
Sbjct  110  FATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLLMLISWA  154



>gb|KJB67151.1| hypothetical protein B456_010G178300 [Gossypium raimondii]
Length=397

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 105/165 (64%), Gaps = 21/165 (13%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSV----LSLARPVHVS  669
            M+S+++ S P +   + F   +   P P+     PLP +K    +      S  +P+ V+
Sbjct  1    MLSSIKLS-PSSFTSTGFLPNRRSIPTPQFS---PLPIIKSLHSAFPTHSFSSQKPLQVA  56

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIY  831
            S++        S+     K     C+AYEADRS+P++      +  A+ EAA+++KIGIY
Sbjct  57   SIDNLA----ISKNTQQRK---TECQAYEADRSRPLDIKIELPDEDARLEAAKRIKIGIY  109

Query  832  FATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            FATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSL+MLISWA
Sbjct  110  FATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLLMLISWA  154



>gb|KEH36805.1| glucose-6-phosphate/phosphate translocator-like protein [Medicago 
truncatula]
Length=396

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGS-VLSLARPVHVSSVE  678
            MIS+++ +   +   S+F   K P P  +  +LP +  ++      +LS  +P+++SS +
Sbjct  1    MISSIKCTSTSSFTSSNFTSTKLPLPRSQFSILPTIQNVEQNMSLPLLSSKKPLYLSSTQ  60

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAA--KSEAARKVKIGIYFATWWAL  852
             F  L +  R +  E      C+AYEADRS+P+E        EAA+K+KIG+YFATWWAL
Sbjct  61   NFALLTKPKRKNVTE------CQAYEADRSRPLEINIELPSEEAAQKLKIGLYFATWWAL  114

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+MLISWA
Sbjct  115  NVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMLISWA  152



>gb|AJV90962.1| GPT2-c [Vitis vinifera]
Length=456

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 105/165 (64%), Gaps = 23/165 (14%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSL---ARPVHVSS  672
            MIS+++QS     R  DF       P  + CV        P   +V      A+P+++ S
Sbjct  1    MISSIKQSTGSFTR-CDFL------PRRQRCVAKSDVVSVPSSANVQGFKCSAKPLYICS  53

Query  673  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYF  834
            VE FGS            ++   C+AYEA+RSQP++      +  A+SEAA+K+KIGIYF
Sbjct  54   VEGFGSRSI-------GSKSSSVCRAYEAERSQPLDLNIELSDQEARSEAAQKLKIGIYF  106

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA+
Sbjct  107  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWAV  151



>gb|EYU24788.1| hypothetical protein MIMGU_mgv1a007856mg [Erythranthe guttata]
Length=393

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 87/124 (70%), Gaps = 11/124 (9%)
 Frame = +1

Query  607  LPALKPCRGS-VLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP---  774
             P L PC+ + +L   +P+++SS   FG  + R   D    R    C AYEA RSQP   
Sbjct  33   FPTLNPCKKNYLLPQHKPLYISSATGFGPARTR---DPFSMR----CNAYEAGRSQPVVP  85

Query  775  IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIML  954
            I     + EAA+K KIG+YFATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSLIML
Sbjct  86   ISIGFDREEAAQKAKIGVYFATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLIML  145

Query  955  ISWA  966
            +SWA
Sbjct  146  VSWA  149



>ref|XP_007026011.1| Glucose-6-phosphate/phosphate translocator 2 [Theobroma cacao]
 gb|EOY28633.1| Glucose-6-phosphate/phosphate translocator 2 [Theobroma cacao]
Length=394

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 103/166 (62%), Gaps = 26/166 (16%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSV----LSLARPVHVS  669
            MIS+++ S  +    + FF  K  +         PL  +K   G       S  +P+H+ 
Sbjct  1    MISSIKHSTSV-FNSTGFFSNKRSSQ------FSPLTVIKNVHGGFPNQSCSYQKPLHIV  53

Query  670  SVETFG-SLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGI  828
            ++E    S K + R  +        C+AYEADRS P++      +  A+ E+A+++KIGI
Sbjct  54   AIENLAISKKTQQRKTE--------CQAYEADRSTPLDINIELPDEEARLESAKRIKIGI  105

Query  829  YFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            YFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+MLISWA
Sbjct  106  YFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMLISWA  151



>emb|CAN68645.1| hypothetical protein VITISV_030812 [Vitis vinifera]
Length=391

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 87/113 (77%), Gaps = 13/113 (12%)
 Frame = +1

Query  649  ARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAAR  810
            A+P+++ SVE FGS            ++   C+AYEA+RSQP++      +  A+SEAA+
Sbjct  36   AKPLYICSVEGFGSRSI-------GSKSSSVCRAYEAERSQPLDLNIELSDQEARSEAAQ  88

Query  811  KVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+MLISWA+
Sbjct  89   KLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWAV  141



>gb|KFK27093.1| hypothetical protein AALP_AA8G333200 [Arabis alpina]
Length=385

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 22/118 (19%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRS--QPIEEPAA----K  795
            +VL++ +P+H+S       L+ +S         LV C+AYEAD+S  QPI++ A     K
Sbjct  42   TVLAVTKPLHLS-------LRSKS---------LVRCEAYEADKSEPQPIDDAAEVVEEK  85

Query  796  SEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            SEAA+K+KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  86   SEAAKKLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  143



>ref|XP_009105258.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Brassica rapa]
Length=387

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 89/127 (70%), Gaps = 19/127 (15%)
 Frame = +1

Query  604  PLPALKPCRG--SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP-  774
            PL  +K CR   S +S  +P+H+SS + F S K   R            +AYEADRS+P 
Sbjct  31   PLHIIKSCRNQSSNVSYQKPLHISSAQNFSSFKREVR-----------VEAYEADRSRPL  79

Query  775  ---IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagsl  945
               IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL
Sbjct  80   DINIELP--DEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSL  137

Query  946  IMLISWA  966
            +ML+SWA
Sbjct  138  MMLVSWA  144



>ref|XP_009794775.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=261

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 10/123 (8%)
 Frame = +1

Query  613  ALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI-----  777
            AL+ C  + +   +P+++S+V  FG + E    D      LV C AYEA R Q I     
Sbjct  38   ALQKCDKANILSKKPLYISAVSGFGHVDESKSRDK-----LVQCNAYEASRPQSIPISID  92

Query  778  EEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
             +   +  AA+K+KIG+YFATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSLIML+
Sbjct  93   FDQETQVAAAQKLKIGLYFATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLV  152

Query  958  SWA  966
            SWA
Sbjct  153  SWA  155



>ref|XP_009802193.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=386

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 98/158 (62%), Gaps = 20/158 (13%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            M  +++QS PL+I   DF   +       L  LP    ++ C     S  + +++SSV  
Sbjct  1    MACSIKQS-PLSIT-PDFIPKRGFNFNSNLGFLPK-TKIQNCD---FSTKKHLYISSVTK  54

Query  682  FGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWA  849
            FGS            R    CKAYEAD+SQP    IE P +   AA++VKI IYFATWWA
Sbjct  55   FGSFS----------RIGTICKAYEADKSQPLDVNIELPKSLEAAAQRVKISIYFATWWA  104

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            LNVVFNIYNKKVLNAYPFPWLTSTLSLA GSLIMLISW
Sbjct  105  LNVVFNIYNKKVLNAYPFPWLTSTLSLATGSLIMLISW  142



>ref|XP_006449070.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
 ref|XP_006449071.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
 gb|ESR62310.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
 gb|ESR62311.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
Length=322

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 104/163 (64%), Gaps = 18/163 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALK-PCRGSVLSLARPVHVSSVE  678
            MIS+V+ +       S  F PK     P L    PLP ++     +  S  +P+H+SS +
Sbjct  1    MISSVKHT---PFSASTDFLPKKRFLTPTL-KFSPLPIIQNSIFNNKFSSEKPLHISSTQ  56

Query  679  TFG-SLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFA  837
                S KE+      +K     C AYEADRS+P++      +  A+ EAA+++KIGIYFA
Sbjct  57   NLTFSPKEQ------QKELKTQCNAYEADRSRPLDINIEVLDEQARFEAAQRLKIGIYFA  110

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            TWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  111  TWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWA  153



>gb|KDO75519.1| hypothetical protein CISIN_1g039814mg, partial [Citrus sinensis]
Length=454

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 106/163 (65%), Gaps = 18/163 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALK-PCRGSVLSLARPVHVSSVE  678
            MIS+V+ + P +   S  F PK     P L    PLP ++     +  S  +P+H+SS +
Sbjct  44   MISSVKHT-PFS--ASTDFLPKKRFLTPTLK-FSPLPIIQNSIFNNKFSSEKPLHISSTQ  99

Query  679  TFG-SLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFA  837
                S KE+      +K     C AYEADRS+P++      +  A+ EAA+++KIGIYFA
Sbjct  100  NLTFSPKEQ------QKELKTQCNAYEADRSRPLDINIEVLDEQARFEAAQRLKIGIYFA  153

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            TWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  154  TWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWA  196



>ref|XP_009397167.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397168.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=393

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 103/164 (63%), Gaps = 23/164 (14%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRG-------SVLSLARPV  660
            MI +++ S       +D   PKS    P LC      A   C         S LS  +P+
Sbjct  1    MICSLKSSSSAFAATTDLLPPKSRM-TPTLCF-----ATLRCNSFSPKTPSSSLSSIKPL  54

Query  661  HVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEP--AAKSEAARKVKIGIYF  834
            +++ +E+FGS K R           +  KAYEADRS+ +  P   A++ AA+K+KIGIYF
Sbjct  55   YLTPLESFGSAKPRGMS--------LKAKAYEADRSESVAFPDHEARAAAAQKLKIGIYF  106

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSLIML+SWA
Sbjct  107  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLIMLLSWA  150



>ref|XP_006449072.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
 ref|XP_006467999.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Citrus sinensis]
 gb|ESR62312.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
Length=396

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 106/163 (65%), Gaps = 18/163 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALK-PCRGSVLSLARPVHVSSVE  678
            MIS+V+ + P +   S  F PK     P L    PLP ++     +  S  +P+H+SS +
Sbjct  1    MISSVKHT-PFS--ASTDFLPKKRFLTPTLK-FSPLPIIQNSIFNNKFSSEKPLHISSTQ  56

Query  679  TFG-SLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFA  837
                S KE+      +K     C AYEADRS+P++      +  A+ EAA+++KIGIYFA
Sbjct  57   NLTFSPKEQ------QKELKTQCNAYEADRSRPLDINIEVLDEQARFEAAQRLKIGIYFA  110

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            TWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  111  TWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWA  153



>ref|XP_003547247.2| PREDICTED: beta-glucosidase 47-like [Glycine max]
Length=929

 Score =   116 bits (291),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 104/158 (66%), Gaps = 13/158 (8%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRG-SVLSLARPVHVSSVE  678
            MIS+++ +   ++  S F   K P   P+L  LP +  ++   G S L   +P+++SS E
Sbjct  1    MISSMKCTAS-SLTCSAFSNRKIPIARPQLVTLPTINNVEQNTGLSQLCSQKPLYLSSTE  59

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAA--KSEAARKVKIGIYFATWWAL  852
                +K R   +         C+AYEADRS+P+E        EAA++ KIG+YFATWWAL
Sbjct  60   NLALVKRRRETE---------CQAYEADRSRPLEINIELPGEEAAQRFKIGLYFATWWAL  110

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+ML+SWA
Sbjct  111  NVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMLVSWA  148



>ref|XP_008778019.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Phoenix dactylifera]
Length=399

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = +1

Query  559  RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRAL-  735
            R KSPAP  +L +LP + A+K  + SV S  +P++++S +  G         D + R L 
Sbjct  19   RSKSPAPRSQLAILPSICAVKNPKLSVSS-RKPLYLASPDGSGFGYRDGVLSDTKPRGLG  77

Query  736  VTCKAYEADRSQPIE--EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPW  909
               +AY+ADRS+ +E      +S A +KVKIGIYFATWWALNVVFNIYNKKVLNA+P+PW
Sbjct  78   FKREAYQADRSENVEISHGETRSAAGQKVKIGIYFATWWALNVVFNIYNKKVLNAFPYPW  137

Query  910  ltstlslaagslIMLISWA  966
             TSTLSLA GS++ML SWA
Sbjct  138  FTSTLSLATGSVMMLASWA  156



>emb|CDY43022.1| BnaA03g11690D [Brassica napus]
Length=390

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 22/125 (18%)
 Frame = +1

Query  604  PLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRS---QP  774
            P PAL P R +VL+L++P+H+SS+                 ++ V C A+EAD+S   QP
Sbjct  38   PSPAL-PKR-TVLTLSKPLHLSSLRA---------------KSPVRCSAHEADKSEPPQP  80

Query  775  IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIML  954
            I++   KSEAA+K KIG+YFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+ML
Sbjct  81   IDD--TKSEAAKKAKIGVYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMML  138

Query  955  ISWAL  969
            ISWA+
Sbjct  139  ISWAV  143



>ref|XP_004486132.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cicer arietinum]
Length=387

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 95/136 (70%), Gaps = 9/136 (7%)
 Frame = +1

Query  565  KSPAPAPKLCVLPPLPALKPCRG-SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVT  741
            K P   P++  LP +  ++     S+LS  +P+++SS E F  L + +R      + +  
Sbjct  14   KLPLQRPQISNLPTIQNVEQNMSLSLLSSKKPLYLSSTENFALLTKPNR------KNVTL  67

Query  742  CKAYEADRSQPIEEPAA--KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlt  915
            C+AYEADRS+P+E        E A+++KIG+YFATWWALNVVFNIYNKKVLN +P+PWLT
Sbjct  68   CQAYEADRSRPLEINIELPNEEEAQRLKIGLYFATWWALNVVFNIYNKKVLNVFPYPWLT  127

Query  916  stlslaagslIMLISW  963
            STLSLAAGSLIMLISW
Sbjct  128  STLSLAAGSLIMLISW  143



>ref|XP_006449073.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
 gb|ESR62313.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
Length=451

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 104/163 (64%), Gaps = 18/163 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALK-PCRGSVLSLARPVHVSSVE  678
            MIS+V+ +       S  F PK     P L    PLP ++     +  S  +P+H+SS +
Sbjct  1    MISSVKHT---PFSASTDFLPKKRFLTPTLK-FSPLPIIQNSIFNNKFSSEKPLHISSTQ  56

Query  679  TFG-SLKERSRGDDHEKRALVTCKAYEADRSQPIE------EPAAKSEAARKVKIGIYFA  837
                S KE+      +K     C AYEADRS+P++      +  A+ EAA+++KIGIYFA
Sbjct  57   NLTFSPKEQ------QKELKTQCNAYEADRSRPLDINIEVLDEQARFEAAQRLKIGIYFA  110

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            TWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  111  TWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWA  153



>ref|XP_007026012.1| Glucose-6-phosphate/phosphate translocator 2 isoform 1 [Theobroma 
cacao]
 gb|EOY28634.1| Glucose-6-phosphate/phosphate translocator 2 isoform 1 [Theobroma 
cacao]
Length=387

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 97/158 (61%), Gaps = 19/158 (12%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSV----LSLARPVHVS  669
            MIS+++ S   A   + FF  K     P+     PLP +K           S  +P+HV+
Sbjct  1    MISSIKHSTS-AFNSTSFFSKKRSITRPQFS---PLPVIKNVHNGFPNQSCSYQKPLHVA  56

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWA  849
            ++E    LK+  +         + C+AYEADRS+P++      E    +KIGIYFATWWA
Sbjct  57   AIENLAILKKTQQRK-------IECQAYEADRSRPLDINIELPE----IKIGIYFATWWA  105

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            LNVVFNIYNKKVLN +P+PWLTSTLSLAAGSL+MLISW
Sbjct  106  LNVVFNIYNKKVLNVFPYPWLTSTLSLAAGSLMMLISW  143



>gb|ACV60359.1| putative glucose-6-phosphate/phosphate translocator [Camellia 
sinensis]
Length=401

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 100/148 (68%), Gaps = 12/148 (8%)
 Frame = +1

Query  547  SDFFRPKSPAPAPKLCVLPPLPAL--KPCRGSVLSLARPVHV-SSVETFGSLKERSRGDD  717
            S+ F+P+S A  P+   LP  P+   K    + L   +P+H+ SS+  F +  E +  + 
Sbjct  15   SNHFQPQSLASKPQ--NLPTFPSNFDKKLAKTNLLAPKPLHILSSLPGFKNFDESN--NT  70

Query  718  HEKRALVTCKAYEADRSQPIE-----EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKK  882
              + +LV CKAYEA   QPI+     +   +  AA+K+KIG+YFATWWALNV+FNIYNKK
Sbjct  71   KPRDSLVPCKAYEAHHVQPIQINIELDEHTREVAAQKLKIGVYFATWWALNVIFNIYNKK  130

Query  883  VLNAYPFPWltstlslaagslIMLISWA  966
            VLNA+PFPWLTSTLSLA GSL+ML+SWA
Sbjct  131  VLNAFPFPWLTSTLSLATGSLMMLVSWA  158



>ref|XP_007026013.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2 [Theobroma 
cacao]
 gb|EOY28635.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2 [Theobroma 
cacao]
Length=417

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 97/158 (61%), Gaps = 19/158 (12%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSV----LSLARPVHVS  669
            MIS+++ S   A   + FF  K     P+     PLP +K           S  +P+HV+
Sbjct  1    MISSIKHSTS-AFNSTSFFSKKRSITRPQFS---PLPVIKNVHNGFPNQSCSYQKPLHVA  56

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARKVKIGIYFATWWA  849
            ++E    LK+  +         + C+AYEADRS+P++      E    +KIGIYFATWWA
Sbjct  57   AIENLAILKKTQQRK-------IECQAYEADRSRPLDINIELPE----IKIGIYFATWWA  105

Query  850  LNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            LNVVFNIYNKKVLN +P+PWLTSTLSLAAGSL+MLISW
Sbjct  106  LNVVFNIYNKKVLNVFPYPWLTSTLSLAAGSLMMLISW  143



>ref|XP_006279646.1| hypothetical protein CARUB_v10026569mg [Capsella rubella]
 gb|EOA12544.1| hypothetical protein CARUB_v10026569mg [Capsella rubella]
Length=389

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 87/120 (73%), Gaps = 22/120 (18%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP--------IEEPA  789
            +VL++++P+H+SS+                K  L+ C+AYEADRS+P             
Sbjct  42   TVLAVSKPLHLSSLR--------------AKSPLLRCEAYEADRSEPQPIGDDAAAAAVV  87

Query  790  AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
             KSEAA+++KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  88   EKSEAAKRLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  147



>ref|XP_002888066.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64325.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=388

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 88/129 (68%), Gaps = 23/129 (18%)
 Frame = +1

Query  604  PLPALKPCRG----SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQ  771
            PLP +K C      S +S  +P+H+SS   F             KR  V  +AYEADRS+
Sbjct  32   PLPIIKTCHNQSFNSSVSHQKPLHISSTLNF-------------KRGEVKVEAYEADRSR  78

Query  772  P----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaag  939
            P    IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA G
Sbjct  79   PLDINIELP--DEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACG  136

Query  940  slIMLISWA  966
            SL+ML+SWA
Sbjct  137  SLMMLVSWA  145



>emb|CDY52572.1| BnaC03g71800D [Brassica napus]
Length=390

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 95/125 (76%), Gaps = 22/125 (18%)
 Frame = +1

Query  604  PLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRS---QP  774
            P PAL P R +VL+L++P+H+SS+          R     +R+     AYEAD+S   QP
Sbjct  38   PSPAL-PKR-TVLTLSKPLHLSSL----------RAKSPVRRS-----AYEADKSEPPQP  80

Query  775  IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIML  954
            I++   KSEAA+K+KIG+YFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+ML
Sbjct  81   IDD--TKSEAAKKLKIGVYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMML  138

Query  955  ISWAL  969
            ISWA+
Sbjct  139  ISWAV  143



>emb|CDY55220.1| BnaA01g36280D [Brassica napus]
Length=387

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 88/127 (69%), Gaps = 19/127 (15%)
 Frame = +1

Query  604  PLPALKPCRG--SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP-  774
            PL  +K CR   S +S  +P+H+SS + F S K   R            +AYEADRS+P 
Sbjct  31   PLHIIKSCRNQSSNVSYQKPLHISSAQNFSSFKREVR-----------VEAYEADRSRPL  79

Query  775  ---IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagsl  945
               IE P    ++A+K+KIGI FATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL
Sbjct  80   DINIELP--DEQSAQKLKIGISFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSL  137

Query  946  IMLISWA  966
            +ML+SWA
Sbjct  138  MMLVSWA  144



>ref|XP_010475728.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Camelina sativa]
Length=384

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 25/124 (20%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI------EEPAA-  792
            +VLS+ +P+H+SS+     L  R             C+AYEADRS+P       ++ +A 
Sbjct  43   TVLSVTKPLHLSSLRAKSPLVRR-------------CEAYEADRSEPTPPIGGGDDASAE  89

Query  793  -----KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
                 KSEAA+++KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLI
Sbjct  90   AALETKSEAAKRLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLI  149

Query  958  SWAL  969
            SWA+
Sbjct  150  SWAV  153



>ref|XP_009132423.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Brassica rapa]
Length=385

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 86/115 (75%), Gaps = 20/115 (17%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRS---QPIEEPAAKSEA  804
            +VL+L++P+H+S +                 +  V C AYEAD+S   QPI++   KSEA
Sbjct  46   TVLTLSKPLHLSVLRA---------------KPPVRCSAYEADKSEPPQPIDD--TKSEA  88

Query  805  ARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            A+K KIG+YFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  89   AKKAKIGVYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  143



>gb|KFK40647.1| hypothetical protein AALP_AA2G023600 [Arabis alpina]
Length=389

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 90/137 (66%), Gaps = 24/137 (18%)
 Frame = +1

Query  583  PKLCVLPPLPALKPC-----RGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCK  747
            P      PLP +K C     + S +S  +P+H+SS+  F   + R              +
Sbjct  25   PTKLYFSPLPIIKNCHNQTFKTSNISHQKPLHISSIHNFSKREVR-------------VQ  71

Query  748  AYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlt  915
            AYEADRS+P    IE P    ++A+K+KIG+YFATWWALNVVFNIYNKKVLNA+P+PWLT
Sbjct  72   AYEADRSRPLDINIELP--DEQSAQKLKIGVYFATWWALNVVFNIYNKKVLNAFPYPWLT  129

Query  916  stlslaagslIMLISWA  966
            STLSLA GSL+ML+SWA
Sbjct  130  STLSLACGSLMMLVSWA  146



>emb|CDY19859.1| BnaC09g31250D [Brassica napus]
Length=414

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 109/161 (68%), Gaps = 20/161 (12%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPA-PAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            M+ A +Q+    I  S+    ++P+ P  +  +    P+    + +VL++++P+H+S + 
Sbjct  1    MVLAAKQALSAKIGFSNPLSRRNPSSPLQRSPLAASFPSTDLRKRTVLAVSKPLHLSPM-  59

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRS--QPIEEPAA--KSEAARKVKIGIYFATWW  846
                     R     +R     +AYEAD+S  QPI++ AA  KSEAA+K+KIGIYFATWW
Sbjct  60   ---------RAKPPARR-----EAYEADKSEPQPIDDDAAETKSEAAKKLKIGIYFATWW  105

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            ALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  106  ALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  146



>ref|XP_010443058.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Camelina sativa]
Length=391

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 89/121 (74%), Gaps = 23/121 (19%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVT-CKAYEADRSQPI-----EEPAA-  792
            +VLS+ +P+H+SS+                K  LV  C+AYEADRS+P      ++  A 
Sbjct  43   TVLSVTKPLHLSSLR--------------AKSPLVRPCEAYEADRSEPQPPIGGDDATAL  88

Query  793  --KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
              KSEAA+++KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA
Sbjct  89   ETKSEAAKRLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWA  148

Query  967  L  969
            +
Sbjct  149  V  149



>ref|XP_009357419.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009340952.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=394

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 10/108 (9%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE---EPAAKSEAARKVKI  822
            +P+H+SS + F    +  +G          CKAYEAD+S+P+E   E   + EAA+++KI
Sbjct  51   KPLHISSGDCFALAGKAEKGT-------AVCKAYEADQSRPLEINIELPDQQEAAQRLKI  103

Query  823  GIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            G+YFATWWALNVVFNIYNKKVLN +P+PWLTSTLSLA GSL+ML+SWA
Sbjct  104  GLYFATWWALNVVFNIYNKKVLNVFPYPWLTSTLSLATGSLMMLVSWA  151



>ref|XP_009340951.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=398

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 10/108 (9%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE---EPAAKSEAARKVKI  822
            +P+H+SS + F    +  +G          CKAYEAD+S+P+E   E   + EAA+++KI
Sbjct  51   KPLHISSGDCFALAGKAEKGT-------AVCKAYEADQSRPLEINIELPDQQEAAQRLKI  103

Query  823  GIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            G+YFATWWALNVVFNIYNKKVLN +P+PWLTSTLSLA GSL+ML+SWA
Sbjct  104  GLYFATWWALNVVFNIYNKKVLNVFPYPWLTSTLSLATGSLMMLVSWA  151



>ref|XP_010482887.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Camelina sativa]
Length=394

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 88/124 (71%), Gaps = 26/124 (21%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVT-CKAYEADRSQPI---------EE  783
            +VLS+ +P+H+SS+                K  LV  C+AYEADRS+P           E
Sbjct  43   TVLSVTKPLHLSSLR--------------AKSPLVRPCEAYEADRSEPTPPIGGDDATAE  88

Query  784  PA--AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
             A   KSEAA+++KIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLI
Sbjct  89   AALETKSEAAKRLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLI  148

Query  958  SWAL  969
            SWA+
Sbjct  149  SWAV  152



>ref|XP_008439971.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Cucumis melo]
Length=391

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 100/156 (64%), Gaps = 9/156 (6%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  681
            MIS++R +       ++ F  KSP   P L +  P  ++        S  +P+H+SSVE 
Sbjct  1    MISSLRLTSS-NFTSTEIFNRKSPLLRPNLPLQSPDCSVLKHVDRSFSTNKPIHISSVEN  59

Query  682  FGSLKERSRGDDHEKRALVTCKAYEAD-RSQPIEEPAAKSEAARKVKIGIYFATWWALNV  858
              SL  +S      +R+ V C+AYEAD R   I       +  +K+KIG+YFATWWALNV
Sbjct  60   L-SLSTKS-----SERSTV-CRAYEADSRRLQINIELPDEQTTQKLKIGLYFATWWALNV  112

Query  859  VFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VFN+YNKKVLNA+P+PWLTSTLSLAAGSL+ML+SWA
Sbjct  113  VFNVYNKKVLNAFPYPWLTSTLSLAAGSLMMLVSWA  148



>ref|XP_008224795.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Prunus mume]
Length=393

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 99/160 (62%), Gaps = 14/160 (9%)
 Frame = +1

Query  499  MMISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLA-RPVHVSSV  675
            M IS+V+         S+F   +    A     LP    ++      LS + +P+++SS 
Sbjct  1    MQISSVKLRTS-TFTSSEFLNQRCSIKAQSFS-LPSFQNVQQSVNHSLSSSFKPIYISST  58

Query  676  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE---EPAAKSEAARKVKIGIYFATWW  846
            E+F  + +  R  +        CKAYEAD+S+P++   E   +  A+++ KIGIYFATWW
Sbjct  59   ESFALVSKTQRVTE--------CKAYEADKSRPLKINIELPDQQAASQRFKIGIYFATWW  110

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLN +P+PWLTSTLSLA GSL+MLISWA
Sbjct  111  ALNVVFNIYNKKVLNVFPYPWLTSTLSLATGSLMMLISWA  150



>ref|XP_007211968.1| hypothetical protein PRUPE_ppa006608mg [Prunus persica]
 gb|EMJ13167.1| hypothetical protein PRUPE_ppa006608mg [Prunus persica]
Length=403

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 100/162 (62%), Gaps = 20/162 (12%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSV----LSLARPVHVS  669
            MIS+V+         S+F   +    A        LP+ +  + SV     S  +P+++S
Sbjct  1    MISSVKLRTS-TFTSSEFLNQRCSIKAQSFS----LPSFQNVQQSVNHSFSSSFKPLYIS  55

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE---EPAAKSEAARKVKIGIYFAT  840
            S E+F  + +  R  +        CKAYEAD+S+P++   E   +  A+++ KIGIYFAT
Sbjct  56   STESFALVSKTQRVTE--------CKAYEADKSRPLKVNIELPDQQAASQRFKIGIYFAT  107

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WWALNVVFNIYNKKVLN +P+PWLTSTLSLA GSL+MLISWA
Sbjct  108  WWALNVVFNIYNKKVLNVFPYPWLTSTLSLATGSLMMLISWA  149



>gb|KCW75358.1| hypothetical protein EUGRSUZ_E04104 [Eucalyptus grandis]
Length=321

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 104/160 (65%), Gaps = 12/160 (8%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS+VR +  P     S F   +     P+   LP +   +      +S  +P+++SSVE
Sbjct  1    MISSVRHAVSPFP--SSGFLTQRRSLAKPRFWPLPIIRNEQLNLNHSVSPQKPIYISSVE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEA-DR--SQPIEEPAAKS-EAARKVKIGIYFATWW  846
            TF  L         +KR +V C AYEA DR     IE P  ++ EAAR++KIG+YFATWW
Sbjct  59   TFSPLP----AAKIQKREVV-CNAYEAADRPLEINIELPDEQAAEAARRIKIGLYFATWW  113

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+M+ISWA
Sbjct  114  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMMISWA  153



>ref|XP_009120008.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Brassica rapa]
Length=388

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 24/152 (16%)
 Frame = +1

Query  523  SGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKER  702
            S PL+ R      P SP     L    P     P R +VL++++P+H+S +         
Sbjct  16   SNPLSRR-----NPSSPLQRSPLAASFPSTTDLPKR-TVLAVSKPLHLSPM---------  60

Query  703  SRGDDHEKRALVTCKAYEADRS--QPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIY  873
             R     +R     +AYE D+S  QPI++ A  KSEAA+K+KIGIYFATWWALNVVFNIY
Sbjct  61   -RAKPPARR-----EAYEGDKSEPQPIDDAAETKSEAAKKLKIGIYFATWWALNVVFNIY  114

Query  874  NKKVLNAYPFPWltstlslaagslIMLISWAL  969
            NKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  115  NKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  146



>ref|XP_007147746.1| hypothetical protein PHAVU_006G151500g [Phaseolus vulgaris]
 gb|ESW19740.1| hypothetical protein PHAVU_006G151500g [Phaseolus vulgaris]
Length=391

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 102/160 (64%), Gaps = 17/160 (11%)
 Frame = +1

Query  502  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRG-SVLSLARPVHVSSVE  678
            MIS  + S   ++  S F   K P   P+L   P +  ++     S L   +P+++S  E
Sbjct  1    MISLTKCSAS-SLTCSAFSTRKLPPARPQLLTFPTINNVEQNTSPSQLCSQKPLYLSPTE  59

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVKIGIYFATWW  846
                +K         ++ +  C+AYEADRS+P    IE P    +AA+++KIG+YFATWW
Sbjct  60   NMALVK---------RKRVTECQAYEADRSRPMEINIELPG--EDAAQRMKIGVYFATWW  108

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+MLISWA
Sbjct  109  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLLMLISWA  148



>emb|CDY17274.1| BnaA10g09080D [Brassica napus]
Length=414

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 24/152 (16%)
 Frame = +1

Query  523  SGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKER  702
            S PL+ R      P SP     L    P     P R +VL++++P+H+S +         
Sbjct  16   SNPLSRR-----NPSSPLQRSPLAASFPSTTDLPKR-TVLAVSKPLHLSPM---------  60

Query  703  SRGDDHEKRALVTCKAYEADRS--QPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIY  873
             R     +R     +AYE D+S  QPI++ A  KSEAA+K+KIGIYFATWWALNVVFNIY
Sbjct  61   -RAKPPARR-----EAYEGDKSEPQPIDDAAETKSEAAKKLKIGIYFATWWALNVVFNIY  114

Query  874  NKKVLNAYPFPWltstlslaagslIMLISWAL  969
            NKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  115  NKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  146



>gb|KHN37588.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=355

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 15/109 (14%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVK  819
            +P+++SS E    ++         +R +  C+AYEADRS+P    IE PA   EAA++ K
Sbjct  10   KPLYLSSTENLALVR---------RRRVTECQAYEADRSRPLEINIELPA--EEAAQRFK  58

Query  820  IGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            IG+YFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+ML+SWA
Sbjct  59   IGVYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMLVSWA  107



>ref|XP_006302377.1| hypothetical protein CARUB_v10020443mg [Capsella rubella]
 gb|EOA35275.1| hypothetical protein CARUB_v10020443mg [Capsella rubella]
Length=388

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 83/115 (72%), Gaps = 19/115 (17%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSE  801
            +V+S  +P+H+SS   F             KR  V  +AYEADRS+P    IE P    +
Sbjct  46   NVVSHQKPLHISSASNF-------------KRGEVKVQAYEADRSRPLDINIELP--DEQ  90

Query  802  AARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            +A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  91   SAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWA  145



>ref|XP_009765173.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=622

 Score =   109 bits (272),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 80/110 (73%), Gaps = 10/110 (9%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE-----EPAAKSEAARKV  816
            +P+++S+V  FG + E    D      LV C AYEA R Q I      +   +  AA+K+
Sbjct  275  KPLYISAVSGFGHVDESKSRDK-----LVQCNAYEASRPQSIPISIDFDQETQVAAAQKL  329

Query  817  KIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            KIG+YFATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSLIML+SWA
Sbjct  330  KIGLYFATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLIMLVSWA  379



>ref|XP_008384044.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
isoform X1 [Malus domestica]
 ref|XP_008358746.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=399

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 10/108 (9%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE---EPAAKSEAARKVKI  822
            +P+H+SS + F    +  +G          C AYEAD+S+P+E   E   + EA +++KI
Sbjct  51   KPLHISSGDCFALAGKTEKGS-------AVCNAYEADQSRPLEINIELPDQQEATQRLKI  103

Query  823  GIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            G+YFATWWALNVVFNIYNKKVLN +P+PWLTSTLSLA GSL+ML+SWA
Sbjct  104  GLYFATWWALNVVFNIYNKKVLNVFPYPWLTSTLSLATGSLMMLVSWA  151



>ref|XP_008384045.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
isoform X2 [Malus domestica]
 ref|XP_008358747.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X2 [Malus domestica]
Length=394

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 10/108 (9%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE---EPAAKSEAARKVKI  822
            +P+H+SS + F    +  +G          C AYEAD+S+P+E   E   + EA +++KI
Sbjct  51   KPLHISSGDCFALAGKTEKGS-------AVCNAYEADQSRPLEINIELPDQQEATQRLKI  103

Query  823  GIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            G+YFATWWALNVVFNIYNKKVLN +P+PWLTSTLSLA GSL+ML+SWA
Sbjct  104  GLYFATWWALNVVFNIYNKKVLNVFPYPWLTSTLSLATGSLMMLVSWA  151



>gb|KJB45582.1| hypothetical protein B456_007G313700 [Gossypium raimondii]
Length=411

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 12/123 (10%)
 Frame = +1

Query  598  LPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI  777
            LP L      + ++LSL++P+++SS ++F             +++++ CKAYEAD+S   
Sbjct  30   LPCLNLQNNPKRTLLSLSKPLYISSFQSF------------NEKSVILCKAYEADKSPSP  77

Query  778  EEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
                AKSEAA+ VKIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+ML+
Sbjct  78   AAAEAKSEAAKSVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLV  137

Query  958  SWA  966
            SWA
Sbjct  138  SWA  140



>gb|KJB45583.1| hypothetical protein B456_007G313700 [Gossypium raimondii]
Length=383

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 12/123 (10%)
 Frame = +1

Query  598  LPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI  777
            LP L      + ++LSL++P+++SS ++F             +++++ CKAYEAD+S   
Sbjct  30   LPCLNLQNNPKRTLLSLSKPLYISSFQSF------------NEKSVILCKAYEADKSPSP  77

Query  778  EEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
                AKSEAA+ VKIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA GSL+ML+
Sbjct  78   AAAEAKSEAAKSVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLV  137

Query  958  SWA  966
            SWA
Sbjct  138  SWA  140



>ref|XP_010533829.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Tarenaya hassleriana]
Length=397

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 99/163 (61%), Gaps = 36/163 (22%)
 Frame = +1

Query  505  ISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCR-----GSVLSLARPVHVS  669
            +S++R+S P  +R S                  PLP ++ C+        +S+ +P+HVS
Sbjct  19   LSSIRRSSPAKLRFS------------------PLPIIRNCQKQSFNNHNVSIQKPLHVS  60

Query  670  SVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVKIGIYFA  837
            S E         + +       V  +AYEA+RS+P    IE P    +AA+K+KIGIYFA
Sbjct  61   SAENLSIFPATQKRE-------VKVEAYEAERSRPLDISIELP--DQQAAQKLKIGIYFA  111

Query  838  TWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            TWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML SWA
Sbjct  112  TWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLGSWA  154



>ref|XP_010042185.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Eucalyptus grandis]
Length=396

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 104/160 (65%), Gaps = 12/160 (8%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS+VR +  P     S F   +     P+   LP +   +      +S  +P+++SSVE
Sbjct  1    MISSVRHAVSPFP--SSGFLTQRRSLAKPRFWPLPIIRNEQLNLNHSVSPQKPIYISSVE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEA-DR--SQPIEEPAAKS-EAARKVKIGIYFATWW  846
            TF  L         +KR +V C AYEA DR     IE P  ++ EAA+++KIG+YFATWW
Sbjct  59   TFSPLP----AAKIQKREVV-CNAYEAADRPLEINIELPDEQAAEAAQRIKIGLYFATWW  113

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+M+ISWA
Sbjct  114  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMMISWA  153



>ref|XP_010041822.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Eucalyptus grandis]
Length=322

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 104/160 (65%), Gaps = 12/160 (8%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MIS+VR +  P     S F   +     P+   LP +   +      +S  +P+++SSVE
Sbjct  1    MISSVRHAVSPFP--SSGFLTQRRSLAKPRFWPLPIIRNEQLNLNHSVSPQKPIYISSVE  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEA-DR--SQPIEEPAAKS-EAARKVKIGIYFATWW  846
            TF  L         +KR +V C AYEA DR     IE P  ++ EAA+++KIG+YFATWW
Sbjct  59   TFSPLP----AAKIQKREVV-CNAYEAADRPLEINIELPDEQAAEAAQRIKIGLYFATWW  113

Query  847  ALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            ALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSL+M+ISWA
Sbjct  114  ALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLMMMISWA  153



>ref|XP_010473399.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Camelina sativa]
Length=390

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 87/131 (66%), Gaps = 22/131 (17%)
 Frame = +1

Query  598  LPPLPALKPCRG------SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEA  759
              PL  +K C        +V S  +P+H+SS  +F             KR  V  +AYEA
Sbjct  31   FSPLNIIKNCHNQSFSYNAVSSHQKPLHISSASSF-------------KRE-VKVQAYEA  76

Query  760  DRSQP--IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlsla  933
            DRS+P  I    +  ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA
Sbjct  77   DRSRPLDINIELSNEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLA  136

Query  934  agslIMLISWA  966
             GSL+ML+SWA
Sbjct  137  CGSLMMLVSWA  147



>ref|NP_564785.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis thaliana]
 sp|Q94B38.2|GPT2_ARATH RecName: Full=Glucose-6-phosphate/phosphate translocator 2, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33888.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis thaliana]
Length=388

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 25/132 (19%)
 Frame = +1

Query  598  LPPLPALKPCRG-----SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEAD  762
              PL  +K C       +V+S  +P+H+SS   F             KR  V  +AYEAD
Sbjct  30   FSPLLIIKNCHNQSFNANVVSHQKPLHISSASNF-------------KRE-VKVEAYEAD  75

Query  763  RSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlsl  930
            RS+P    IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSL
Sbjct  76   RSRPLDINIELP--DEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSL  133

Query  931  aagslIMLISWA  966
            A GSL+ML+SWA
Sbjct  134  ACGSLMMLVSWA  145



>gb|AAK68814.1| Similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis 
thaliana]
 gb|AAM10041.1| similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis 
thaliana]
Length=388

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 25/132 (19%)
 Frame = +1

Query  598  LPPLPALKPCRG-----SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEAD  762
              PL  +K C       +V+S  +P+H+SS   F             KR  V  +AYEAD
Sbjct  30   FSPLLIIKNCHNQSFNANVVSHQKPLHISSASNF-------------KRE-VKVEAYEAD  75

Query  763  RSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlsl  930
            RS+P    IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSL
Sbjct  76   RSRPLDINIELP--DEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSL  133

Query  931  aagslIMLISWA  966
            A GSL+ML+SWA
Sbjct  134  ACGSLMMLVSWA  145



>gb|AAC28500.1| Similar to glucose-6-phosphate/phosphate-translocator (GPT) gb|AF020814 
from Pisum sativum [Arabidopsis thaliana]
Length=410

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 25/132 (19%)
 Frame = +1

Query  598  LPPLPALKPCRG-----SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEAD  762
              PL  +K C       +V+S  +P+H+SS   F             KR  V  +AYEAD
Sbjct  30   FSPLLIIKNCHNQSFNANVVSHQKPLHISSASNF-------------KRE-VKVEAYEAD  75

Query  763  RSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlsl  930
            RS+P    IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSL
Sbjct  76   RSRPLDINIELP--DEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSL  133

Query  931  aagslIMLISWA  966
            A GSL+ML+SWA
Sbjct  134  ACGSLMMLVSWA  145



>ref|XP_010430199.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Camelina sativa]
Length=388

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 88/137 (64%), Gaps = 25/137 (18%)
 Frame = +1

Query  583  PKLCVLPPLPALKPCRG-----SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCK  747
            P      PL  +K C       + +S  +P+H+SS   F             KR  V  +
Sbjct  25   PTKLQFSPLNIIKNCHNQSFSSNAISHQKPLHISSASNF-------------KRE-VRVQ  70

Query  748  AYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlt  915
            AYEADRS+P    IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLT
Sbjct  71   AYEADRSRPLDINIELP--NEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLT  128

Query  916  stlslaagslIMLISWA  966
            STLSLA GSL+ML+SWA
Sbjct  129  STLSLACGSLMMLVSWA  145



>ref|XP_006367280.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Solanum tuberosum]
Length=405

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 77/108 (71%), Gaps = 9/108 (8%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE---EPAAKSEAARKVKI  822
            +P+++S+V  FG + E    D      LV C AYEA R  PI    +   +  AA K KI
Sbjct  52   KPLYISAVSGFGHVNESKSRDP-----LVQCNAYEASR-PPISIEFDEETQIVAAHKFKI  105

Query  823  GIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            G+YFATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGS IML+SWA
Sbjct  106  GLYFATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSFIMLVSWA  153



>ref|XP_007020964.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2, partial 
[Theobroma cacao]
 gb|EOY12489.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2, partial 
[Theobroma cacao]
Length=323

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 1/71 (1%)
 Frame = +1

Query  757  ADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlsla  933
            ADRSQPIE     KSEAA++VKIGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLA
Sbjct  10   ADRSQPIEAAGEVKSEAAKRVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLA  69

Query  934  agslIMLISWA  966
             GSL+MLISWA
Sbjct  70   CGSLMMLISWA  80



>ref|XP_006654288.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Oryza brachyantha]
Length=387

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 104/157 (66%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI AV+ S GP+A  G++  R K+ +       +P +  LKP +  V SL RP++++ ++
Sbjct  1    MIPAVKLSPGPVAFSGTNL-RSKTAS-------VPSVSGLKPSKFVVSSL-RPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
              G+ +++ R    E +    C A  AD  +   E    +SEAA+K+KI IYFATWWALN
Sbjct  52   GPGAAEQKPRRKPLEFK----CAASAADDKESKTEVVPIRSEAAQKLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML+SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLVSWA  144



>emb|CDY25324.1| BnaC01g29930D [Brassica napus]
Length=395

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 86/137 (63%), Gaps = 22/137 (16%)
 Frame = +1

Query  583  PKLCVLPPLPALKPCRG-----SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCK  747
            P      PL   + C       S +S  +P+H+SS +   S K   R            +
Sbjct  24   PTKLQFSPLRITRSCHNQSFINSNVSHQKPLHISSAQNLSSFKREVR-----------VE  72

Query  748  AYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlt  915
            AYEADR +P    IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWLT
Sbjct  73   AYEADRYRPLDINIELP--DEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLT  130

Query  916  stlslaagslIMLISWA  966
            STLSLA GSL+ML+SWA
Sbjct  131  STLSLACGSLMMLVSWA  147



>ref|XP_010418155.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=389

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 88/138 (64%), Gaps = 26/138 (19%)
 Frame = +1

Query  583  PKLCVLPPLPALKPCRG------SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTC  744
            P      PL  +K C        +V S  +P+H+SS     SLK             V  
Sbjct  25   PTKLQFSPLHIIKNCHNQSFNSNAVYSHQKPLHISSAS---SLKRE-----------VKV  70

Query  745  KAYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWl  912
            +AYEADRS+P    IE P    ++A+K+KIGIYFATWWALNVVFNIYNKKVLNA+P+PWL
Sbjct  71   QAYEADRSRPLDINIELP--NEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWL  128

Query  913  tstlslaagslIMLISWA  966
            TSTLSLA GSL+ML+SWA
Sbjct  129  TSTLSLACGSLMMLVSWA  146



>gb|AAY85658.1| plastid glucose-6-phosphate/phosphate translocator precursor 
[Helianthus annuus]
Length=379

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 16/111 (14%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKSEAARK  813
            S+++ ++P+HVSS+++FGSL +             +CKAYEA       +    +EAA++
Sbjct  42   SIVTNSKPLHVSSLQSFGSLXK-----------FESCKAYEAGG-----DVVENTEAAKR  85

Query  814  VKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            VKIG YFATWW LNV+F IYNKKVLNA+P+PWLTSTLSLAAGS IML+SWA
Sbjct  86   VKIGFYFATWWFLNVIFXIYNKKVLNAFPYPWLTSTLSLAAGSAIMLVSWA  136



>ref|XP_006383937.1| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
 gb|ERP61734.1| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
Length=400

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = +1

Query  718  HEKRALVTCKAYEADRSQPIEEPAAKSE--AARKVKIGIYFATWWALNVVFNIYNKKVLN  891
             +++ +  C AYEADRS+P++     S+  AA+K+KIG+YFATWWALNVVFNIYNKKVLN
Sbjct  73   QQEKPVTVCNAYEADRSRPLDINIELSDEHAAQKIKIGLYFATWWALNVVFNIYNKKVLN  132

Query  892  AYPFPWltstlslaagslIMLISWA  966
            A+P+PWLTSTLSLA GSL+MLISWA
Sbjct  133  AFPYPWLTSTLSLACGSLMMLISWA  157



>ref|XP_002305598.2| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
 gb|EEE86109.2| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
Length=405

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = +1

Query  718  HEKRALVTCKAYEADRSQPIEEPAAKSE--AARKVKIGIYFATWWALNVVFNIYNKKVLN  891
             +++ +  C AYEADRS+P++     S+  AA+K+KIG+YFATWWALNVVFNIYNKKVLN
Sbjct  73   QQEKPVTVCNAYEADRSRPLDINIELSDEHAAQKIKIGLYFATWWALNVVFNIYNKKVLN  132

Query  892  AYPFPWltstlslaagslIMLISWA  966
            A+P+PWLTSTLSLA GSL+MLISWA
Sbjct  133  AFPYPWLTSTLSLACGSLMMLISWA  157



>ref|XP_011037695.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Populus euphratica]
Length=400

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = +1

Query  718  HEKRALVTCKAYEADRSQPIEEPAAKSE--AARKVKIGIYFATWWALNVVFNIYNKKVLN  891
             +++ +  C AYEADRS+P++     S+  AA+K+KIG+YFATWWALNVVFNIYNKKVLN
Sbjct  73   QQEKPVTVCNAYEADRSRPLDINIELSDEHAAQKIKIGLYFATWWALNVVFNIYNKKVLN  132

Query  892  AYPFPWltstlslaagslIMLISWA  966
            A+P+PWLTSTLSLA GSL+MLISWA
Sbjct  133  AFPYPWLTSTLSLACGSLMMLISWA  157



>gb|AIR93781.1| glucose 6-phosphate phosphate translocator [Kalanchoe fedtschenkoi]
Length=397

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 14/131 (11%)
 Frame = +1

Query  601  PPLPALKP---CRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQ  771
            P LP+  P    +  V    RP++VSS+  F  ++E  +     ++  V C AY++ RS+
Sbjct  29   PSLPSSIPKAFFKSYVCHSTRPLYVSSLNNFNFVEEEPK-----EKLSVKCNAYQSRRSE  83

Query  772  PIE------EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlsla  933
            P++          +    +K+KIGIYFATWWALNVVFNIYNKKVLNA+PFPWL STL+LA
Sbjct  84   PLQMGLEFVSQQLEQIDTQKLKIGIYFATWWALNVVFNIYNKKVLNAFPFPWLISTLALA  143

Query  934  agslIMLISWA  966
            +GSL+ML+SWA
Sbjct  144  SGSLMMLVSWA  154



>ref|XP_006417337.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
 gb|ESQ35690.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
Length=389

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 77/105 (73%), Gaps = 5/105 (5%)
 Frame = +1

Query  655  PVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEE--PAAKSEAARKVKIGI  828
            P+ V S + F +    S     ++R +    AYEADRSQPIE     +  ++ +KVKIGI
Sbjct  44   PLQVLSAQNFSNF---SVSAAAQRRDVFKVGAYEADRSQPIEIGIEISDEQSRQKVKIGI  100

Query  829  YFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            YFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SW
Sbjct  101  YFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSW  145



>ref|XP_006417336.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
 gb|ESQ35689.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
Length=388

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 77/105 (73%), Gaps = 5/105 (5%)
 Frame = +1

Query  655  PVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEE--PAAKSEAARKVKIGI  828
            P+ V S + F +    S     ++R +    AYEADRSQPIE     +  ++ +KVKIGI
Sbjct  44   PLQVLSAQNFSNF---SVSAAAQRRDVFKVGAYEADRSQPIEIGIEISDEQSRQKVKIGI  100

Query  829  YFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            YFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SW
Sbjct  101  YFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSW  145



>gb|ABJ98060.1| glucose 6-Pi/Pi transporter [Eutrema halophilum]
Length=388

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 77/105 (73%), Gaps = 5/105 (5%)
 Frame = +1

Query  655  PVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEE--PAAKSEAARKVKIGI  828
            P+ V S + F +    S     ++R +    AYEADRSQPIE     +  ++ +KVKIGI
Sbjct  44   PLQVLSAQNFSNF---SVSAAAQRRDVFKVGAYEADRSQPIEIGIEISDEQSRQKVKIGI  100

Query  829  YFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            YFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SW
Sbjct  101  YFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSW  145



>ref|XP_010476089.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=392

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = +1

Query  688  SLKERSRGDDHEKRALVT-CKAYEADRSQPIE---EPAAKSEAARKVKIGIYFATWWALN  855
            SL   +     E+R+ V   +AYEADRS+PIE   E   + ++ +KVKIGIYFATWWALN
Sbjct  53   SLSNFTFAAAQEQRSDVFRVRAYEADRSRPIEIGVEVPEEEQSGQKVKIGIYFATWWALN  112

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            VVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SW
Sbjct  113  VVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSW  148



>ref|XP_004134753.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Cucumis sativus]
 gb|KGN49125.1| hypothetical protein Csa_6G514860 [Cucumis sativus]
Length=391

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 97/162 (60%), Gaps = 21/162 (13%)
 Frame = +1

Query  502  MISAVR------QSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVH  663
            MIS++R       S  +  R S   RP  P  +P   VL      K    S L+  +P+H
Sbjct  1    MISSLRLTSSHFNSTEIVNRKSQLLRPNIPLQSPDCSVL------KHVDRSFLT-NKPLH  53

Query  664  VSSVETFGSLKERSRGDDHEKRALVTCKAYEAD-RSQPIEEPAAKSEAARKVKIGIYFAT  840
            +SSVE    L + S      +R+ V C+AYEA+ R   I       +  +K+KI +YFA 
Sbjct  54   ISSVENLSLLTKSS------ERSTV-CRAYEAESRRLQINIELPDEQTTQKLKIALYFAA  106

Query  841  WWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WWALNVVFN+YNKKVLNA+P+PWLTSTLSLAAGSL+ML+SW 
Sbjct  107  WWALNVVFNVYNKKVLNAFPYPWLTSTLSLAAGSLMMLVSWT  148



>ref|XP_004240145.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Solanum lycopersicum]
Length=401

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 84/123 (68%), Gaps = 8/123 (7%)
 Frame = +1

Query  616  LKPCRGSVLSLARPVHVSSVET-FGSLKERSRGDDHEKRALVTCKAYEADRSQPI-----  777
             K C    +   +P+++S+V + FG   E    +   +  LV C AYEA R Q I     
Sbjct  39   FKQCDKPNILSKKPLYISAVLSGFGHADESK--EFKSRDPLVQCNAYEASRPQSIPINIE  96

Query  778  EEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
                A++ A +K+KIG+YFATWWALNVVFNIYNKKVLNA+PFPWLTSTLSLAAGSL+ML+
Sbjct  97   FGQEAQAAATQKLKIGLYFATWWALNVVFNIYNKKVLNAFPFPWLTSTLSLAAGSLMMLV  156

Query  958  SWA  966
            SWA
Sbjct  157  SWA  159



>ref|XP_006356920.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Solanum tuberosum]
 gb|AAO19451.1| glucose-6-phosphate/phosphate translocator 2 [Solanum tuberosum]
Length=401

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 91/135 (67%), Gaps = 15/135 (11%)
 Frame = +1

Query  601  PPLPAL-------KPCRGSVLSLARPVHVSSVET-FGSLKERSRGDDHEKRALVTCKAYE  756
            PP+ +L       K C    +   +P+++S+V + FG   E    +   +  LV C AYE
Sbjct  27   PPISSLSIKDIDFKQCDKHNILSKKPLYISAVLSGFGHADESK--EFKSRDPLVQCNAYE  84

Query  757  ADRSQ--PIE---EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltst  921
            A + Q  PI+      A++ A +K+KIG+YFATWWALNVVFNIYNKKVLNA+PFPWLTST
Sbjct  85   ASQPQSIPIDIEFGQEAQAAATQKLKIGLYFATWWALNVVFNIYNKKVLNAFPFPWLTST  144

Query  922  lslaagslIMLISWA  966
            LSLAAGSL+ML+SWA
Sbjct  145  LSLAAGSLMMLVSWA  159



>gb|AAC08526.1| glucose-6-phosphate/phosphate-translocator precursor [Solanum 
tuberosum]
Length=393

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 90/135 (67%), Gaps = 15/135 (11%)
 Frame = +1

Query  601  PPLPAL-------KPCRGSVLSLARPVHVSSV-ETFGSLKERSRGDDHEKRALVTCKAYE  756
            PP+ +L       K C    +   +P+++S+V   FG   E    +   +  LV C AYE
Sbjct  19   PPISSLSIKDIDFKQCDKHNILSKKPLYISAVLSGFGHADESK--EFKSRDPLVQCNAYE  76

Query  757  ADRSQ--PIE---EPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltst  921
            A + Q  PI+      A++ A +K+KIG+YFATWWALNVVFNIYNKKVLNA+PFPWLTST
Sbjct  77   ASQPQSIPIDIEFGQEAQAAATQKLKIGLYFATWWALNVVFNIYNKKVLNAFPFPWLTST  136

Query  922  lslaagslIMLISWA  966
            LSLAAGSL+ML+SWA
Sbjct  137  LSLAAGSLMMLVSWA  151



>ref|XP_009127064.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Brassica rapa]
Length=386

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 103/168 (61%), Gaps = 36/168 (21%)
 Frame = +1

Query  502  MISAVRQSG---PLAIRGSDFFRPKSPA---PAPKLCVLPPLPALKPCRGSVLSLARPVH  663
            M+ A +Q G   PL  R      P SP+   P P L      P+    + +VLSL++P+ 
Sbjct  1    MVLAAKQIGFSNPLLRR-----NPSSPSLQRPPPSLS----FPSTALPKRTVLSLSKPLR  51

Query  664  VSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP------IEEPAAKSEAARKVKIG  825
            +SS+                  + V C AYEAD+S+P            KSEAA+K+KIG
Sbjct  52   LSSLTA---------------ESPVRCSAYEADKSEPQPTDAAAAAAETKSEAAKKLKIG  96

Query  826  IYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            IYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA+
Sbjct  97   IYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAV  144



>ref|XP_009619233.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=401

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 81/122 (66%), Gaps = 7/122 (6%)
 Frame = +1

Query  616  LKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQ--PIEEPA  789
             + C  S +   +P+++S+V  FG   E    +   +  LV C AYEA R Q  PI    
Sbjct  39   FRKCDKSYILSRKPLYISAVSGFGYADESK--ESKSRDPLVQCNAYEASRPQSIPISIEF  96

Query  790  AKSEAAR---KVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLIS  960
             +   A    K+KIG+YFATWWALNV FNIYNKKVLNA+PFPWLTSTLSLAAGSL+ML+S
Sbjct  97   GQEAQAAAAQKLKIGLYFATWWALNVAFNIYNKKVLNAFPFPWLTSTLSLAAGSLMMLVS  156

Query  961  WA  966
            WA
Sbjct  157  WA  158



>ref|XP_006659185.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Oryza brachyantha]
Length=387

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 103/158 (65%), Gaps = 17/158 (11%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI AV+ S GP+A  G++  R KS        ++P + +LKP +  V SL RP++++ ++
Sbjct  1    MIPAVKLSPGPVAFSGTNL-RSKS-------ALVPSVSSLKPSKFVVSSL-RPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRAL-VTCKAYEAD-RSQPIEEPAAKSEAARKVKIGIYFATWWAL  852
                   R+     +++ L   C A  AD +    E    +SEAA+K+KI IYFATWWAL
Sbjct  52   -----GPRAAVQKPQRKPLEFKCAASAADDKKSKTEVVPVRSEAAQKLKISIYFATWWAL  106

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            NV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML+SWA
Sbjct  107  NVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLVSWA  144



>ref|XP_010930664.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Elaeis guineensis]
Length=397

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 97/142 (68%), Gaps = 13/142 (9%)
 Frame = +1

Query  565  KSPAPAPK-LCVLPPLPA-----LKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEK  726
            KSP+  P+   VLPP+ +     L   R S+    +P++++    FGS ++ S      +
Sbjct  18   KSPSLRPRPSSVLPPISSSTSENLNSARSSI----KPLYLTPSFGFGS-RDGSVPAAEPR  72

Query  727  RALVTCKAYEADRSQPIEEPA--AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYP  900
                   AYEA+ ++ I  P+  A+S AA+K+KIGIYFATWWALNVVFNIYNKKVLNA+P
Sbjct  73   GLSFKRTAYEANSAEGIALPSEEARSAAAQKLKIGIYFATWWALNVVFNIYNKKVLNAFP  132

Query  901  FPWltstlslaagslIMLISWA  966
            +PWLTSTLSLAAGSL+MLISWA
Sbjct  133  YPWLTSTLSLAAGSLMMLISWA  154



>ref|XP_009417236.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=401

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +1

Query  742  CKAYEADRSQ--PIEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlt  915
             +AYEADRS+  P+ +   ++ AA+KVKIGIYFATWWALNVVFNIYNKKVLNA+P+PWLT
Sbjct  82   ARAYEADRSEGIPVLDNEGRAAAAQKVKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLT  141

Query  916  stlslaagslIMLISWA  966
            STLSLA GSLIML+SW 
Sbjct  142  STLSLAVGSLIMLLSWG  158



>ref|XP_010493043.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=390

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +1

Query  688  SLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAA--KSEAARKVKIGIYFATWWALNVV  861
            SL   +     ++  +   +AYEADRS+PIE      + ++ +KVKIGIYFATWWALNVV
Sbjct  53   SLSNFTFAAPQQRSDVFRVRAYEADRSRPIEIGVEVPEEQSGQKVKIGIYFATWWALNVV  112

Query  862  FNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            FNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SW
Sbjct  113  FNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSW  146



>gb|AFW56904.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor [Zea mays]
Length=391

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  5    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  55

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  56   GPRTAELKSRRQPLEFR----CSASAADDKESKTQVVPVQSEGAQRLKISIYFATWWALN  111

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  112  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  148



>ref|NP_001105604.1| glucose-6-phosphate/phosphate-translocator precursor [Zea mays]
 gb|AAC08524.1| glucose-6-phosphate/phosphate-translocator precursor [Zea mays]
 gb|ACF80436.1| unknown [Zea mays]
 gb|ACG37447.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
 gb|AFW56906.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor isoform 1 [Zea mays]
 gb|AFW56907.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor isoform 2 [Zea mays]
Length=387

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CSASAADDKESKTQVVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>gb|ACN36392.1| unknown [Zea mays]
 gb|AFW56905.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor [Zea mays]
Length=394

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  8    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  58

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  59   GPRTAELKSRRQPLEFR----CSASAADDKESKTQVVPVQSEGAQRLKISIYFATWWALN  114

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  115  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  151



>gb|ABK91089.1| putative glucose-6-phosphate translocator, partial [Sorghum bicolor]
Length=327

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>emb|CDY28750.1| BnaA02g09420D [Brassica napus]
Length=450

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 102/167 (61%), Gaps = 36/167 (22%)
 Frame = +1

Query  502  MISAVRQSG---PLAIRGSDFFRPKSPA---PAPKLCVLPPLPALKPCRGSVLSLARPVH  663
            M+ A +Q G   PL  R      P SP+   P P L      P+    + +VLSL++P+ 
Sbjct  1    MVLAAKQIGFSNPLLRR-----NPSSPSLQRPPPSLS----FPSTALPKRTVLSLSKPLR  51

Query  664  VSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP------IEEPAAKSEAARKVKIG  825
            +SS+                  + V C AYEAD+S+P            KSEAA+K+KIG
Sbjct  52   LSSLTA---------------ESPVRCSAYEADKSEPQPTDAAAAAAETKSEAAKKLKIG  96

Query  826  IYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            IYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSL+MLISWA
Sbjct  97   IYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWA  143



>emb|CDY34641.1| BnaC08g42000D [Brassica napus]
Length=363

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = +1

Query  748  AYEADRSQPIEE--PAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltst  921
            AYEADRSQPI+    A   ++ +KVKIGIYFATWWALNVVFNIYNKKVLNA+P+PWLTST
Sbjct  30   AYEADRSQPIDVGVEAPGEQSGQKVKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTST  89

Query  922  lslaagslIMLISW  963
            LSLA GSL+ML+SW
Sbjct  90   LSLACGSLMMLVSW  103



>ref|XP_010545200.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Tarenaya hassleriana]
Length=391

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 16/115 (14%)
 Frame = +1

Query  634  SVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSE  801
            +VL++++P+H+ ++                 ++ V C AYEADRS+P        AAKS+
Sbjct  46   AVLAVSKPLHLGAIAL------------RRTKSPVKCNAYEADRSEPQPVDAAAVAAKSD  93

Query  802  AARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            AA++V+IGIYFATWWALNVVFNIYNKKVLNAYP+PWLTSTLSLAAGSLIML+SWA
Sbjct  94   AAKRVRIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLIMLVSWA  148



>gb|ABK91085.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>ref|XP_002443966.1| hypothetical protein SORBIDRAFT_07g005200 [Sorghum bicolor]
 gb|ABK91081.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91083.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91088.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91090.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91092.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91095.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91099.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91101.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|EES13461.1| hypothetical protein SORBIDRAFT_07g005200 [Sorghum bicolor]
Length=387

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>gb|ABK91084.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>gb|ABK91093.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>gb|ABK91091.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>gb|ABK91097.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>gb|ABK91102.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE A+++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>ref|XP_002462940.1| hypothetical protein SORBIDRAFT_02g034980 [Sorghum bicolor]
 gb|EER99461.1| hypothetical protein SORBIDRAFT_02g034980 [Sorghum bicolor]
Length=395

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +1

Query  598  LPPLPALKPCRGSVLSL-ARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  774
            LPPLPA    R   L++ ARP++        ++   +    +++       +  AD ++P
Sbjct  30   LPPLPAAAGLRPLSLAVSARPLYRQE-HVLSTVAVAAAAGRNDRATSPAPPSATADGARP  88

Query  775  IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIML  954
            +E  AA +E AR+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAAGS IML
Sbjct  89   VEVAAAPAENARRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAAGSAIML  148

Query  955  ISWA  966
             SWA
Sbjct  149  ASWA  152



>ref|XP_006391961.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
 gb|ESQ29247.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
Length=387

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 20/109 (18%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVK  819
            +P+++SS + F             KR  V  +AYEADRS+P    IE P    ++A+K+K
Sbjct  52   KPLYISSSQNF-------------KRE-VRVEAYEADRSRPLDINIELP--DEQSAQKLK  95

Query  820  IGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            IGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  96   IGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWA  144



>ref|XP_006391960.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
 gb|ESQ29246.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
Length=355

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 20/109 (18%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP----IEEPAAKSEAARKVK  819
            +P+++SS + F             KR  V  +AYEADRS+P    IE P    ++A+K+K
Sbjct  52   KPLYISSSQNF-------------KRE-VRVEAYEADRSRPLDINIELP--DEQSAQKLK  95

Query  820  IGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            IGIYFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SWA
Sbjct  96   IGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWA  144



>ref|XP_006307580.1| hypothetical protein CARUB_v10009203mg, partial [Capsella rubella]
 gb|EOA40478.1| hypothetical protein CARUB_v10009203mg, partial [Capsella rubella]
Length=430

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +1

Query  661  HVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAA--KSEAARKVKIGIYF  834
            H+ S  +  +    +     ++  +    AYEADRS+PIE        ++ +KVKIGIYF
Sbjct  84   HLLSARSLSNFTFAAAAAPQQRSDVFRVGAYEADRSRPIEIGVEVPDEQSGQKVKIGIYF  143

Query  835  ATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            ATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SW
Sbjct  144  ATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSW  186



>ref|XP_006343413.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Solanum tuberosum]
Length=381

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 66/79 (84%), Gaps = 5/79 (6%)
 Frame = +1

Query  745  KAYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWl  912
            KAYEAD+SQ     IE P ++ +  +KVKIGIYFA WW LNVVFNIYNKKVLNAYPFPWL
Sbjct  62   KAYEADKSQSLDLNIELPKSQVDG-QKVKIGIYFAIWWGLNVVFNIYNKKVLNAYPFPWL  120

Query  913  tstlslaagslIMLISWAL  969
            TSTLSLA GSLIMLISWA+
Sbjct  121  TSTLSLATGSLIMLISWAM  139



>ref|XP_010317737.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Solanum lycopersicum]
Length=381

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 65/79 (82%), Gaps = 5/79 (6%)
 Frame = +1

Query  745  KAYEADRSQP----IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWl  912
            KAYEAD+SQ     IE P ++ +  R VKIGIYFA WW LNVVFNIYNKKVLNAYPFPWL
Sbjct  62   KAYEADKSQSLDLNIELPKSQVDGQR-VKIGIYFAIWWGLNVVFNIYNKKVLNAYPFPWL  120

Query  913  tstlslaagslIMLISWAL  969
            TSTLSLA GSLIMLISWA+
Sbjct  121  TSTLSLATGSLIMLISWAM  139



>ref|XP_010458564.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=394

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 7/97 (7%)
 Frame = +1

Query  688  SLKERSRGDDHEKRALVT-CKAYEADRSQPI----EEPAAKSEAARKVKIGIYFATWWAL  852
            SL   +    H++R+ V    AYEADRS+PI    E P  + ++ +KVKIGIYFATWWAL
Sbjct  53   SLSNFTFVAAHQRRSDVFRVGAYEADRSRPIKIGVEVP--EEQSGQKVKIGIYFATWWAL  110

Query  853  NVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            NVVFNIYNKKVLNA+P+PWLTSTLSLA GSL+ML+SW
Sbjct  111  NVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSW  147



>gb|ABK91082.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91086.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91087.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91096.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91098.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91100.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE  +++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGTQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>ref|XP_004957888.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X1 [Setaria italica]
Length=388

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +1

Query  577  PAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYE  756
            PA K   LPPLPA  P   S+   ARP++              R D     A     A  
Sbjct  20   PAFKPLHLPPLPAGAPRPLSLSVSARPLYRQEHVLATVAAAAGRSDRASSPA---PPAAT  76

Query  757  ADRSQPIEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaa  936
            AD ++P+E  AA +E AR+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAA
Sbjct  77   ADGARPVEV-AAPAETARRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAA  135

Query  937  gslIMLISWA  966
            GS IML SWA
Sbjct  136  GSAIMLASWA  145



>gb|ABK91094.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S GP A  GS   R K P+       +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRLSPGPAAFSGSSL-RSKLPS-------IPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +SR    E R    C A  AD  +   +    +SE  +++KI IYFATWWALN
Sbjct  52   GPRTAELKSRRQPLEFR----CAASAADDKESKTKAVPVQSEGTQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>ref|XP_008667831.1| PREDICTED: uncharacterized protein LOC100279907 isoform X1 [Zea 
mays]
 tpg|DAA41023.1| TPA: hypothetical protein ZEAMMB73_640449 [Zea mays]
Length=394

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = +1

Query  598  LPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI  777
            LPPLPA      S+   ARP++        +    +     ++ A     +  AD ++P+
Sbjct  30   LPPLPAAGSRPLSLSVSARPLYRQD-HVLATTVAMAAAGRSDRAASPAPPSATADGARPV  88

Query  778  EEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLI  957
             E AA +E AR+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAAGS IML 
Sbjct  89   VEVAAPAETARRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAAGSAIMLA  148

Query  958  SWA  966
            SWA
Sbjct  149  SWA  151



>ref|XP_002889879.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66138.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +1

Query  721  EKRALVTCKAYEADRSQPIEE--PAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNA  894
            ++  +    AYEADRS+PIE        ++ +KVKIGIYFATWWALNVVFNIYNKKVLNA
Sbjct  63   QRSGVFRVGAYEADRSRPIEIGIDVPDEQSGQKVKIGIYFATWWALNVVFNIYNKKVLNA  122

Query  895  YPFPWltstlslaagslIMLISW  963
            +P+PWLTSTLSLA GSL+ML+SW
Sbjct  123  FPYPWLTSTLSLACGSLMMLVSW  145



>ref|XP_004957889.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X2 [Setaria italica]
Length=398

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +1

Query  577  PAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYE  756
            PA K   LPPLPA  P   S+   ARP++              R D     A     A  
Sbjct  20   PAFKPLHLPPLPAGAPRPLSLSVSARPLYRQEHVLATVAAAAGRSDRASSPA---PPAAT  76

Query  757  ADRSQPIEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaa  936
            AD ++P+E  AA +E AR+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAA
Sbjct  77   ADGARPVEV-AAPAETARRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAA  135

Query  937  gslIMLISWA  966
            GS IML SWA
Sbjct  136  GSAIMLASWA  145



>gb|ABO87607.1| chloroplast glucose-6-phosphate/phosphate translocator [Pisum 
sativum]
Length=385

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 85/138 (62%), Gaps = 24/138 (17%)
 Frame = +1

Query  598  LPPLPALKPCRGSVLSLA---------RPVHVSSVETFGSLKERSRGDDHEKRALVTCKA  750
              PL + KP   + L+           +P+++SS + F S     R  +        C A
Sbjct  14   FTPLSSSKPKLSTTLTFHNVAKNTIHFKPLYLSSTQNF-SFSTAKRVTE--------CHA  64

Query  751  YEADRSQPIEEPAAKS------EAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWl  912
            YEADRS+    P A +        A+K+KIG+YFATWWALNVVFNIYNKKVLNA+P+PWL
Sbjct  65   YEADRSESEPAPLAVNIDVPVEPVAQKMKIGLYFATWWALNVVFNIYNKKVLNAFPYPWL  124

Query  913  tstlslaagslIMLISWA  966
            TSTLSLAAGSLIM ISWA
Sbjct  125  TSTLSLAAGSLIMWISWA  142



>gb|KFK31943.1| hypothetical protein AALP_AA6G180100 [Arabis alpina]
Length=389

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = +1

Query  721  EKRALVTCKAYEADRSQPIEEPAA--KSEAARKVKIGIYFATWWALNVVFNIYNKKVLNA  894
            ++R      AYEADRS+ IE        ++ +KVKIGIYFATWWALNVVFNIYNKKVLNA
Sbjct  63   QRRDGFKVGAYEADRSRQIEIGVDIPDEQSGQKVKIGIYFATWWALNVVFNIYNKKVLNA  122

Query  895  YPFPWltstlslaagslIMLISW  963
            +P+PWLTSTLSLA GSL+ML+SW
Sbjct  123  FPYPWLTSTLSLACGSLMMLVSW  145



>ref|XP_004972694.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Setaria italica]
Length=387

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            M+ +VR S  P A  GS   R KS +       +P + +LKP +  V SL RP++++ ++
Sbjct  1    MLPSVRLSPAPAAFSGSSL-RSKSAS-------IPSISSLKPSKYVVSSL-RPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +++    E R    C A  AD  +   E    +SE A+K+KI IYFATWWALN
Sbjct  52   GPRTAELKAQRQPLEFR----CAASAADDKESKAEVVPVQSEGAQKLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +M+ SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMIFSWA  144



>ref|NP_001147439.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
 gb|ACG27520.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=400

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = +1

Query  598  LPPLPALKPCRGSVLSL-ARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  774
            LPPLPA    R   LS+ ARP++    E   +    +    +++ A     +  AD S+P
Sbjct  37   LPPLPAAAGLRPLSLSVSARPLYRQ--EHVLASVAVAAAGRNDRAASPAPPSATADGSRP  94

Query  775  IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIML  954
            +E  AA +E  R+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAAGS IML
Sbjct  95   LEV-AAPAETGRRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAAGSAIML  153

Query  955  ISWA  966
             SWA
Sbjct  154  ASWA  157



>ref|XP_008812143.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Phoenix dactylifera]
Length=417

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 97/161 (60%), Gaps = 23/161 (14%)
 Frame = +1

Query  553  FFRPKSPAPAPKLC-VLPPLPA----LKPCR-----------GSVLSLARPVHVSSVETF  684
            F   KSP+  P+ C  LPP+ +    L   R           GS    +R  HV + E  
Sbjct  14   FMLYKSPSLRPRSCSALPPISSSSENLDSARSSRKRLCLTPLGSFGFGSRDGHVHAAEPR  73

Query  685  GSLKERS--RGDDHEKRALVTCKA---YEADRSQPIEEPA--AKSEAARKVKIGIYFATW  843
            G   +R+    +  E  AL +  A   YEA+  + I  P+  A+  AA+K+KIGIYFATW
Sbjct  74   GLSFKRTAYEANSAEGIALPSEDARTDYEANSVEGIALPSEDARPAAAQKLKIGIYFATW  133

Query  844  WALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            WALNVVFNIYNKKVLN +P+PWLTSTLSLAAGSLIMLISWA
Sbjct  134  WALNVVFNIYNKKVLNVFPYPWLTSTLSLAAGSLIMLISWA  174



>tpg|DAA62951.1| TPA: glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=391

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = +1

Query  598  LPPLPALKPCRGSVLSL-ARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  774
            LPPLPA    R   LS+ ARP++    E   +    +    +E+       +  AD ++P
Sbjct  28   LPPLPAAAGLRPLSLSVSARPLYRQ--EHVLASVAVAAAGRNERATSPAPPSATADGARP  85

Query  775  IEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIML  954
            +E  AA +E  R+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAAGS IML
Sbjct  86   LEV-AAPAETGRRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAAGSAIML  144

Query  955  ISWA  966
             SWA
Sbjct  145  ASWA  148



>gb|ABC95747.1| glucose-6-phosphate/phosphate translocator [Hordeum vulgare]
 gb|ABC95748.1| glucose-6-phosphate/phosphate translocator, partial [Hordeum 
vulgare]
Length=197

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 9/108 (8%)
 Frame = +1

Query  652  RPVHVSSVE--TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKI  822
            RP++++ ++      LK R +  D +      C A  AD  +   E   A SEAA+K+KI
Sbjct  26   RPLYLTRIDDPQTSELKPRRQLLDFQ------CAASAADDKESKAEVVPASSEAAQKLKI  79

Query  823  GIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
             IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  80   SIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  127



>gb|AIR93780.1| glucose 6-phosphate phosphate translocator [Kalanchoe fedtschenkoi]
Length=395

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = +1

Query  610  PALKP-CRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEP  786
            PA  P     VLS  R V    V +FG L E    D     A+  C+AYEA+ S   ++ 
Sbjct  38   PATNPLTSAGVLSKPRLVSPVLVRSFGVLTE----DRKRGLAVEPCRAYEAEGSVE-DDG  92

Query  787  AAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
             AKSEAA+K KIG+YFATWWALNVVFNIYNKKVLNA+P+PWLTSTLSLAAGSLIM+ISWA
Sbjct  93   RAKSEAAKKAKIGVYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLAAGSLIMIISWA  152



>ref|NP_001061152.1| Os08g0187800 [Oryza sativa Japonica Group]
 dbj|BAD03325.1| glucose-6-phosphate/phosphate translocator [Oryza sativa Japonica 
Group]
 dbj|BAD05754.1| glucose-6-phosphate/phosphate translocator [Oryza sativa Japonica 
Group]
 dbj|BAF23066.1| Os08g0187800 [Oryza sativa Japonica Group]
 dbj|BAG87501.1| unnamed protein product [Oryza sativa Japonica Group]
Length=387

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  637  VLSLARPVHVSSVETFGSLKERSRGDDHEKRAL-VTCKAYEADRSQPIEEPA-AKSEAAR  810
            V+S  RP++++ ++       R+ G   +++ L   C A  AD  +   E    +SEAA+
Sbjct  38   VVSSLRPLYLAPLD-----GPRAAGQKAQRQPLEFRCAASAADDKESKTEVVPVRSEAAQ  92

Query  811  KVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML+SWA
Sbjct  93   KLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLVSWA  144



>ref|XP_003573402.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Brachypodium distachyon]
Length=387

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 88/130 (68%), Gaps = 10/130 (8%)
 Frame = +1

Query  586  KLCVLPPLPALKPCRGSVLSLARPVHVSSVET--FGSLKERSRGDDHEKRALVTCKAYEA  759
            K  ++P + ++KP + +  SL RP++++ ++      LK R +  + +      C A  A
Sbjct  22   KSALVPSVSSIKPSKFAACSL-RPLYLAPLDGPRTALLKPRKQLLEFQ------CAASAA  74

Query  760  DRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaa  936
            D  +   E    +SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA 
Sbjct  75   DDKESKAEVVPVRSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAC  134

Query  937  gslIMLISWA  966
            GS++ML SWA
Sbjct  135  GSIMMLFSWA  144



>gb|EEC83014.1| hypothetical protein OsI_28073 [Oryza sativa Indica Group]
Length=395

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  637  VLSLARPVHVSSVETFGSLKERSRGDDHEKRAL-VTCKAYEADRSQPIEEPA-AKSEAAR  810
            V+S  RP++++ ++       R+ G   +++ L   C A  AD  +   E    +SEAA+
Sbjct  46   VVSSFRPLYLAPLD-----GPRAAGQKAQRQPLEFRCAASAADDKESKTEVVPVRSEAAQ  100

Query  811  KVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML+SWA
Sbjct  101  KLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLVSWA  152



>gb|AAK54618.1|AF375053_1 glucose-6-phosphate/phosphate translocator [Oryza sativa]
Length=387

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  637  VLSLARPVHVSSVETFGSLKERSRGDDHEKRAL-VTCKAYEADRSQPIEEPA-AKSEAAR  810
            V+S  RP++++ ++       R+ G   +++ L   C A  AD  +   E    +SEAA+
Sbjct  38   VVSPLRPLYLAPLD-----GPRAAGQKAQRQPLEFRCAASAADDKESKTEVVPVRSEAAQ  92

Query  811  KVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML+SWA
Sbjct  93   KLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLVSWA  144



>ref|XP_010229653.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Brachypodium distachyon]
Length=508

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +1

Query  748  AYEADRSQPIEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstls  927
            A  AD ++P+E   A  EAAR+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLS
Sbjct  195  AATADGARPVE--TAAPEAARRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLS  252

Query  928  laagslIMLISWA  966
            LAAGS IML SWA
Sbjct  253  LAAGSAIMLASWA  265



>dbj|BAJ93997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 9/108 (8%)
 Frame = +1

Query  652  RPVHVSSVE--TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKI  822
            RP++++ ++      LK R +  D +      C A  AD  +   E   A SEAA+K+KI
Sbjct  41   RPLYLTRIDDPQTSELKPRRQLLDFQ------CAASAADDKESKAEVVPASSEAAQKLKI  94

Query  823  GIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
             IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  95   SIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  142



>gb|ABC95693.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95694.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95695.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95696.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95697.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95698.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95699.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95700.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95701.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95702.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95703.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95704.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95705.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95706.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95707.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95708.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95709.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95710.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95711.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95712.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95713.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95714.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95715.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95716.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95717.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95718.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95719.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95720.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95721.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95722.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95723.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95724.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95725.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95726.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95727.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95728.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95729.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95730.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95731.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95732.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
turgidum]
 gb|ABC95733.1| glucose-6-phosphate/phosphate translocator [Aegilops speltoides]
 gb|ABC95734.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
speltoides]
 gb|ABC95735.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
speltoides]
 gb|ABC95744.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
speltoides]
 gb|ABC95745.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
speltoides]
 gb|ABD47380.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47381.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47382.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47383.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47384.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47385.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47386.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47387.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47388.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47389.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47390.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
Length=197

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVVPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>ref|XP_001778585.1| predicted protein [Physcomitrella patens]
 gb|EDQ56615.1| predicted protein, partial [Physcomitrella patens]
Length=317

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  754  EADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlsl  930
             +D +  ++  A AKS+AA ++KIG YFA WW LNVVFNIYNKKVLNAYP PWLTSTLSL
Sbjct  5    HSDETPKVDTAAVAKSDAAHRLKIGTYFAVWWGLNVVFNIYNKKVLNAYPMPWLTSTLSL  64

Query  931  aagslIMLISWAL  969
            AAGS IMLISWAL
Sbjct  65   AAGSAIMLISWAL  77



>gb|ABC95740.1| glucose-6-phosphate/phosphate translocator [Aegilops longissima]
 gb|ABC95741.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
longissima]
 gb|ABC95742.1| glucose-6-phosphate/phosphate translocator [Aegilops sharonensis]
 gb|ABC95743.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
sharonensis]
Length=197

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVVPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>gb|ABC95648.1| glucose-6-phosphate/phosphate translocator [Triticum monococcum]
 gb|ABC95649.1| glucose-6-phosphate/phosphate translocator [Triticum urartu]
 gb|ABC95651.1| glucose-6-phosphate/phosphate translocator [Triticum monococcum 
subsp. aegilopoides]
 gb|ABC95652.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
monococcum subsp. aegilopoides]
 gb|ABC95736.1| glucose-6-phosphate/phosphate translocator [Aegilops searsii]
 gb|ABC95737.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
searsii]
 gb|ABC95738.1| glucose-6-phosphate/phosphate translocator [Aegilops bicornis]
 gb|ABC95739.1| glucose-6-phosphate/phosphate translocator, partial [Aegilops 
bicornis]
Length=197

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVVPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>ref|XP_002984083.1| hypothetical protein SELMODRAFT_45116, partial [Selaginella moellendorffii]
 gb|EFJ15095.1| hypothetical protein SELMODRAFT_45116, partial [Selaginella moellendorffii]
Length=320

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = +1

Query  727  RALVTCKAYEADRSQPIEEPAAKSE-AARKVKIGIYFATWWALNVVFNIYNKKVLNAYPF  903
            + +V  +AYEAD      EPAAK+     ++KIGIYF TWWALNVVFNIYNKKVLNAYP+
Sbjct  1    KRIVRAEAYEADADH---EPAAKAPPQLNRLKIGIYFVTWWALNVVFNIYNKKVLNAYPY  57

Query  904  PWltstlslaagslIMLISWA  966
            PWLTSTLSLAAGS +ML SWA
Sbjct  58   PWLTSTLSLAAGSALMLASWA  78



>gb|ABC95650.1| glucose-6-phosphate/phosphate translocator [Triticum urartu]
Length=197

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVVPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSL  GS +ML SW
Sbjct  112  TLSLVCGSAMMLFSW  126



>gb|ABD47369.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47370.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47371.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47372.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47373.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii subsp. armeniacum]
 gb|ABD47374.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47375.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47376.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47377.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47378.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
 gb|ABD47379.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
timopheevii]
Length=197

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 13/115 (11%)
 Frame = +1

Query  658  VHVSSVETFGSLKER----SRGDD-HE-----KRALVT--CKAYEADRSQPIEEPA-AKS  798
            V + +++ F S   R    +R DD H      +R L+   C A  AD  +   E   A S
Sbjct  12   VSILNMKNFASCSLRPLYLTRLDDPHTSELKPRRQLLDFWCAASAADDKESKAEVVPASS  71

Query  799  EAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            EAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SW
Sbjct  72   EAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSW  126



>ref|XP_002960055.1| hypothetical protein SELMODRAFT_70870, partial [Selaginella moellendorffii]
 gb|EFJ37594.1| hypothetical protein SELMODRAFT_70870, partial [Selaginella moellendorffii]
Length=320

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = +1

Query  727  RALVTCKAYEADRSQPIEEPAAKSE-AARKVKIGIYFATWWALNVVFNIYNKKVLNAYPF  903
            + +V  +AYEAD      EPAAK+     ++KIGIYF TWWALNVVFNIYNKKVLNAYP+
Sbjct  1    KRIVRAEAYEADADH---EPAAKAPPQLNRLKIGIYFVTWWALNVVFNIYNKKVLNAYPY  57

Query  904  PWltstlslaagslIMLISWA  966
            PWLTSTLSLAAGS +ML SWA
Sbjct  58   PWLTSTLSLAAGSALMLASWA  78



>gb|ABC95667.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
Length=197

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVLPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>gb|ABC95653.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95654.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95655.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95656.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95657.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95658.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95659.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95660.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95661.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95662.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95663.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95664.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95665.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95666.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95668.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95669.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95670.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95671.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95672.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95673.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95674.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95676.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95677.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95678.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95679.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95680.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95681.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95682.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccon]
 gb|ABC95683.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95684.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95685.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95686.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95687.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95688.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95690.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95691.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
 gb|ABC95692.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
turgidum]
Length=197

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVLPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>gb|ABC95689.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
Length=197

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVLPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>gb|ACG36927.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=387

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 95/157 (61%), Gaps = 15/157 (10%)
 Frame = +1

Query  502  MISAVRQS-GPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  678
            MI +VR S G  A  GS            KL  +P + +LKP +  V SL +P++++ ++
Sbjct  1    MIPSVRISPGSAAFSGSSL--------RLKLHSIPSISSLKPSKYVVSSL-KPLYLAPLD  51

Query  679  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALN  855
               + + +S     E R    C A  AD  +   +    + E A+++KI IYFATWWALN
Sbjct  52   GPHTSELKSWRQPLEFR----CAASAADDKESKTQVVPVQLEGAQRLKISIYFATWWALN  107

Query  856  VVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            V+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SWA
Sbjct  108  VIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWA  144



>gb|EPS63359.1| hypothetical protein M569_11424, partial [Genlisea aurea]
Length=324

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +1

Query  721  EKRALVTCKAYEA--DRSQPIEEPAAKSEA-ARKVKIGIYFATWWALNVVFNIYNKKVLN  891
            +  A V C AYEA    S PI        A A+KVKIG+YFA WW+LNV+FNIYNKKVLN
Sbjct  2    DDAAAVKCGAYEARPADSVPIGGVEIDGGAVAQKVKIGVYFAAWWSLNVIFNIYNKKVLN  61

Query  892  AYPFPWltstlslaagslIMLISWA  966
            A+PFPWLTSTLSLAAGS +ML+SWA
Sbjct  62   AFPFPWLTSTLSLAAGSFLMLLSWA  86



>ref|XP_001775355.1| predicted protein [Physcomitrella patens]
 gb|EDQ59825.1| predicted protein [Physcomitrella patens]
Length=351

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 66/92 (72%), Gaps = 10/92 (11%)
 Frame = +1

Query  724  KRALV---TCKAYEADRSQPIEEPAAKSE-------AARKVKIGIYFATWWALNVVFNIY  873
            K+ALV   + +A +A  S    E   K         A R+VKIGIYFATWWALNVVFNIY
Sbjct  2    KKALVHRVSAQAGDASSSDAYPEGTPKVGDVEVPKPAMRRVKIGIYFATWWALNVVFNIY  61

Query  874  NKKVLNAYPFPWltstlslaagslIMLISWAL  969
            NKKVLN +PFPWLTSTLSLAAGS IMLISWAL
Sbjct  62   NKKVLNVFPFPWLTSTLSLAAGSAIMLISWAL  93



>gb|ABC95675.1| glucose-6-phosphate/phosphate translocator, partial [Triticum 
dicoccoides]
Length=197

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVLPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>ref|XP_001764779.1| predicted protein [Physcomitrella patens]
 gb|EDQ70478.1| predicted protein [Physcomitrella patens]
Length=298

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  811  KVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWAL  969
            +VKIGIYFATWWALNVVFNIYNKKVLNAYPFPWLTSTLSLAAGS IMLISWAL
Sbjct  3    RVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWLTSTLSLAAGSAIMLISWAL  55



>ref|NP_001131942.1| uncharacterized protein LOC100193334 [Zea mays]
 gb|ACF80573.1| unknown [Zea mays]
Length=387

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 85/128 (66%), Gaps = 6/128 (5%)
 Frame = +1

Query  586  KLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADR  765
            KL  +P + +LKP +  V SL +P++++ ++   + + +S     E R    C A  AD 
Sbjct  22   KLHSIPSISSLKPSKYVVSSL-KPLYLAPLDGPHTSELKSWRQPLEFR----CAASAADD  76

Query  766  SQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaags  942
             +   +    + E A+++KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS
Sbjct  77   KESKTQVVPVQLEGAQRLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGS  136

Query  943  lIMLISWA  966
             +ML SWA
Sbjct  137  AMMLFSWA  144



>gb|ABC95746.1| glucose-6-phosphate/phosphate translocator [Aegilops tauschii]
Length=197

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SE A+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  52   CAASAADDKESKAEVVPASSEVAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  111

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  112  TLSLACGSAMMLFSW  126



>ref|XP_006657775.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=325

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
 Frame = +1

Query  757  ADRSQPIEEPAAK----SEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstl  924
            AD + P+E  AA     +E AR+ KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTL
Sbjct  9    ADGAHPVEAAAAAAAAPTETARRAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTL  68

Query  925  slaagslIMLISWA  966
            SLAAGS IML SWA
Sbjct  69   SLAAGSAIMLASWA  82



>gb|AAP80864.1| glucose-6-phosphate/phosphate translocator [Triticum aestivum]
Length=385

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = +1

Query  652  RPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKSEAARKVKIGI  828
            RP++++ ++   + + + R    + R    C A  AD  +   E   A SEAA+K+KI I
Sbjct  41   RPLYLTRLDDPHTFELKPRRQLLDFR----CAASAADDKESKAEVLPASSEAAQKLKISI  96

Query  829  YFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISW  963
            YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS +ML SW
Sbjct  97   YFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSW  141



>gb|AFW61083.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=440

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 85/128 (66%), Gaps = 6/128 (5%)
 Frame = +1

Query  586  KLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADR  765
            KL  +P + +LKP +  V SL +P++++ ++   + + +S     E R    C A  AD 
Sbjct  75   KLHSIPSISSLKPSKYVVSSL-KPLYLAPLDGPHTSELKSWRQPLEFR----CAASAADD  129

Query  766  SQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaags  942
             +   +    + E A+++KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLA GS
Sbjct  130  KESKTQVVPVQLEGAQRLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGS  189

Query  943  lIMLISWA  966
             +ML SWA
Sbjct  190  AMMLFSWA  197



>gb|EMS53161.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Triticum 
urartu]
Length=459

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SEAA+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  86   CAASAADDKESKAEVVPASSEAAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  145

Query  919  tlslaagslIMLISW  963
            TLSL  GS +ML SW
Sbjct  146  TLSLVCGSAMMLFSW  160



>gb|KHN03064.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic, 
partial [Glycine soja]
Length=267

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +1

Query  790  AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            A  EA +++KIG+YFATWWALNV FNIYNKKVLNA+P+PWLTSTLSLAAGSLIMLISWA
Sbjct  2    AGIEATQRIKIGLYFATWWALNVAFNIYNKKVLNAFPYPWLTSTLSLAAGSLIMLISWA  60



>ref|XP_002960052.1| hypothetical protein SELMODRAFT_270155 [Selaginella moellendorffii]
 gb|EFJ37591.1| hypothetical protein SELMODRAFT_270155 [Selaginella moellendorffii]
Length=390

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query  718  HEKRALVTCKAYEADRSQPIEEPAAKSEA-ARKVKIGIYFATWWALNVVFNIYNKKVLNA  894
             + RA    + YEA++ +     +A+  A   ++KIGIYF TWW+LNVVFNIYNKKVLNA
Sbjct  63   QQPRASFKAETYEANQGETAPPSSAEPAAPMNRLKIGIYFVTWWSLNVVFNIYNKKVLNA  122

Query  895  YPFPWltstlslaagslIMLISWA  966
            YPFPWLTSTLSL  GS +M +SWA
Sbjct  123  YPFPWLTSTLSLLTGSTLMFLSWA  146



>ref|XP_002984086.1| hypothetical protein SELMODRAFT_156336 [Selaginella moellendorffii]
 gb|EFJ15098.1| hypothetical protein SELMODRAFT_156336 [Selaginella moellendorffii]
Length=390

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = +1

Query  718  HEKRALVTCKAYEADRSQPIEEPAAKSEA-ARKVKIGIYFATWWALNVVFNIYNKKVLNA  894
             + RA    + YEA++ +     +A+  A   ++KIGIYF TWW+LNVVFNIYNKKVLNA
Sbjct  63   QQPRASFKAETYEANQGETAPPSSAEPAAPMNRLKIGIYFVTWWSLNVVFNIYNKKVLNA  122

Query  895  YPFPWltstlslaagslIMLISWA  966
            YPFPWLTSTLSL AGS +M +SWA
Sbjct  123  YPFPWLTSTLSLLAGSTLMFLSWA  146



>gb|EMT25193.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Aegilops 
tauschii]
Length=548

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  742  CKAYEADRSQPIEEPA-AKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWlts  918
            C A  AD  +   E   A SE A+K+KI IYFATWWALNV+FNIYNKKVLNA+P+PWLTS
Sbjct  205  CAASAADDKESKAEVVPASSEVAQKLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTS  264

Query  919  tlslaagslIMLISW  963
            TLSLA GS +ML SW
Sbjct  265  TLSLACGSAMMLFSW  279



>ref|XP_001755644.1| predicted protein [Physcomitrella patens]
 gb|EDQ79704.1| predicted protein, partial [Physcomitrella patens]
Length=313

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 55/66 (83%), Gaps = 2/66 (3%)
 Frame = +1

Query  778  EEPAAKSEAA--RKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIM  951
            EE AAK  AA   K+ IG+ FA WW+LNVVFNIYNKKVLN YPFPWLTSTLSLAAGS IM
Sbjct  2    EEKAAKQNAADASKLNIGMKFAVWWSLNVVFNIYNKKVLNVYPFPWLTSTLSLAAGSGIM  61

Query  952  LISWAL  969
            LISWAL
Sbjct  62   LISWAL  67



>gb|EMT13790.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Aegilops 
tauschii]
Length=384

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +1

Query  760  DRSQPIEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaag  939
            D ++P+E  AA  EAA+  KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAAG
Sbjct  74   DGARPVET-AAAPEAAKSAKIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAAG  132

Query  940  slIMLISWA  966
            S IML+SWA
Sbjct  133  SAIMLVSWA  141



>dbj|BAG91782.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  817  KIGIYFATWWALNVVFNIYNKKVLNAYPFPWltstlslaagslIMLISWA  966
            KIG+YFATWWALNV+FNIYNKKVLNA+P+PWLTSTLSLAAGS IML SWA
Sbjct  139  KIGVYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLAAGSAIMLASWA  188



>gb|ACN40020.1| unknown [Picea sitchensis]
Length=341

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 10/87 (11%)
 Frame = +1

Query  736  VTCKAYEAD----------RSQPIEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKV  885
            V  KAYEA             + + E  +   AA+++KIGIYF  WW LNVVFNIYNKKV
Sbjct  64   VQAKAYEASSSDLVSDSDVEEEVLSENPSPQAAAQRLKIGIYFVAWWTLNVVFNIYNKKV  123

Query  886  LNAYPFPWltstlslaagslIMLISWA  966
            LNA+P+PWLTSTLSLA GSL+M +SWA
Sbjct  124  LNAFPYPWLTSTLSLAVGSLMMWVSWA  150



>gb|ABK24716.1| unknown [Picea sitchensis]
Length=420

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 10/87 (11%)
 Frame = +1

Query  736  VTCKAYEAD----------RSQPIEEPAAKSEAARKVKIGIYFATWWALNVVFNIYNKKV  885
            V  KAYEA             + + E  +   AA+++KIGIYF  WW LNVVFNIYNKKV
Sbjct  90   VQAKAYEASSSDLVSDSDVEEEVLSENPSPQAAAQRLKIGIYFVAWWTLNVVFNIYNKKV  149

Query  886  LNAYPFPWltstlslaagslIMLISWA  966
            LNA+P+PWLTSTLSLA GSL+M +SWA
Sbjct  150  LNAFPYPWLTSTLSLAVGSLMMWVSWA  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2377925492388