BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1695

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074970.1|  PREDICTED: elongation factor 1-gamma-like          343   3e-113   Sesamum indicum [beniseed]
gb|AGJ83736.1|  elongation factor 1-gamma-like protein                  327   1e-109   Caragana korshinskii
ref|XP_004240589.1|  PREDICTED: elongation factor 1-gamma 2-like        330   1e-108   Solanum lycopersicum
ref|NP_001046318.1|  Os02g0220600                                       329   5e-108   
ref|XP_002278756.2|  PREDICTED: elongation factor 1-gamma               329   6e-108   Vitis vinifera
ref|XP_007041182.1|  Elongation factor 1-gamma 3 isoform 2              325   8e-108   
gb|ACA50518.1|  elongation factor 1-gamma                               328   9e-108   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046317.1|  Os02g0220500                                       328   9e-108   
sp|Q6YW46.2|EF1G2_ORYSJ  RecName: Full=Elongation factor 1-gamma ...    328   1e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099002.1|  PREDICTED: elongation factor 1-gamma 2-like        327   2e-107   Sesamum indicum [beniseed]
ref|XP_006647077.1|  PREDICTED: elongation factor 1-gamma 2-like        327   3e-107   Oryza brachyantha
ref|XP_007222556.1|  hypothetical protein PRUPE_ppa006233mg             327   3e-107   
ref|XP_007041183.1|  Elongation factor 1-gamma 3 isoform 3              323   4e-107   
gb|EYU28215.1|  hypothetical protein MIMGU_mgv1a007176mg                326   8e-107   Erythranthe guttata [common monkey flower]
ref|XP_008219063.1|  PREDICTED: elongation factor 1-gamma-like          326   1e-106   Prunus mume [ume]
gb|KDO42761.1|  hypothetical protein CISIN_1g014592mg                   322   2e-106   Citrus sinensis [apfelsine]
ref|XP_004250641.1|  PREDICTED: elongation factor 1-gamma 2-like ...    325   3e-106   Solanum lycopersicum
ref|XP_004294500.1|  PREDICTED: elongation factor 1-gamma-like          324   5e-106   Fragaria vesca subsp. vesca
gb|ABA81876.1|  unknown                                                 324   6e-106   Solanum tuberosum [potatoes]
emb|CDP10743.1|  unnamed protein product                                323   1e-105   Coffea canephora [robusta coffee]
ref|XP_006478210.1|  PREDICTED: elongation factor 1-gamma-like          323   2e-105   Citrus sinensis [apfelsine]
ref|XP_007041181.1|  Elongation factor 1-gamma 3 isoform 1              322   3e-105   Theobroma cacao [chocolate]
ref|XP_009610261.1|  PREDICTED: elongation factor 1-gamma 2-like ...    322   3e-105   Nicotiana tomentosiformis
ref|XP_010686883.1|  PREDICTED: elongation factor 1-gamma-like          322   4e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB47897.1|  hypothetical protein B456_008G046200                    321   1e-104   Gossypium raimondii
ref|XP_004250642.1|  PREDICTED: elongation factor 1-gamma 2-like ...    320   2e-104   Solanum lycopersicum
ref|XP_009418787.1|  PREDICTED: elongation factor 1-gamma 2-like        320   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU22759.1|  hypothetical protein MIMGU_mgv1a007114mg                320   2e-104   Erythranthe guttata [common monkey flower]
ref|XP_010928857.1|  PREDICTED: elongation factor 1-gamma 2             320   2e-104   Elaeis guineensis
gb|KDO42759.1|  hypothetical protein CISIN_1g014592mg                   320   3e-104   Citrus sinensis [apfelsine]
ref|XP_006339362.1|  PREDICTED: elongation factor 1-gamma 2-like ...    320   3e-104   Solanum tuberosum [potatoes]
ref|XP_006441587.1|  hypothetical protein CICLE_v10020303mg             319   5e-104   Citrus clementina [clementine]
ref|XP_008339178.1|  PREDICTED: elongation factor 1-gamma-like          315   6e-104   
ref|XP_002451782.1|  hypothetical protein SORBIDRAFT_04g007760          319   6e-104   Sorghum bicolor [broomcorn]
ref|XP_003571724.1|  PREDICTED: elongation factor 1-gamma 2             319   7e-104   Brachypodium distachyon [annual false brome]
gb|ADR70876.1|  eukaryotic translation elongation factor 1B gamma...    319   9e-104   Hevea brasiliensis [jebe]
ref|XP_010272550.1|  PREDICTED: elongation factor 1-gamma-like is...    320   1e-103   Nelumbo nucifera [Indian lotus]
ref|XP_009610260.1|  PREDICTED: elongation factor 1-gamma 2-like ...    318   1e-103   Nicotiana tomentosiformis
gb|AAO72574.1|  elongation factor 1 gamma-like protein                  318   1e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006431568.1|  hypothetical protein CICLE_v10003566mg             318   1e-103   Citrus clementina [clementine]
ref|XP_006385057.1|  elongation factor 1-gamma 1 family protein         318   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_009353791.1|  PREDICTED: elongation factor 1-gamma               318   1e-103   Pyrus x bretschneideri [bai li]
ref|XP_002264400.1|  PREDICTED: elongation factor 1-gamma-like          318   2e-103   Vitis vinifera
emb|CAN75785.1|  hypothetical protein VITISV_021574                     318   2e-103   Vitis vinifera
ref|XP_008339412.1|  PREDICTED: elongation factor 1-gamma               318   2e-103   
ref|XP_009774948.1|  PREDICTED: elongation factor 1-gamma 2-like ...    317   2e-103   Nicotiana sylvestris
ref|XP_010272551.1|  PREDICTED: elongation factor 1-gamma-like is...    317   3e-103   Nelumbo nucifera [Indian lotus]
gb|ACB72462.1|  elongation factor 1 gamma-like protein                  317   3e-103   Nicotiana tabacum [American tobacco]
ref|XP_006494223.1|  PREDICTED: elongation factor 1-gamma 3-like ...    315   1e-102   Citrus sinensis [apfelsine]
ref|XP_009759974.1|  PREDICTED: elongation factor 1-gamma 2-like ...    315   2e-102   Nicotiana sylvestris
ref|XP_009362385.1|  PREDICTED: elongation factor 1-gamma-like          315   2e-102   Pyrus x bretschneideri [bai li]
gb|EEE56572.1|  hypothetical protein OsJ_05923                          317   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004951452.1|  PREDICTED: elongation factor 1-gamma 2-like        315   2e-102   Setaria italica
ref|XP_011028370.1|  PREDICTED: elongation factor 1-gamma 2-like        315   3e-102   Populus euphratica
ref|XP_003563720.1|  PREDICTED: elongation factor 1-gamma 3             314   4e-102   Brachypodium distachyon [annual false brome]
ref|XP_008677347.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    313   7e-102   
ref|XP_008804357.1|  PREDICTED: elongation factor 1-gamma 2-like        315   8e-102   Phoenix dactylifera
ref|XP_006656177.1|  PREDICTED: elongation factor 1-gamma 3-like        313   9e-102   
ref|XP_009417204.1|  PREDICTED: elongation factor 1-gamma 2-like        313   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009774942.1|  PREDICTED: elongation factor 1-gamma 2-like ...    313   1e-101   Nicotiana sylvestris
ref|XP_006339363.1|  PREDICTED: elongation factor 1-gamma 2-like ...    313   1e-101   Solanum tuberosum [potatoes]
gb|AFW76479.1|  elongation factor gamma1                                310   1e-101   
gb|EEC72757.1|  hypothetical protein OsI_06402                          315   1e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_011047878.1|  PREDICTED: elongation factor 1-gamma               313   2e-101   Populus euphratica
ref|XP_008643919.1|  PREDICTED: uncharacterized protein LOC100381...    312   2e-101   
ref|XP_010242290.1|  PREDICTED: elongation factor 1-gamma-like          312   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_009759973.1|  PREDICTED: elongation factor 1-gamma 2-like ...    311   7e-101   Nicotiana sylvestris
ref|NP_001151229.1|  elongation factor 1-gamma 2                        311   9e-101   Zea mays [maize]
gb|ADB11388.1|  gamma class glutathione transferase EF1Bgamma3          309   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_007222927.1|  hypothetical protein PRUPE_ppa005220mg             311   5e-100   Prunus persica
ref|NP_001057916.1|  Os06g0571400                                       308   6e-100   
ref|XP_008789739.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    308   7e-100   Phoenix dactylifera
gb|EMT20600.1|  Elongation factor 1-gamma 2                             308   7e-100   
ref|XP_004966044.1|  PREDICTED: elongation factor 1-gamma 3-like        308   1e-99    Setaria italica
gb|EAZ37421.1|  hypothetical protein OsJ_21756                          309   1e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002438602.1|  hypothetical protein SORBIDRAFT_10g022570          308   1e-99    Sorghum bicolor [broomcorn]
sp|Q9FUM1.1|EF1G_PRUAV  RecName: Full=Elongation factor 1-gamma; ...    308   2e-99    Prunus avium [gean]
gb|EEC80835.1|  hypothetical protein OsI_23436                          309   2e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_004966045.1|  PREDICTED: elongation factor 1-gamma 3-like        307   2e-99    Setaria italica
gb|ACG36145.1|  elongation factor 1-gamma 3                             307   2e-99    Zea mays [maize]
ref|XP_008647353.1|  PREDICTED: uncharacterized protein LOC100192...    307   2e-99    
ref|XP_006389499.1|  elongation factor 1-gamma 1 family protein         307   2e-99    
gb|KJB47886.1|  hypothetical protein B456_008G046300                    303   3e-99    Gossypium raimondii
gb|ACJ84952.1|  unknown                                                 300   3e-99    Medicago truncatula
gb|AGC13156.1|  EF1Bgamma class glutathione S-transferase               300   4e-99    Pinus tabuliformis [southern Chinese pine]
ref|XP_011623896.1|  PREDICTED: elongation factor 1-gamma               305   2e-98    Amborella trichopoda
ref|NP_001148829.1|  elongation factor 1-gamma 3                        305   2e-98    Zea mays [maize]
ref|XP_008365338.1|  PREDICTED: elongation factor 1-gamma-like          302   2e-98    
gb|EMS60520.1|  Elongation factor 1-gamma 2                             305   2e-98    Triticum urartu
ref|XP_008218696.1|  PREDICTED: elongation factor 1-gamma               304   5e-98    Prunus mume [ume]
gb|AHZ94964.1|  elongation factor 1                                     302   1e-97    Lilium regale
gb|AAO72563.1|  elongation factor 1 gamma-like protein                  302   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010030200.1|  PREDICTED: elongation factor 1-gamma               302   2e-97    Eucalyptus grandis [rose gum]
ref|NP_001274793.1|  elongation factor 1-gamma 2-like                   302   3e-97    Solanum tuberosum [potatoes]
ref|XP_008456982.1|  PREDICTED: elongation factor 1-gamma-like          301   5e-97    Cucumis melo [Oriental melon]
ref|XP_010683294.1|  PREDICTED: elongation factor 1-gamma 2-like        301   7e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB47883.1|  hypothetical protein B456_008G046300                    300   1e-96    Gossypium raimondii
gb|KHG04277.1|  hypothetical protein F383_29497                         300   1e-96    Gossypium arboreum [tree cotton]
gb|KHG12420.1|  hypothetical protein F383_17048                         300   1e-96    Gossypium arboreum [tree cotton]
gb|KHN03584.1|  Elongation factor 1-gamma                               300   2e-96    Glycine soja [wild soybean]
gb|AIZ68134.1|  translation elongation factor 1-gamma                   300   2e-96    Ornithogalum longebracteatum [sea-onion]
ref|XP_006600242.1|  PREDICTED: elongation factor 1-gamma isoform X1    300   2e-96    
ref|XP_009355338.1|  PREDICTED: elongation factor 1-gamma               300   2e-96    Pyrus x bretschneideri [bai li]
gb|ERN07474.1|  hypothetical protein AMTR_s00019p00255470               300   2e-96    Amborella trichopoda
ref|XP_008352808.1|  PREDICTED: elongation factor 1-gamma-like          300   3e-96    
gb|ABK25057.1|  unknown                                                 299   4e-96    Picea sitchensis
ref|XP_010907209.1|  PREDICTED: elongation factor 1-gamma 2-like        299   4e-96    Elaeis guineensis
gb|AHC03515.1|  gamma class glutathione S-transferase                   298   1e-95    Larix kaempferi [karamatsu]
ref|XP_010414808.1|  PREDICTED: probable elongation factor 1-gamma 2    291   1e-95    Camelina sativa [gold-of-pleasure]
gb|KEH32762.1|  translation elongation factor EF1B, gamma chain         297   2e-95    Medicago truncatula
ref|XP_003540135.1|  PREDICTED: elongation factor 1-gamma-like          297   2e-95    
ref|XP_010101278.1|  Elongation factor 1-gamma                          298   2e-95    
gb|ACU24584.1|  unknown                                                 297   3e-95    Glycine max [soybeans]
ref|XP_002325529.1|  hypothetical protein POPTR_0019s10560g             296   5e-95    Populus trichocarpa [western balsam poplar]
ref|XP_012066699.1|  PREDICTED: elongation factor 1-gamma               295   1e-94    Jatropha curcas
ref|NP_001241223.1|  uncharacterized protein LOC100787125               295   2e-94    Glycine max [soybeans]
ref|XP_006392370.1|  hypothetical protein EUTSA_v10023493mg             294   2e-94    Eutrema salsugineum [saltwater cress]
gb|KHN40193.1|  Elongation factor 1-gamma                               295   2e-94    Glycine soja [wild soybean]
ref|NP_001235707.1|  elongation factor 1-gamma                          294   3e-94    
ref|XP_011031541.1|  PREDICTED: elongation factor 1-gamma-like          294   4e-94    Populus euphratica
ref|XP_009388887.1|  PREDICTED: elongation factor 1-gamma 2-like        289   5e-94    
ref|NP_001242737.1|  uncharacterized protein LOC100810452               293   1e-93    
dbj|BAH56923.1|  AT1G57720                                              291   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153909.1|  hypothetical protein PHAVU_003G075200g             291   3e-93    Phaseolus vulgaris [French bean]
ref|XP_008218698.1|  PREDICTED: elongation factor 1-gamma-like          291   4e-93    Prunus mume [ume]
ref|XP_010553691.1|  PREDICTED: probable elongation factor 1-gamma 2    291   4e-93    Tarenaya hassleriana [spider flower]
ref|XP_002892012.1|  hypothetical protein ARALYDRAFT_474857             291   4e-93    
ref|XP_010511351.1|  PREDICTED: probable elongation factor 1-gamma 2    291   6e-93    Camelina sativa [gold-of-pleasure]
ref|NP_176084.1|  elongation factor EF-1 gamma subunit                  290   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AAK59587.1|  putative elongation factor 1B gamma                     290   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300001.1|  PREDICTED: elongation factor 1-gamma-like          289   3e-92    Fragaria vesca subsp. vesca
ref|XP_011470423.1|  PREDICTED: elongation factor 1-gamma-like is...    290   5e-92    Fragaria vesca subsp. vesca
ref|XP_010470318.1|  PREDICTED: probable elongation factor 1-gamma 2    288   6e-92    Camelina sativa [gold-of-pleasure]
ref|XP_006302321.1|  hypothetical protein CARUB_v10020374mg             287   1e-91    Capsella rubella
gb|EPS67955.1|  elongation factor 1 gamma-like protein                  287   2e-91    Genlisea aurea
ref|XP_004485430.1|  PREDICTED: elongation factor 1-gamma-like is...    287   2e-91    Cicer arietinum [garbanzo]
gb|AGC13144.1|  EF1Bgamma class glutathione S-transferase               286   5e-91    Pinus tabuliformis [southern Chinese pine]
ref|NP_001184949.1|  elongation factor EF-1 gamma subunit               280   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308137.1|  PREDICTED: elongation factor 1-gamma-like is...    285   7e-91    Fragaria vesca subsp. vesca
ref|XP_010544111.1|  PREDICTED: probable elongation factor 1-gamma 2    284   2e-90    Tarenaya hassleriana [spider flower]
emb|CDY22629.1|  BnaC08g42630D                                          284   2e-90    Brassica napus [oilseed rape]
ref|XP_009118302.1|  PREDICTED: probable elongation factor 1-gamma 1    284   3e-90    Brassica rapa
emb|CDY20681.1|  BnaC08g13770D                                          286   1e-89    Brassica napus [oilseed rape]
gb|EMT01475.1|  Elongation factor 1-gamma 2                             287   3e-89    
ref|XP_002889762.1|  hypothetical protein ARALYDRAFT_471063             281   4e-89    
emb|CDY31074.1|  BnaA08g26240D                                          280   1e-88    Brassica napus [oilseed rape]
ref|XP_010490215.1|  PREDICTED: probable elongation factor 1-gamma 1    280   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_007148576.1|  hypothetical protein PHAVU_006G220100g             280   1e-88    Phaseolus vulgaris [French bean]
ref|XP_010458260.1|  PREDICTED: probable elongation factor 1-gamma 1    279   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009110814.1|  PREDICTED: probable elongation factor 1-gamma 1    279   2e-88    Brassica rapa
ref|NP_563848.1|  elongation factor EF-1 gamma subunit                  279   2e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CDY06365.1|  BnaA09g48380D                                          278   3e-88    
ref|XP_008452241.1|  PREDICTED: elongation factor 1-gamma-like          278   6e-88    Cucumis melo [Oriental melon]
ref|XP_003592901.1|  Elongation factor 1-gamma                          278   7e-88    Medicago truncatula
gb|KEH34076.1|  translation elongation factor EF1B, gamma chain         278   7e-88    Medicago truncatula
ref|XP_006417552.1|  hypothetical protein EUTSA_v10007759mg             277   9e-88    Eutrema salsugineum [saltwater cress]
ref|XP_011650572.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    275   3e-87    Cucumis sativus [cucumbers]
gb|AFK34308.1|  unknown                                                 276   3e-87    Medicago truncatula
ref|XP_003592902.1|  Elongation factor 1-gamma                          276   3e-87    
gb|KGN56265.1|  hypothetical protein Csa_3G110620                       275   3e-87    Cucumis sativus [cucumbers]
ref|XP_010475804.1|  PREDICTED: probable elongation factor 1-gamm...    276   4e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010475805.1|  PREDICTED: probable elongation factor 1-gamm...    276   6e-87    
emb|CBI39244.3|  unnamed protein product                                266   1e-86    Vitis vinifera
gb|ACJ85171.1|  unknown                                                 273   6e-86    Medicago truncatula
ref|XP_006307657.1|  hypothetical protein CARUB_v10009284mg             271   2e-85    Capsella rubella
gb|KDO42760.1|  hypothetical protein CISIN_1g014592mg                   269   5e-85    Citrus sinensis [apfelsine]
ref|XP_004133719.2|  PREDICTED: elongation factor 1-gamma               268   2e-84    Cucumis sativus [cucumbers]
ref|XP_008365322.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    267   1e-83    
emb|CDX93494.1|  BnaA06g05540D                                          265   6e-83    
ref|XP_009148264.1|  PREDICTED: probable elongation factor 1-gamma 1    265   7e-83    Brassica rapa
ref|XP_001758671.1|  predicted protein                                  265   1e-82    
emb|CBI29689.3|  unnamed protein product                                255   2e-82    Vitis vinifera
emb|CDY50887.1|  BnaCnng19790D                                          262   9e-82    Brassica napus [oilseed rape]
ref|XP_008789740.1|  PREDICTED: elongation factor 1-gamma 1 isofo...    259   4e-81    
ref|XP_008452240.1|  PREDICTED: elongation factor 1-gamma-like          256   1e-79    Cucumis melo [Oriental melon]
gb|KEH32761.1|  translation elongation factor EF1B, gamma chain         255   2e-79    Medicago truncatula
gb|AFW76480.1|  elongation factor gamma1                                254   3e-79    
ref|XP_001771013.1|  predicted protein                                  255   6e-79    
gb|AFW87006.1|  hypothetical protein ZEAMMB73_710904                    251   4e-78    
ref|XP_002984514.1|  hypothetical protein SELMODRAFT_156635             237   6e-72    Selaginella moellendorffii
ref|XP_002973046.1|  hypothetical protein SELMODRAFT_98733              234   6e-71    
ref|XP_001774148.1|  predicted protein                                  207   2e-60    
gb|AFW76477.1|  elongation factor gamma1                                196   1e-57    
ref|XP_005645852.1|  glutathione S-transferase                          192   2e-54    Coccomyxa subellipsoidea C-169
ref|XP_008867564.1|  hypothetical protein H310_04829                    182   6e-51    Aphanomyces invadans
ref|XP_008605170.1|  hypothetical protein SDRG_01423                    181   1e-50    Saprolegnia diclina VS20
gb|AAL87298.1|  unknown protein                                         179   2e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392372.1|  hypothetical protein EUTSA_v10023493mg             177   7e-50    
ref|XP_009825362.1|  hypothetical protein H257_03107                    179   1e-49    Aphanomyces astaci
gb|ABB02642.1|  unknown                                                 169   3e-49    Solanum tuberosum [potatoes]
gb|ETO78833.1|  hypothetical protein F444_06337                         155   5e-43    Phytophthora parasitica P1976
ref|XP_009040775.1|  hypothetical protein AURANDRAFT_70385              160   8e-43    Aureococcus anophagefferens
dbj|GAN05559.1|  hypothetical protein MAM1_0095c05030                   156   1e-42    Mucor ambiguus
ref|XP_009519315.1|  hypothetical protein PHYSODRAFT_284839             159   2e-42    Phytophthora sojae
gb|EFA79702.1|  glutathione S-transferase domain-containing protein     159   2e-42    Heterostelium album PN500
ref|XP_008891716.1|  hypothetical protein PPTG_02396                    154   2e-42    Phytophthora parasitica INRA-310
ref|XP_004353907.1|  glutathione S-transferase domain-containing ...    159   2e-42    Cavenderia fasciculata
gb|KDO40981.1|  hypothetical protein CISIN_1g021153mg                   157   2e-42    Citrus sinensis [apfelsine]
gb|KDO34814.1|  hypothetical protein SPRG_00875                         158   4e-42    Saprolegnia parasitica CBS 223.65
ref|XP_009519320.1|  hypothetical protein PHYSODRAFT_359164             157   2e-41    Phytophthora sojae
ref|XP_009041108.1|  hypothetical protein AURANDRAFT_39051              157   2e-41    Aureococcus anophagefferens
gb|ETK89985.1|  hypothetical protein L915_06155                         150   4e-41    Phytophthora parasitica
emb|CBJ27519.1|  eukaryotic elongation factor-1 B gamma                 155   5e-41    Ectocarpus siliculosus
emb|CCA15330.1|  calciumdependent protein 1 putative                    155   7e-41    Albugo laibachii Nc14
ref|XP_002901767.1|  elongation factor 1-gamma, putative                155   7e-41    Phytophthora infestans T30-4
gb|KHN39680.1|  Elongation factor 1-gamma                               153   7e-41    Glycine soja [wild soybean]
gb|ETL96579.1|  hypothetical protein L917_05965                         154   7e-41    Phytophthora parasitica
gb|ETM49723.1|  hypothetical protein L914_06088                         150   8e-41    Phytophthora parasitica
gb|ETP19871.1|  hypothetical protein F441_06281                         154   2e-40    Phytophthora parasitica CJ01A1
gb|ETK89994.1|  hypothetical protein L915_06152                         154   2e-40    Phytophthora parasitica
emb|CBK21757.2|  unnamed protein product                                152   7e-40    Blastocystis hominis
gb|ETL96570.1|  hypothetical protein L917_05968                         149   9e-40    Phytophthora parasitica
emb|CCI44608.1|  unnamed protein product                                152   1e-39    Albugo candida
ref|XP_004341586.1|  elongation factor 1-gamma family protein           152   1e-39    Acanthamoeba castellanii str. Neff
gb|EWM21126.1|  elongation factor 1                                     152   1e-39    Nannochloropsis gaditana
dbj|GAM21220.1|  hypothetical protein SAMD00019534_043950               150   4e-39    Acytostelium subglobosum LB1
ref|XP_005760139.1|  hypothetical protein EMIHUDRAFT_438506             144   6e-39    Emiliania huxleyi CCMP1516
gb|AFW71312.1|  hypothetical protein ZEAMMB73_547198                    147   7e-39    
gb|EPB85278.1|  hypothetical protein HMPREF1544_07959                   149   8e-39    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008891718.1|  hypothetical protein PPTG_02398                    149   2e-38    Phytophthora parasitica INRA-310
gb|ADV40141.1|  elongation factor-1 gamma                               146   3e-38    Latrodectus hesperus [black widow]
emb|CDS12960.1|  hypothetical protein LRAMOSA05144                      147   7e-38    Lichtheimia ramosa
sp|P12261.3|EF1G_ARTSA  RecName: Full=Elongation factor 1-gamma; ...    147   9e-38    Artemia salina
ref|NP_001083003.1|  uncharacterized protein LOC100037382               147   1e-37    Danio rerio [leopard danio]
gb|ETP47818.1|  hypothetical protein F442_06319                         140   2e-37    Phytophthora parasitica P10297
emb|CDH55788.1|  elongation factor 1-gamma                              145   3e-37    Lichtheimia corymbifera JMRC:FSU:9682
gb|ETI50110.1|  hypothetical protein F443_06278                         139   3e-37    Phytophthora parasitica P1569
dbj|BAB29238.3|  unnamed protein product                                140   4e-37    Mus musculus [mouse]
gb|KFH74042.1|  hypothetical protein MVEG_01255                         144   6e-37    Mortierella verticillata NRRL 6337
dbj|BAB27948.1|  unnamed protein product                                140   8e-37    Mus musculus [mouse]
emb|CEI89465.1|  hypothetical protein RMCBS344292_03820                 144   1e-36    Rhizopus microsporus
emb|CEI97373.1|  hypothetical protein RMCBS344292_11508                 143   1e-36    Rhizopus microsporus
emb|CEG74026.1|  hypothetical protein RMATCC62417_09299                 143   1e-36    Rhizopus microsporus
emb|CDH55787.1|  elongation factor 1-gamma                              144   2e-36    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005988901.1|  PREDICTED: elongation factor 1-gamma-like          144   2e-36    
ref|XP_007056947.1|  PREDICTED: elongation factor 1-gamma               143   2e-36    Chelonia mydas [green seaturtle]
gb|ELK23445.1|  Elongation factor 1-gamma                               143   2e-36    Myotis davidii
gb|KDR22664.1|  Elongation factor 1-gamma                               143   2e-36    Zootermopsis nevadensis
ref|XP_003229963.2|  PREDICTED: elongation factor 1-gamma               143   3e-36    Anolis carolinensis [Carolina anole]
ref|XP_007439957.1|  PREDICTED: elongation factor 1-gamma-like is...    143   3e-36    Python bivittatus
ref|XP_007943079.1|  PREDICTED: elongation factor 1-gamma               143   3e-36    Orycteropus afer afer
gb|AJD25298.1|  elongation factor-1 gamma-like protein                  139   5e-36    Plectreurys tristis
ref|XP_006772813.1|  PREDICTED: elongation factor 1-gamma               142   7e-36    Myotis davidii
dbj|BAE88257.1|  unnamed protein product                                138   8e-36    Macaca fascicularis [crab eating macaque]
ref|XP_005857534.1|  PREDICTED: elongation factor 1-gamma               142   9e-36    Myotis brandtii
ref|XP_011428586.1|  PREDICTED: elongation factor 1-gamma-like          139   9e-36    
ref|XP_005707114.1|  elongation factor EF-1 gamma subunit               145   9e-36    Galdieria sulphuraria
ref|XP_006109995.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    141   1e-35    Myotis lucifugus
gb|EKC22737.1|  Elongation factor 1-gamma                               137   1e-35    Crassostrea gigas
ref|XP_003508788.1|  PREDICTED: elongation factor 1-gamma               141   1e-35    Cricetulus griseus [Chinese hamsters]
ref|XP_008172336.1|  PREDICTED: elongation factor 1-gamma               141   1e-35    Chrysemys picta bellii
gb|EPQ02217.1|  Elongation factor 1-gamma                               141   2e-35    Myotis brandtii
gb|ETI50094.1|  hypothetical protein F443_06281                         135   2e-35    Phytophthora parasitica P1569
gb|EMP38506.1|  Elongation factor 1-gamma                               142   2e-35    Chelonia mydas [green seaturtle]
ref|NP_080283.3|  elongation factor 1-gamma                             140   2e-35    Mus musculus [mouse]
ref|XP_006039986.1|  PREDICTED: elongation factor 1-gamma-like          137   3e-35    
gb|ERE79389.1|  elongation factor 1-gamma                               140   3e-35    Cricetulus griseus [Chinese hamsters]
ref|XP_006841161.1|  PREDICTED: elongation factor 1-gamma 2             132   3e-35    Amborella trichopoda
ref|XP_001119776.2|  PREDICTED: elongation factor 1-gamma               139   3e-35    
ref|XP_006113632.1|  PREDICTED: elongation factor 1-gamma               140   3e-35    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008158973.1|  PREDICTED: elongation factor 1-gamma               140   3e-35    Eptesicus fuscus
ref|NP_001004223.1|  elongation factor 1-gamma                          140   4e-35    Rattus norvegicus [brown rat]
ref|XP_010954720.1|  PREDICTED: elongation factor 1-gamma               140   4e-35    Camelus bactrianus [camel]
gb|AAL23895.1|  elongation factor-like protein                          140   4e-35    Mus musculus [mouse]
ref|XP_005351981.1|  PREDICTED: elongation factor 1-gamma               140   4e-35    Microtus ochrogaster [prairie voles]
gb|EPB91935.1|  hypothetical protein HMPREF1544_01229                   139   5e-35    Mucor circinelloides f. circinelloides 1006PhL
gb|ABG88952.1|  elongation factor-1 gamma                               139   7e-35    Hypochilus thorelli
ref|XP_006271018.1|  PREDICTED: elongation factor 1-gamma-like          139   7e-35    
emb|CEP19706.1|  hypothetical protein                                   139   7e-35    Parasitella parasitica
ref|XP_004621561.1|  PREDICTED: elongation factor 1-gamma               139   7e-35    Sorex araneus [Eurasian shrew]
ref|XP_006995262.1|  PREDICTED: elongation factor 1-gamma               139   8e-35    Peromyscus maniculatus bairdii
ref|XP_004264257.1|  PREDICTED: elongation factor 1-gamma               139   9e-35    Orcinus orca [Orca]
gb|ETE60028.1|  Elongation factor 1-gamma                               139   9e-35    Ophiophagus hannah
ref|XP_006181822.1|  PREDICTED: elongation factor 1-gamma               139   1e-34    Camelus ferus
ref|NP_001095173.1|  elongation factor 1-gamma                          139   1e-34    Oryctolagus cuniculus [domestic rabbit]
ref|XP_007526399.1|  PREDICTED: elongation factor 1-gamma               139   1e-34    Erinaceus europaeus [common hedgehog]
ref|XP_006033236.1|  PREDICTED: elongation factor 1-gamma isoform X1    139   1e-34    
ref|XP_007462218.1|  PREDICTED: elongation factor 1-gamma               139   1e-34    Lipotes vexillifer [baiji]
gb|ENN80225.1|  hypothetical protein YQE_03344                          138   1e-34    Dendroctonus ponderosae
dbj|BAE93064.1|  eukaryotic elongation factor 1 gamma                   138   1e-34    
ref|XP_006214925.1|  PREDICTED: elongation factor 1-gamma               138   1e-34    
gb|AEE62776.1|  unknown                                                 138   1e-34    
ref|XP_853577.1|  PREDICTED: elongation factor 1-gamma isoform 1        138   2e-34    
ref|XP_004682779.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_006875070.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
gb|KJB47885.1|  hypothetical protein B456_008G046300                    136   2e-34    
ref|XP_007110004.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_003920279.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_002925414.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_002755470.1|  PREDICTED: elongation factor 1-gamma isoform X1    138   2e-34    
ref|XP_010383201.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_007993749.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
emb|CDS05969.1|  hypothetical protein LRAMOSA08497                      137   2e-34    
ref|XP_003419695.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_008705722.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|NP_001075254.1|  elongation factor 1-gamma                          138   2e-34    
ref|NP_001182509.1|  eukaryotic translation elongation factor 1 g...    138   2e-34    
sp|Q29387.2|EF1G_PIG  RecName: Full=Elongation factor 1-gamma; Sh...    138   2e-34    
emb|CDH60277.1|  elongation factor 1 gamma domain-containingprotein     137   2e-34    
ref|XP_010852324.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_005331561.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_005660855.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_008571701.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_004656596.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
gb|ABF57407.1|  eukaryotic translation elongation factor 1 gamma        138   2e-34    
dbj|GAN03435.1|  elongation factor 1-gamma family protein               137   2e-34    
ref|XP_005414851.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|XP_006911275.1|  PREDICTED: elongation factor 1-gamma               138   2e-34    
ref|NP_001035577.1|  elongation factor 1-gamma                          137   2e-34    
ref|XP_006043256.1|  PREDICTED: elongation factor 1-gamma               137   2e-34    
gb|EFB28168.1|  hypothetical protein PANDA_014932                       137   3e-34    
ref|XP_005699833.1|  PREDICTED: elongation factor 1-gamma               137   3e-34    
ref|XP_005904892.1|  PREDICTED: elongation factor 1-gamma               137   3e-34    
gb|ACJ12080.1|  translation elongation factor EF-1 gamma                137   3e-34    
ref|XP_001505899.2|  PREDICTED: elongation factor 1-gamma               137   3e-34    
ref|XP_008060650.1|  PREDICTED: elongation factor 1-gamma isoform X1    137   3e-34    
ref|XP_008530379.1|  PREDICTED: elongation factor 1-gamma               138   3e-34    
gb|ELR49692.1|  Elongation factor 1-gamma                               137   3e-34    
ref|XP_004413812.1|  PREDICTED: elongation factor 1-gamma               137   3e-34    
ref|XP_004383908.1|  PREDICTED: elongation factor 1-gamma               137   4e-34    
ref|XP_011848755.1|  PREDICTED: elongation factor 1-gamma isoform X1    137   4e-34    
ref|XP_005966833.1|  PREDICTED: elongation factor 1-gamma               137   4e-34    
ref|XP_010631294.1|  PREDICTED: elongation factor 1-gamma isoform X1    137   5e-34    
ref|XP_004437533.1|  PREDICTED: elongation factor 1-gamma               137   5e-34    
ref|XP_011957712.1|  PREDICTED: elongation factor 1-gamma isoform X1    137   5e-34    
ref|XP_010631295.1|  PREDICTED: elongation factor 1-gamma isoform X2    137   5e-34    
ref|XP_001366000.1|  PREDICTED: elongation factor 1-gamma               137   5e-34    
ref|XP_006566786.1|  PREDICTED: elongation factor 1-gamma-like          136   6e-34    
ref|XP_008557385.1|  PREDICTED: elongation factor 1-gamma               136   6e-34    
ref|XP_004883303.1|  PREDICTED: elongation factor 1-gamma               137   6e-34    
gb|EHB02083.1|  Elongation factor 1-gamma                               137   6e-34    
ref|XP_004770359.1|  PREDICTED: elongation factor 1-gamma isoform X1    137   7e-34    
ref|XP_006156649.1|  PREDICTED: elongation factor 1-gamma               137   7e-34    
ref|XP_004770360.1|  PREDICTED: elongation factor 1-gamma isoform X2    137   7e-34    
gb|ENN82421.1|  hypothetical protein YQE_01203                          136   7e-34    
ref|XP_004646771.1|  PREDICTED: elongation factor 1-gamma               136   9e-34    
gb|EFZ22579.1|  hypothetical protein SINV_13881                         136   9e-34    
ref|XP_004644383.1|  PREDICTED: elongation factor 1-gamma-like          136   9e-34    
ref|XP_011334294.1|  PREDICTED: elongation factor 1-gamma               136   9e-34    
ref|XP_003467975.1|  PREDICTED: elongation factor 1-gamma               136   9e-34    
ref|XP_003292098.1|  hypothetical protein DICPUDRAFT_156785             135   1e-33    
ref|XP_011162880.1|  PREDICTED: elongation factor 1-gamma               136   1e-33    
ref|XP_004065457.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    135   1e-33    
ref|NP_001395.1|  elongation factor 1-gamma                             135   1e-33    
ref|XP_012154504.1|  PREDICTED: elongation factor 1-gamma               135   1e-33    
ref|XP_003828537.1|  PREDICTED: elongation factor 1-gamma               135   1e-33    
ref|NP_001289353.1|  elongation factor 1-gamma                          135   1e-33    
gb|AAP36704.1|  Homo sapiens eukaryotic translation elongation fa...    135   1e-33    
gb|ELW52035.1|  Elongation factor 1-gamma                               139   2e-33    
ref|XP_010339291.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    135   2e-33    
ref|XP_008835762.1|  PREDICTED: elongation factor 1-gamma isoform X1    135   2e-33    
ref|XP_011152520.1|  PREDICTED: elongation factor 1-gamma               135   2e-33    
ref|NP_001079766.1|  elongation factor 1-gamma-A                        135   2e-33    
sp|P26642.1|EF1GA_XENLA  RecName: Full=Elongation factor 1-gamma-...    135   2e-33    
gb|AAH07949.2|  EEF1G protein                                           135   2e-33    
ref|XP_004449309.1|  PREDICTED: elongation factor 1-gamma               135   2e-33    
ref|XP_003487839.1|  PREDICTED: hypothetical protein LOC100743133       139   2e-33    
gb|AAB29957.1|  elongation factor 1 gamma                               135   2e-33    
ref|XP_003399098.1|  PREDICTED: hypothetical protein LOC100647544       139   2e-33    
ref|XP_011633347.1|  PREDICTED: elongation factor 1-gamma               135   2e-33    
ref|NP_001133235.1|  elongation factor 1 gamma                          133   2e-33    
dbj|BAG61974.1|  unnamed protein product                                135   3e-33    
ref|XP_002178302.1|  predicted protein                                  134   3e-33    
ref|XP_007174472.1|  PREDICTED: elongation factor 1-gamma               134   3e-33    
ref|XP_010730447.1|  PREDICTED: elongation factor 1-gamma               134   4e-33    
emb|CDY04368.1|  BnaC04g18250D                                          131   4e-33    
ref|XP_002432920.1|  elongation factor 1-gamma, putative                134   4e-33    
ref|XP_011692485.1|  PREDICTED: elongation factor 1-gamma               134   4e-33    
ref|XP_011264946.1|  PREDICTED: elongation factor 1-gamma               134   5e-33    
ref|XP_004596833.1|  PREDICTED: elongation factor 1-gamma               134   5e-33    
ref|XP_011739970.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    134   5e-33    
gb|EFN62393.1|  Elongation factor 1-gamma                               138   6e-33    
gb|AAH13918.1|  Eukaryotic translation elongation factor 1 gamma        134   7e-33    
gb|ABS57446.1|  elongation factor 1 gamma                               129   7e-33    
ref|XP_009244529.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    133   7e-33    
ref|XP_012055686.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    133   8e-33    
ref|XP_009055805.1|  hypothetical protein LOTGIDRAFT_189800             133   1e-32    
gb|KFO33384.1|  Elongation factor 1-gamma                               133   1e-32    
ref|XP_008210112.1|  PREDICTED: elongation factor 1-gamma               132   2e-32    
ref|XP_007565951.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    132   2e-32    
ref|XP_010900657.1|  PREDICTED: elongation factor 1-gamma               132   2e-32    
gb|ACM08681.1|  Elongation factor 1-gamma                               132   2e-32    
gb|ACN10123.1|  Elongation factor 1-gamma                               132   2e-32    
ref|XP_011867803.1|  PREDICTED: elongation factor 1-gamma               132   2e-32    
ref|XP_003290965.1|  hypothetical protein DICPUDRAFT_49566              132   2e-32    
gb|ABG88953.1|  elongation factor-1 gamma                               132   3e-32    
ref|XP_007246522.1|  PREDICTED: elongation factor 1-gamma               132   3e-32    
gb|ABG88954.1|  elongation factor-1 gamma                               132   3e-32    
ref|XP_011068058.1|  PREDICTED: elongation factor 1-gamma               132   3e-32    
ref|XP_005534461.1|  PREDICTED: elongation factor 1-gamma-like          130   3e-32    
ref|XP_003444636.1|  PREDICTED: elongation factor 1-gamma-like          132   4e-32    
gb|ABG88957.1|  elongation factor-1 gamma                               131   4e-32    
ref|XP_006781412.1|  PREDICTED: elongation factor 1-gamma-like is...    131   4e-32    
gb|AAH80966.1|  MGC76278 protein                                        131   4e-32    
ref|XP_005913461.1|  PREDICTED: elongation factor 1-gamma-like          131   4e-32    
ref|XP_001809758.1|  PREDICTED: elongation factor 1-gamma               131   4e-32    
ref|XP_005723183.1|  PREDICTED: elongation factor 1-gamma-like          131   5e-32    
ref|XP_006781411.1|  PREDICTED: elongation factor 1-gamma-like is...    131   5e-32    
ref|XP_011312957.1|  PREDICTED: elongation factor 1-gamma               131   6e-32    
ref|XP_008418577.1|  PREDICTED: elongation factor 1-gamma               131   7e-32    
ref|XP_008325378.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    131   7e-32    
ref|XP_004545571.1|  PREDICTED: elongation factor 1-gamma-like          131   7e-32    
ref|XP_002610271.1|  hypothetical protein BRAFLDRAFT_115434             130   7e-32    
gb|ACM09182.1|  Elongation factor 1-gamma                               130   8e-32    
ref|NP_001135112.1|  Elongation factor 1-gamma                          130   8e-32    
gb|AAL78751.1|  translation elongation factor-1 gamma                   130   8e-32    
ref|XP_003274134.1|  PREDICTED: elongation factor 1-gamma isoform 1     130   8e-32    
gb|ACH85278.1|  eukaryotic translation elongation factor 1 gamma        130   8e-32    
sp|Q90YC0.1|EF1G_CARAU  RecName: Full=Elongation factor 1-gamma; ...    130   9e-32    
ref|XP_005809860.1|  PREDICTED: elongation factor 1-gamma-like          130   9e-32    
ref|XP_003274135.1|  PREDICTED: elongation factor 1-gamma isoform 2     130   1e-31    
ref|XP_009009109.1|  hypothetical protein HELRODRAFT_105304             130   1e-31    
ref|XP_011505224.1|  PREDICTED: elongation factor 1-gamma               130   1e-31    
gb|AAS49527.1|  eukaryotic translation elongation factor 1 gamma        129   1e-31    
ref|XP_008281826.1|  PREDICTED: elongation factor 1-gamma               130   2e-31    
sp|Q6PE25.1|EF1G_DANRE  RecName: Full=Elongation factor 1-gamma; ...    129   2e-31    
dbj|BAN20579.1|  elongation factor 1 gamma                              129   2e-31    
gb|AAH66518.1|  Eef1g protein                                           129   2e-31    
gb|ERM95713.1|  hypothetical protein AMTR_s00023p00230860               121   3e-31    
gb|ACO09775.1|  Elongation factor 1-gamma                               129   3e-31    
gb|EGW02095.1|  Elongation factor 1-gamma                               128   3e-31    
ref|NP_775370.1|  elongation factor 1-gamma                             129   4e-31    
gb|AJN91131.1|  elongation factor 1-gamma                               129   4e-31    
gb|EFX73418.1|  hypothetical protein DAPPUDRAFT_200523                  129   4e-31    
ref|XP_003970321.1|  PREDICTED: elongation factor 1-gamma               128   6e-31    
ref|NP_001131533.1|  uncharacterized protein LOC100192872               126   7e-31    
ref|NP_001185679.1|  eukaryotic translation elongation factor 1 g...    128   7e-31    
ref|XP_005497725.1|  PREDICTED: elongation factor 1-gamma-like          128   8e-31    
ref|XP_001733005.1|  glutathione S-transferase domain-containing ...    127   9e-31    
ref|NP_001020382.1|  translation elongation factor 1B gamma subunit     127   9e-31    
ref|XP_010333151.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    127   2e-30    
ref|XP_002754632.1|  PREDICTED: elongation factor 1-gamma-like          127   2e-30    
ref|XP_010588872.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    127   2e-30    
gb|ELT98041.1|  hypothetical protein CAPTEDRAFT_173297                  127   2e-30    
emb|CCQ18584.1|  Translation elongation factor EF-1 gamma               126   2e-30    
gb|KDO40986.1|  hypothetical protein CISIN_1g021153mg                   122   2e-30    
dbj|BAC56575.1|  similar to elongation factor-1-gamma                   121   3e-30    
ref|XP_004073276.1|  PREDICTED: elongation factor 1-gamma               126   3e-30    
gb|AGH70142.1|  eukaryotic translation elongation factor 1 gamma        122   3e-30    
ref|XP_006680023.1|  hypothetical protein BATDEDRAFT_37118              126   3e-30    
gb|AAS49528.1|  eukaryotic translation elongation factor 1 gamma        125   4e-30    
gb|ERE84099.1|  Glutathione S-transferase containing protein            129   4e-30    
gb|ERE84098.1|  Glutathione S-transferase containing protein            129   6e-30    
gb|ETM49731.1|  hypothetical protein L914_06086                         119   6e-30    
gb|KFH71059.1|  hypothetical protein MVEG_03905                         125   7e-30    
gb|ABG88951.1|  elongation factor-1 gamma                               125   9e-30    
gb|ABG88919.1|  elongation factor-1 gamma                               123   1e-29    
gb|AAH84224.1|  Unknown (protein for MGC:80886)                         124   1e-29    
ref|XP_005089146.1|  PREDICTED: elongation factor 1-gamma-like          124   1e-29    
ref|XP_006730446.1|  PREDICTED: elongation factor 1-gamma               124   1e-29    
gb|AAI70047.1|  LOC397861 protein                                       124   2e-29    
gb|AAU89473.1|  putative translation elongation factor 1 gamma          122   3e-29    
gb|ABG88916.1|  elongation factor-1 gamma                               122   4e-29    
dbj|BAC56425.1|  similar to elongation factor-1-gamma                   117   6e-29    
ref|NP_001171816.1|  elongation factor 1-gamma                          122   9e-29    
ref|XP_001661570.1|  AAEL011288-PA                                      122   9e-29    
gb|ABF18271.1|  elongation factor 1-gamma                               122   9e-29    
ref|NP_001081481.1|  elongation factor 1-gamma-B                        122   1e-28    
ref|XP_001640531.1|  predicted protein                                  122   1e-28    
ref|NP_001036852.1|  elongation factor 1 gamma                          122   1e-28    
gb|AAM93480.1|  eukaryotic translation elongation factor 1 gamma        121   1e-28    
gb|ABG88915.1|  elongation factor-1 gamma                               121   2e-28    
gb|EAW74026.1|  eukaryotic translation elongation factor 1 gamma,...    120   2e-28    
dbj|BAM19052.1|  elongation factor 1 gamma                              120   3e-28    
gb|EPY83396.1|  speckle targeted PIP5K1A-regulated poly(A) polyme...    123   4e-28    
gb|EHJ69132.1|  elongation factor 1 gamma                               120   5e-28    
gb|KFB39640.1|  AGAP000883-PA-like protein                              120   5e-28    
ref|XP_001865800.1|  elongation factor 1-gamma                          120   6e-28    
ref|XP_011903879.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    119   6e-28    
emb|CAF94682.1|  unnamed protein product                                115   6e-28    
gb|ABG88914.1|  elongation factor-1 gamma                               119   6e-28    
ref|XP_005514198.1|  PREDICTED: elongation factor 1-gamma-like          118   6e-28    
gb|AAM93482.1|  eukaryotic translation elongation factor 1 gamma        119   8e-28    
gb|KDN39258.1|  eEF1-gamma domain-containing protein                    119   8e-28    
gb|AAI54939.1|  MGC76278 protein                                        119   9e-28    
ref|XP_001996097.1|  GH14004                                            119   1e-27    
gb|ABG88958.1|  elongation factor-1 gamma                               119   1e-27    
gb|ETN60121.1|  elongation factor 1-gamma                               119   1e-27    
ref|XP_002000755.1|  GI22348                                            118   2e-27    
dbj|BAM17758.1|  elongation factor 1 gamma                              118   2e-27    
gb|AAM93483.1|  eukaryotic translation elongation factor 1 gamma        117   2e-27    
ref|XP_316859.4|  AGAP000883-PA                                         118   2e-27    
gb|ACO13185.1|  Elongation factor 1-gamma                               117   3e-27    
ref|XP_002131081.1|  PREDICTED: elongation factor 1-gamma-A-like        117   3e-27    
ref|XP_002901771.1|  elongation factor 1-gamma, putative                117   4e-27    
gb|AAU84935.1|  putative translation elongation factor-1 gamma          117   4e-27    
ref|XP_003663778.1|  glutathione S-transferase-like protein             114   5e-27    
ref|XP_003385089.1|  PREDICTED: elongation factor 1-gamma-like          116   9e-27    
gb|ABG88956.1|  elongation factor-1 gamma                               116   1e-26    
ref|XP_682573.1|  hypothetical protein AN9304.2                         113   1e-26    
ref|XP_005536940.1|  eukaryotic translation elongation factor 1 g...    116   1e-26    
ref|XP_011179201.1|  PREDICTED: elongation factor 1-gamma               115   1e-26    
ref|XP_008064282.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    115   2e-26    
ref|XP_011210287.1|  PREDICTED: elongation factor 1-gamma               115   2e-26    
gb|AFM92633.1|  elongation factor-1 gamma                               112   2e-26    
ref|XP_009497237.1|  hypothetical protein H696_05112                    113   2e-26    
gb|EXX52333.1|  Tef4p                                                   115   2e-26    
emb|CDR15964.1|  elongation factor 1-gamma, putative                    115   3e-26    
gb|ESA05922.1|  hypothetical protein GLOINDRAFT_349960                  114   3e-26    
gb|AAG33072.1|  translation elongation factor 1 gamma subunit           114   4e-26    



>ref|XP_011074970.1| PREDICTED: elongation factor 1-gamma-like [Sesamum indicum]
Length=420

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFKALI AEY GVKVELTK+F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHASSTNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++KPDNPL+GSSLI+YGHIEQW DF+ATEID N A+WLYPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKPDNPLYGSSLIDYGHIEQWMDFSATEIDINIARWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEA IA+LKR+L ALNTHLASNTYLVGH VTLADIVM CNLSIGFK IM KS T
Sbjct  121  LYLPPAEEAGIAALKRALEALNTHLASNTYLVGHGVTLADIVMTCNLSIGFKAIMIKSLT  180

Query  655  KEFPHVERYFWTL  693
             +FPHVERYFWT+
Sbjct  181  SQFPHVERYFWTM  193



>gb|AGJ83736.1| elongation factor 1-gamma-like protein, partial [Caragana korshinskii]
Length=221

 Score =   327 bits (837),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M+LVLH+ N NKNAFKALI AEY GV+VEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MSLVLHAGNTNKNAFKALIAAEYSGVQVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSSLIEY HIEQW DFA+ EIDAN  +W  PR GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYAHIEQWIDFASMEIDANIMRWYIPRAGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLADI+M CNL +GF  +MTKSFT
Sbjct  121  VYLPPAEEAAISALKRALDALNTHLASNTYLVGHSVTLADIIMTCNLLLGFNRVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             E PHVERY+WT+
Sbjct  181  SESPHVERYYWTM  193



>ref|XP_004240589.1| PREDICTED: elongation factor 1-gamma 2-like [Solanum lycopersicum]
Length=413

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LHS + NKNA KALI AEY GVKV+L K+FQMGVSNKTPEFL+MNPIGKVPVL+TP
Sbjct  1    MALILHSTDNNKNASKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K KP+NPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKTKPNNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y+  AEE A+A+LKR+L ALNTHLASNTYLVGH +TLADI+M+CNLSIGF+ I+TKSFT
Sbjct  121  VYISQAEEGAVAALKRALGALNTHLASNTYLVGHFITLADIIMVCNLSIGFRMILTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|NP_001046318.1| Os02g0220600 [Oryza sativa Japonica Group]
 sp|Q9ZRI7.1|EF1G1_ORYSJ RecName: Full=Elongation factor 1-gamma 1; Short=EF-1-gamma 1; 
AltName: Full=eEF-1B gamma 1 [Oryza sativa Japonica Group]
 dbj|BAA34206.1| elongation factor 1B gamma [Oryza sativa]
 dbj|BAD17615.1| Elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08232.1| Os02g0220600 [Oryza sativa Japonica Group]
Length=418

 Score =   329 bits (844),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFKALI AEY GVKVEL KNFQMGVSNKTPE+LKMNPIGKVP+LETP
Sbjct  1    MALVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL+PRLGF 
Sbjct  61   DGPVFESNAIARYVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWLFPRLGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLADIVM CNL +GF  IMTK+FT
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKNFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma [Vitis vinifera]
Length=424

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ N NKNAFKALI AEY GVKVEL KNF+MGVSNK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELVKNFEMGVSNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GS+LIEY HIEQW DF + EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSTLIEYAHIEQWIDFGSLEIDANILRWFIPRIGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLADI+M CNL +GF  +MTKSFT
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHSVTLADIIMTCNLVMGFSRVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_007041182.1| Elongation factor 1-gamma 3 isoform 2 [Theobroma cacao]
 gb|EOX97013.1| Elongation factor 1-gamma 3 isoform 2 [Theobroma cacao]
Length=309

 Score =   325 bits (833),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA KALI A+YC V+V+L +NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            ++LP AEE AIASLKR+L ALNTHLASNTYLVGHSV+LADIVM CNL +GF  IMTKSFT
Sbjct  121  VHLPLAEEHAIASLKRALDALNTHLASNTYLVGHSVSLADIVMTCNLYLGFSQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|ACA50518.1| elongation factor 1-gamma [Oryza sativa Japonica Group]
Length=414

 Score =   328 bits (842),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFKALI AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLADIVM CNL +GF  IMTKSFT
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|NP_001046317.1| Os02g0220500 [Oryza sativa Japonica Group]
 dbj|BAD17614.1| putative elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08231.1| Os02g0220500 [Oryza sativa Japonica Group]
 gb|EEC72756.1| hypothetical protein OsI_06401 [Oryza sativa Indica Group]
 gb|EEE56571.1| hypothetical protein OsJ_05922 [Oryza sativa Japonica Group]
Length=414

 Score =   328 bits (842),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFKALI AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLADIVM CNL +GF  IMTKSFT
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>sp|Q6YW46.2|EF1G2_ORYSJ RecName: Full=Elongation factor 1-gamma 2; Short=EF-1-gamma 2; 
AltName: Full=eEF-1B gamma 2 [Oryza sativa Japonica Group]
Length=418

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFKALI AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLADIVM CNL +GF  IMTKSFT
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_011099002.1| PREDICTED: elongation factor 1-gamma 2-like [Sesamum indicum]
Length=391

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 172/193 (89%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNA+KAL+ AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGK+PVLETP
Sbjct  1    MALVLHS-SPNKNAYKALVAAEYSGVKVELVKNFEMGVSNKTPEFIKMNPIGKIPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++ PD  L+GSSLIEYG IEQW DF+ATEID +   WLYPRLG+ 
Sbjct  60   DGPIFESNAIARYVARLNPDGTLYGSSLIEYGQIEQWLDFSATEIDVSLGNWLYPRLGYR  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIASLKR+L ALNTHLASNTYLVGH VTLADIVM+CNL+ GFK IMTKSFT
Sbjct  120  VYLPPAEEAAIASLKRALGALNTHLASNTYLVGHGVTLADIVMVCNLAYGFKTIMTKSFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERY WTL
Sbjct  180  SEFPHVERYVWTL  192



>ref|XP_006647077.1| PREDICTED: elongation factor 1-gamma 2-like [Oryza brachyantha]
Length=418

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFKALI AEY GVKVEL KNFQMGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWIDFSATEVDANIGKWLYPRLGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+P  EEAAIA+LKRSL ALNTHLASNTYLVG+SVTLADIVM CNL +GF  IM K FT
Sbjct  121  PYVPMGEEAAIAALKRSLGALNTHLASNTYLVGNSVTLADIVMACNLYLGFSRIMIKDFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_007222556.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
 gb|EMJ23755.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
Length=421

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ N NKN FKALI AEY GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPLFGS+LIEY H+EQW DFA  EIDAN  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLFGSTLIEYAHVEQWIDFATLEIDANILRWLIPRIGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+LTALNTHL+SNTYLVGHSVTLADI+M CNL++GF  ++TK FT
Sbjct  121  VYLPPAEEAAISALKRALTALNTHLSSNTYLVGHSVTLADIIMACNLTLGFSRLLTKKFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_007041183.1| Elongation factor 1-gamma 3 isoform 3 [Theobroma cacao]
 gb|EOX97014.1| Elongation factor 1-gamma 3 isoform 3 [Theobroma cacao]
Length=320

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA KALI A+YC V+V+L +NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            ++LP AEE AIASLKR+L ALNTHLASNTYLVGHSV+LADIVM CNL +GF  IMTKSFT
Sbjct  121  VHLPLAEEHAIASLKRALDALNTHLASNTYLVGHSVSLADIVMTCNLYLGFSQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|EYU28215.1| hypothetical protein MIMGU_mgv1a007176mg [Erythranthe guttata]
Length=416

 Score =   326 bits (836),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNA KALI AEY G+K+EL K F+MGVSNKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHASSTNKNAIKALITAEYSGIKIELAKGFEMGVSNKTPAFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL+GSSLI+YGHIEQW DF+A EIDAN  +WLYPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGSSLIDYGHIEQWIDFSANEIDANIGRWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEA I +LKR+L ALN HLAS TYLVGH +TLADIVM CNLSIGFK IMTKSFT
Sbjct  121  LYLPPAEEAGITALKRALEALNIHLASKTYLVGHEITLADIVMACNLSIGFKAIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             +FPHVERYFWTL
Sbjct  181  CQFPHVERYFWTL  193



>ref|XP_008219063.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=421

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ N NKN FKALI AEY GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPLFGSSLIEY H+EQW DFA  EID+N  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLFGSSLIEYAHVEQWIDFATLEIDSNILRWLIPRIGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+LTALNTHL+SNTYLVGHS TLADI+M CNL++GF  ++TK FT
Sbjct  121  VYLPPAEEAAISALKRALTALNTHLSSNTYLVGHSATLADIIMACNLTLGFSRLLTKKFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|KDO42761.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=312

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M LVLH+ N NKNAFKALI AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLADI+M CNL++GF  I++KSFT
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPH+ERYFWT+
Sbjct  181  SEFPHIERYFWTM  193



>ref|XP_004250641.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
lycopersicum]
Length=414

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LHS N NKNA KALI AEY GVKVE+ K+FQMGVSN TPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHSTNNNKNASKALIAAEYTGVKVEVPKDFQMGVSNNTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYSQIEQWNDFSATEVDANIGRWLYPRLGFR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y+P AEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLADI+M+CNLSIGF+ IMTKSFT
Sbjct  121  VYIPAAEEAAVAALKRALGALNTHLASNTYLVGHSITLADIIMVCNLSIGFRMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|XP_004294500.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=419

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKN +KALI AEYCGVKVEL K+FQMGVSNKTPEFLK+NPIGKVPVLETP
Sbjct  1    MALVLHAASNNKNGYKALIAAEYCGVKVELVKDFQMGVSNKTPEFLKLNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K D PLFGSSLIE+  ++QW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVARLKADTPLFGSSLIEHALVDQWIDFATLEIDANILRWFIPRIGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI+SLKR+LTALNTHLASNTYLVGHSVTLADI+MI NL++GF  ++TKSFT
Sbjct  121  VYLPPAEEAAISSLKRALTALNTHLASNTYLVGHSVTLADIIMISNLTLGFNRLLTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|ABA81876.1| unknown [Solanum tuberosum]
Length=413

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LHS N NKN  KALI AEY GVKV+L K+FQMGVSNKTPEFL+MNPIGKVPVL+T 
Sbjct  1    MALILHSTNNNKNTSKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTT  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
              P+ ESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATE+DAN A+WLYPRLG+ 
Sbjct  61   YEPVLESNAIARYVTKTKPDNPLFGSSLIEYAQIEQWNDFSATEVDANIARWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y+P AEE A+A+LKR+L ALNTHLASNTYLVGH +TLADI+M+CNLSIGF+ IMTKSFT
Sbjct  121  VYIPQAEEGAVAALKRALGALNTHLASNTYLVGHCITLADIIMVCNLSIGFRMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>emb|CDP10743.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+ + NKNAFKALI AEY  VKVELTK+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATSNNKNAFKALIAAEYSDVKVELTKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+K +NPLFGSSLIEY  IEQW DFA TEID N  +WLYPRLGF+
Sbjct  61   DGPLFESNAIARYVTKLKANNPLFGSSLIEYARIEQWIDFATTEIDVNLGRWLYPRLGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            ++LPPAEEAAIASLKR+L  LN HLASNTYLVG  VTLADI+ ICNL +G+K +MTKSFT
Sbjct  121  VHLPPAEEAAIASLKRALGPLNAHLASNTYLVGDFVTLADIITICNLYLGYKTVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_006478210.1| PREDICTED: elongation factor 1-gamma-like [Citrus sinensis]
Length=422

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MA+VLH+ N NKNAFKALI AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MAMVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLADI+M CNL++GF  I+TKSFT
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_007041181.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
 gb|EOX97012.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
Length=422

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA KALI A+YC V+V+L +NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            ++LP AEE AIASLKR+L ALNTHLASNTYLVGHSV+LADIVM CNL +GF  IMTKSFT
Sbjct  121  VHLPLAEEHAIASLKRALDALNTHLASNTYLVGHSVSLADIVMTCNLYLGFSQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_009610261.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=417

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS N NKNA KALI AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKSKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLADI+M CNLSIGF+ IMTKSFT
Sbjct  121  AYIPPAEEAAVAALKRALDALNTHLASNTYLVGHSITLADIIMGCNLSIGFRMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|XP_010686883.1| PREDICTED: elongation factor 1-gamma-like [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ N NKNAFKALI AEY GVKVEL K+F+MGVSN+TPEFLK+NPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELAKDFEMGVSNQTPEFLKINPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV ++K DNPL+GSSLI+YGHIEQW DFA+ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIQYGHIEQWIDFASLEIDVNILRWFVPRIGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L A+NTHLA NTYLVG SVTLADIVM CNL +G+  +MTKSFT
Sbjct  121  VYLPPAEEAAISALKRALEAVNTHLACNTYLVGDSVTLADIVMTCNLVLGYSRVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|KJB47897.1| hypothetical protein B456_008G046200 [Gossypium raimondii]
Length=421

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNAFKALI AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYVA+ K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPP+EEAAIA+LKR+L ALNTHLASNT+LVGH VTLADI+M CNL +GF  IMTKSFT
Sbjct  121  VYLPPSEEAAIAALKRALGALNTHLASNTFLVGHFVTLADIIMTCNLYLGFSQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_004250642.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M  +LHS N NKNA KALI AEY GVKVE+ K+FQMGVSN TPEFLKMNPIGKVPVLETP
Sbjct  1    MLQILHSTNNNKNASKALIAAEYTGVKVEVPKDFQMGVSNNTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYSQIEQWNDFSATEVDANIGRWLYPRLGFR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y+P AEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLADI+M+CNLSIGF+ IMTKSFT
Sbjct  121  VYIPAAEEAAVAALKRALGALNTHLASNTYLVGHSITLADIIMVCNLSIGFRMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|XP_009418787.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ N NKN FKALI AEY G++VEL KNF MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGIQVELVKNFVMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+G SLIEY HIEQW D+A+ EIDAN A+WLYPRLG++
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGCSLIEYAHIEQWIDYASMEIDANLARWLYPRLGYM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YL  AEEAAI+SLKR+L ALNTHLAS+TYLVGHSVTLADIVM CNL +GF  I+ KSFT
Sbjct  121  PYLAVAEEAAISSLKRALGALNTHLASSTYLVGHSVTLADIVMTCNLYLGFSMILVKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|EYU22759.1| hypothetical protein MIMGU_mgv1a007114mg [Erythranthe guttata]
Length=419

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 172/193 (89%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNAFK LI AEYCGVK+E+ K FQMGVSNKTPEF+KMNP+GK+PVLETP
Sbjct  1    MALVLHS-SPNKNAFKVLIAAEYCGVKIEMVKEFQMGVSNKTPEFIKMNPLGKIPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFESNAIARYV +   D+ L+GSSLI+YG IEQW DF+ATEIDA+ A WLYPRLG+ 
Sbjct  60   EGAIFESNAIARYVVRSSADSSLYGSSLIDYGQIEQWMDFSATEIDASIAGWLYPRLGYR  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIASLKR+L ALNTHLASNTYLVGH+VT+ADIVM CNL+IGF+ +MTK+FT
Sbjct  120  LYLPPAEEAAIASLKRALGALNTHLASNTYLVGHAVTIADIVMTCNLAIGFQGVMTKTFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  180  SEFPHVERYFWTL  192



>ref|XP_010928857.1| PREDICTED: elongation factor 1-gamma 2 [Elaeis guineensis]
Length=419

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+ N NKNAFKALI AEY GVKVEL KNF++GVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALILHAGNANKNAFKALIAAEYSGVKVELVKNFEIGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV ++K DNPL+GSSLIEY  IEQW DFA+ EIDAN A+WLYPRLGF+
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFASMEIDANIARWLYPRLGFL  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   AEE+A+++LKR L ALNTHLA+NTYLVGHSVTLADI+M CNL IGF  IMTKSFT
Sbjct  121  PFAAVAEESAVSALKRCLGALNTHLATNTYLVGHSVTLADIIMTCNLYIGFIRIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|KDO42759.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=422

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M LVLH+ N NKNAFKALI AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLADI+M CNL++GF  I++KSFT
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPH+ERYFWT+
Sbjct  181  SEFPHIERYFWTM  193



>ref|XP_006339362.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
tuberosum]
Length=416

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +1

Query  112  AMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  291
            AMAL+LHS N NKNA KALI AE+ GVKVEL K+FQMGVSN +PEFLKMNPIGKVPVLET
Sbjct  2    AMALILHSTNNNKNASKALIAAEFTGVKVELAKDFQMGVSNNSPEFLKMNPIGKVPVLET  61

Query  292  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            PDGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+
Sbjct  62   PDGPVFESNAIARYVTKLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGY  121

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
             +Y+P AEEA +A+LKR+L ALNTHLASNTYLVGH +TLADI+M CNLSIGF+ IMTKSF
Sbjct  122  RVYIPAAEEAVVAALKRALGALNTHLASNTYLVGHLITLADIIMGCNLSIGFRMIMTKSF  181

Query  652  TKEFPHVERYFWTL  693
            TKEFPHVERYFWT+
Sbjct  182  TKEFPHVERYFWTV  195



>ref|XP_006441587.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
 gb|ESR54827.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
Length=422

 Score =   319 bits (818),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M LVLH+ N NKNAFK LI AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKTLITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLADI+M CNL++GF  I+TKSFT
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPH+ERYFWT+
Sbjct  181  SEFPHIERYFWTM  193



>ref|XP_008339178.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=313

 Score =   315 bits (808),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKN FKALI AE+ GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNGFKALIAAEFSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP FESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL P +GF 
Sbjct  61   DGPXFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPXIGFS  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPP EEAA+++LKR+LTALNTHL+SNTYLVGHSVTLADI++ CNL++GF  + TKSFT
Sbjct  121  VYLPPVEEAAVSALKRALTALNTHLSSNTYLVGHSVTLADIILTCNLTLGFSRLFTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_002451782.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
 gb|EES04758.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
Length=418

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFK LI AEY GVKVEL K+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSANKNAFKTLIAAEYSGVKVELAKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFA TE+DANT KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFATTEVDANTGKWLYPRMGFY  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y    EE+AIA+LKR+  +LNTHLASNT+LVGHSVTLADIV+ CNL +GF  I+TKSFT
Sbjct  121  PYAAVTEESAIAALKRAFGSLNTHLASNTFLVGHSVTLADIVLTCNLYLGFSRILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_003571724.1| PREDICTED: elongation factor 1-gamma 2 [Brachypodium distachyon]
Length=417

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVL++   NKNAFKALI AEY GVK+EL K+FQMGVSNK+ EFLKMNPIGKVPVLETP
Sbjct  1    MALVLYAGGGNKNAFKALIAAEYSGVKIELVKDFQMGVSNKSAEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYVA+VK DNPL+GSSL+EY HIEQW DF+ATE+D N  KWLYPRLGF 
Sbjct  61   EGPVFESNAIARYVARVKADNPLYGSSLMEYAHIEQWIDFSATEVDVNIGKWLYPRLGFY  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+  +EEA+IA+LKR+L ALNTHLAS+TYLVGHSVTLADIVM CNL IGF  IMTKSFT
Sbjct  121  HYVAVSEEASIAALKRALGALNTHLASSTYLVGHSVTLADIVMACNLYIGFARIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  AEFPHVERYFWTM  193



>gb|ADR70876.1| eukaryotic translation elongation factor 1B gamma-subunit [Hevea 
brasiliensis]
Length=424

 Score =   319 bits (817),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNAFK+LI AEY GVKVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKSLIAAEYSGVKVELVENFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+ SSLI+Y HIEQW DFA+ EIDAN   WL PR+GF 
Sbjct  61   DGPLFESNAIARYVTRLKADNPLYDSSLIDYAHIEQWIDFASLEIDANLMAWLRPRMGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPPAEEAAI++LKR L ALNTHLASNTYLVGHSVTLADI+  CNL +GF  +MTKSFT
Sbjct  121  PYLPPAEEAAISALKRGLGALNTHLASNTYLVGHSVTLADIITTCNLYMGFALLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_010272550.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Nelumbo 
nucifera]
Length=487

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 169/195 (87%), Gaps = 0/195 (0%)
 Frame = +1

Query  109  EAMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLE  288
            +AM LVLH+ N NKNAFKALI AEY GV V+L  NF+MGVSNKTP+FLKMNPIGKVPVLE
Sbjct  63   QAMTLVLHAGNTNKNAFKALIAAEYNGVTVKLVPNFEMGVSNKTPQFLKMNPIGKVPVLE  122

Query  289  TPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  468
            TPDGPIFESNAIARYVA++K D PL+GSSLIE+  IEQW DFA+ EIDAN  KW  PR G
Sbjct  123  TPDGPIFESNAIARYVARLKGDTPLYGSSLIEFARIEQWIDFASLEIDANILKWFIPRAG  182

Query  469  FVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKS  648
            F +YLPPAEEAAI++LKR+L ALN HLASNT+LVGHSVTLADIVM CNLS+GF  +MTKS
Sbjct  183  FAVYLPPAEEAAISALKRALDALNKHLASNTFLVGHSVTLADIVMTCNLSLGFSRVMTKS  242

Query  649  FTKEFPHVERYFWTL  693
            FT EFPHVERYFWT+
Sbjct  243  FTSEFPHVERYFWTM  257



>ref|XP_009610260.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M  VLHS N NKNA KALI AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKSKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLADI+M CNLSIGF+ IMTKSFT
Sbjct  121  AYIPPAEEAAVAALKRALDALNTHLASNTYLVGHSITLADIIMGCNLSIGFRMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>gb|AAO72574.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=409

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            NKNAFKALI AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETPDGP+FESNAI
Sbjct  2    NKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETPDGPVFESNAI  61

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG   Y+  +EEAA
Sbjct  62   ARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIAPYVAVSEEAA  121

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYF  684
            IA+LKRSL ALNTHLASNTYLVGHSVTLADIVM CNL +GF  IMTKSFT EFPHVERYF
Sbjct  122  IAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKSFTSEFPHVERYF  181

Query  685  WTL  693
            WT+
Sbjct  182  WTM  184



>ref|XP_006431568.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
 gb|ESR44808.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
Length=418

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH   ENKN FK LI AEY GV+V+L +NF+MGV+NK+PEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHVGQENKNGFKGLIAAEYAGVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DN L+GSSLI+Y H+EQW DF+A EIDAN ++W+YPRLG++
Sbjct  61   DGPVFESNAIARYVARLKADNQLYGSSLIDYAHVEQWMDFSAMEIDANISRWVYPRLGYM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+P AEE A+A+LKR+L ALN HLASNTYLVGHSVTLADIVMICNL  GFK IMTKSFT
Sbjct  121  QYIPLAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTV  193



>ref|XP_006385057.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ABK94655.1| unknown [Populus trichocarpa]
 gb|ADB11387.1| gamma class glutathione transferase EF1Bgamma2 [Populus trichocarpa]
 gb|ERP62854.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=422

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVL++   NKNA+KALI AEY GV V+L +NF+MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLYAGKTNKNAYKALIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDA  ++WLYPR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFAATEIDAGISRWLYPRMGFQ  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPPAEEAAI++LKR+L ALN HLASNTYLVGHSVTLADI++ CNL +GF  +MTKSFT
Sbjct  121  PYLPPAEEAAISALKRALGALNLHLASNTYLVGHSVTLADIILTCNLFLGFAHVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_009353791.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
 ref|XP_009353792.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKN +KALI AEY GVKVEL  NF+MGVSNKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIAAEYTGVKVELAPNFEMGVSNKTPEYLKLNPIGKVPLLVTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL+GSSLI+Y HIEQW DF   EIDAN +KW YPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGSSLIDYAHIEQWIDFGTMEIDANISKWYYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            ++LPPAEEAAI++LKR+L ALNTH+ASNTYLVGHSVTLADI+++CNL +GF  +MTKSFT
Sbjct  121  VHLPPAEEAAISALKRALGALNTHIASNTYLVGHSVTLADIIVVCNLYVGFTKVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
 ref|XP_010657965.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
Length=423

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA+K LI AEY G+KVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRIGRA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPP EEAAIA+LKR+L ALNTHLASNT+LVGHSVTLADIVM CNL +GF  +MTKSFT
Sbjct  121  VYLPPFEEAAIAALKRALGALNTHLASNTFLVGHSVTLADIVMTCNLYMGFSKLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera]
Length=423

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA+K LI AEY G+KVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELXQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRMGRA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPP EEAAIA+LKR+L ALNTHLASNT+LVGHSVTLADIVM CNL +GF  +MTKSFT
Sbjct  121  VYLPPFEEAAIAALKRALGALNTHLASNTFLVGHSVTLADIVMTCNLYMGFSKLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_008339412.1| PREDICTED: elongation factor 1-gamma [Malus domestica]
Length=420

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKN +KALI AEY GVKVEL  NF MGVSNKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALITAEYTGVKVELAPNFXMGVSNKTPEYLKLNPIGKVPLLVTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL+G SLI+Y HIEQW DF + EIDAN +KW YPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGCSLIDYAHIEQWIDFGSMEIDANISKWYYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L ALNTH+ASNTYLVGHSVTLADIV++CNL +GF  +MTKSFT
Sbjct  121  VYLPPAEEAAISALKRALGALNTHIASNTYLVGHSVTLADIVVVCNLYVGFANVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_009774948.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNA KALI AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSGSNNKNALKALIAAEYTGVKVELAKNFEMGVSNKTPEFVKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +++PPAEEAA+A+LKR+L ALN HLASNTYLVGHS+TLADI+M CNLS GF++IMTKSFT
Sbjct  121  VFIPPAEEAAVAALKRALGALNIHLASNTYLVGHSITLADIIMACNLSHGFRYIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|XP_010272551.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Nelumbo 
nucifera]
Length=423

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M LVLH+ N NKNAFKALI AEY GV V+L  NF+MGVSNKTP+FLKMNPIGKVPVLETP
Sbjct  1    MTLVLHAGNTNKNAFKALIAAEYNGVTVKLVPNFEMGVSNKTPQFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K D PL+GSSLIE+  IEQW DFA+ EIDAN  KW  PR GF 
Sbjct  61   DGPIFESNAIARYVARLKGDTPLYGSSLIEFARIEQWIDFASLEIDANILKWFIPRAGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L ALN HLASNT+LVGHSVTLADIVM CNLS+GF  +MTKSFT
Sbjct  121  VYLPPAEEAAISALKRALDALNKHLASNTFLVGHSVTLADIVMTCNLSLGFSRVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana tabacum]
Length=417

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNA KALI AEY G+KVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSGSNNKNAIKALIAAEYTGIKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +++PPAEEAA+A+LKR+L ALN HLASNTYLVGHS+TLADI+M CNLS GF++IMTKSFT
Sbjct  121  VFIPPAEEAAVAALKRALGALNIHLASNTYLVGHSITLADIIMACNLSHGFRYIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|XP_006494223.1| PREDICTED: elongation factor 1-gamma 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494224.1| PREDICTED: elongation factor 1-gamma 3-like isoform X2 [Citrus 
sinensis]
 gb|ACP43319.1| translation elongation factor [Citrus maxima]
Length=418

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH   ENKN FK LI AEY GV+V+L +NF+MGV+NK+PEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHVGQENKNGFKGLIAAEYAGVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DN L GSSLI+Y H+EQW DF+A EIDAN ++WLYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+P AEE A+A+LKR+L ALN HLASNTYLVGHSVTLADIVMICNL  GFK IMTK+FT
Sbjct  121  QYIPLAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKHIMTKTFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTV  193



>ref|XP_009759974.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS N NKNA KALI AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KPDNPLFGSSLI+Y  IEQW DF+ TEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIQYAQIEQWNDFSTTEIDANIARWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVG S+TLADI+M CNLSIGF  IMTKSFT
Sbjct  121  PYIPPAEEAAVAALKRALDALNTHLASNTYLVGESITLADIIMGCNLSIGFGMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|XP_009362385.1| PREDICTED: elongation factor 1-gamma-like [Pyrus x bretschneideri]
Length=422

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKN FKALI AE+ G KVEL KNF+MGVSNK+P+FL MNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNGFKALIAAEFSGAKVELVKNFEMGVSNKSPKFLDMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPRIGFS  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPP EEAA+++LKR+LTALNTHL+SNTYLVGHSVTLADI++ CNL++GF  + TKSFT
Sbjct  121  VYLPPVEEAAVSALKRALTALNTHLSSNTYLVGHSVTLADIILTCNLTLGFSRLFTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|EEE56572.1| hypothetical protein OsJ_05923 [Oryza sativa Japonica Group]
Length=479

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 170/200 (85%), Gaps = 9/200 (5%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            +VLH+ + NKNAFKALI AEY GVKVEL KNFQMGVSNKTPE+LKMNPIGKVP+LETPDG
Sbjct  55   IVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDG  114

Query  301  PIFESNAIARYV---------AKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWL  453
            P+FESNAIARYV          + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL
Sbjct  115  PVFESNAIARYVLSSSHFPEVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWL  174

Query  454  YPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKW  633
            +PRLGF  Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLADIVM CNL +GF  
Sbjct  175  FPRLGFAPYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFAR  234

Query  634  IMTKSFTKEFPHVERYFWTL  693
            IMTK+FT EFPHVERYFWT+
Sbjct  235  IMTKNFTSEFPHVERYFWTM  254



>ref|XP_004951452.1| PREDICTED: elongation factor 1-gamma 2-like [Setaria italica]
Length=417

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFKALI AEY G+KVEL K+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG +FESNAIARYVA++K DNPL+G SLI+Y HIEQW DFAATE+DAN  KWL+PR+GF 
Sbjct  61   DGAVFESNAIARYVARLKADNPLYGFSLIDYAHIEQWMDFAATEVDANIGKWLFPRMGFY  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y   +EE AIA+LKR+L +LNTHLASNT+LVGHSVTLADIV+ CNL +GF  IMTKSFT
Sbjct  121  PYAAVSEETAIAALKRALGSLNTHLASNTFLVGHSVTLADIVLTCNLYLGFIRIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_011028370.1| PREDICTED: elongation factor 1-gamma 2-like [Populus euphratica]
Length=422

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVL++   NKN +KALI AEY GV V+L +NF+MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLYAGKTNKNGYKALIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV ++K +NPL+GSSLI+Y HIEQW DFAATEIDA  A+WLYPRLGF 
Sbjct  61   DGPIFESNAIARYVTRLKAENPLYGSSLIDYAHIEQWMDFAATEIDAGIARWLYPRLGFQ  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPP EEAAI +LKR+L ALN HLASNTYLVGHSVTLADI++ CNL +GF  +MTKSFT
Sbjct  121  PYLPPVEEAAITALKRALGALNLHLASNTYLVGHSVTLADIILTCNLFLGFAHVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_003563720.1| PREDICTED: elongation factor 1-gamma 3 [Brachypodium distachyon]
Length=413

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNAFKALI AE+CGVKVEL KNF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEFCGVKVELAKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG +FESNAIARYVA+ K D+PLFG SLI+Y H+EQW DF+ATEID N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDSPLFGGSLIDYAHVEQWMDFSATEIDGNIARWLYPRLGYM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+P +EE  IA LKRSL ALNTHLAS T+LVGHSVTLADI M CNL  GF  ++TK+FT
Sbjct  121  PYVPASEEIGIAGLKRSLGALNTHLASTTFLVGHSVTLADITMTCNLYHGFARLLTKTFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_008677347.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008677348.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008679834.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 ref|XP_008679835.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays]
 gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M LVLH+ + NKNAFK LI AEY GVKVEL K+FQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MVLVLHANSGNKNAFKTLIAAEYSGVKVELVKDFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDAN  KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWIDFAATEIDANIGKWLYPRMGFY  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +    EE+ IA+LKR+L +L+THLASNT+LVGHSVTLADIVM CNL +GF  I+TKSFT
Sbjct  121  PHAGVVEESTIAALKRALGSLSTHLASNTFLVGHSVTLADIVMTCNLCMGFSRILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_008804357.1| PREDICTED: elongation factor 1-gamma 2-like [Phoenix dactylifera]
Length=461

 Score =   315 bits (807),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = +1

Query  112  AMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  291
            +MAL+LH+ N NKN FKALI AEY GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLET
Sbjct  42   SMALILHAGNTNKNGFKALIAAEYSGVQVELAKNFEMGVSNKTPEFLKMNPIGKVPVLET  101

Query  292  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            PDGPIFESNAIARYV ++K DNPLFGSSLI+Y  IEQW DFA+ EID N ++WLYPRLG+
Sbjct  102  PDGPIFESNAIARYVTRLKADNPLFGSSLIDYARIEQWIDFASMEIDVNLSRWLYPRLGY  161

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
              +    EE AI++LKRSL AL+THL++NTYLVGHSVTLADI+M CNL IGF  IMTKSF
Sbjct  162  FPFTAVGEEFAISALKRSLGALSTHLSTNTYLVGHSVTLADIIMTCNLYIGFNRIMTKSF  221

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  222  TSEFPHVERYFWTM  235



>ref|XP_006656177.1| PREDICTED: elongation factor 1-gamma 3-like [Oryza brachyantha]
Length=416

 Score =   313 bits (803),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNAFKALI AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYNGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG +FESNAIARYVA++K +N L GSSLIEY HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGAVFESNAIARYVARLKDNNTLCGSSLIEYAHIEQWMDFSATEVDANIGRWLYPRLGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             ++P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLADIVM CNL  GF  I+ K FT
Sbjct  121  PHVPALEEFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYYGFARILIKKFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_009417204.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=419

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY GV+VEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAFKALIAAEYSGVQVELAENFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSSLIEY HIEQW DFA+ E+DAN A+WLYPRLG++
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYAHIEQWIDFASMEVDANIARWLYPRLGYM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y   AEE A +SLKR+L ALNTHLASNTYLVGHSVTLADI+MICNL  GF  ++ KS T
Sbjct  121  PYHAVAEEVAASSLKRALGALNTHLASNTYLVGHSVTLADIIMICNLYHGFSLLLLKSVT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_009774942.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M  VLHS + NKNA KALI AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSGSNNKNALKALIAAEYTGVKVELAKNFEMGVSNKTPEFVKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +++PPAEEAA+A+LKR+L ALN HLASNTYLVGHS+TLADI+M CNLS GF++IMTKSFT
Sbjct  121  VFIPPAEEAAVAALKRALGALNIHLASNTYLVGHSITLADIIMACNLSHGFRYIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|XP_006339363.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M  +LHS N NKNA KALI AE+ GVKVEL K+FQMGVSN +PEFLKMNPIGKVPVLETP
Sbjct  1    MLQILHSTNNNKNASKALIAAEFTGVKVELAKDFQMGVSNNSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGYR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y+P AEEA +A+LKR+L ALNTHLASNTYLVGH +TLADI+M CNLSIGF+ IMTKSFT
Sbjct  121  VYIPAAEEAVVAALKRALGALNTHLASNTYLVGHLITLADIIMGCNLSIGFRMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>gb|AFW76479.1| elongation factor gamma1 [Zea mays]
Length=309

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+VTLADIVM CNL  G   I+TK+FT
Sbjct  121  PYVSTTEETAISSLKRSLGALNTHLASNTYLVGHAVTLADIVMTCNLYHGIARILTKTFT  180

Query  655  KEFPHVERYFWTL  693
             +FPHVERYFWT+
Sbjct  181  SDFPHVERYFWTM  193



>gb|EEC72757.1| hypothetical protein OsI_06402 [Oryza sativa Indica Group]
Length=479

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 9/200 (5%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            +VLH+ + NKNAFKALI AEY GVKVEL KNFQMGVSNKTPE+LKMNPIGKVP+LETPDG
Sbjct  55   IVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDG  114

Query  301  PIFESNAIARYV---------AKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWL  453
            P+FESN IARYV          + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL
Sbjct  115  PVFESNVIARYVLSSSHFPEVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWL  174

Query  454  YPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKW  633
            +PRLGF  Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLADIVM CNL +GF  
Sbjct  175  FPRLGFAPYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFAR  234

Query  634  IMTKSFTKEFPHVERYFWTL  693
            IMTK+FT EFPHVERYFWT+
Sbjct  235  IMTKNFTSEFPHVERYFWTM  254



>ref|XP_011047878.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
 ref|XP_011047880.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
Length=421

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+L++   NKNA+K LI AEY GV V+L +NF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILYAGKTNKNAYKTLIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV ++K DNPL+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPPAEEA+I++LKR+L ALN HL SNTYLVGHSVTLADI+M CNL  GF +++TKSFT
Sbjct  121  PYLPPAEEASISALKRALGALNLHLTSNTYLVGHSVTLADIIMTCNLYTGFSYVLTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_008643919.1| PREDICTED: uncharacterized protein LOC100381466 isoform X1 [Zea 
mays]
 gb|AFW71313.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=414

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNAFK LI A+Y G+KVEL K+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSSNKNAFKTLIAADYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K +NPL+GSSLI+Y HIEQW DFAATE+DA+  KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKANNPLYGSSLIDYAHIEQWMDFAATEVDASIGKWLYPRMGFY  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y    EE+AIA+LKR+  +LNTHLASNT+LVGHSVTLADIV+ CNL +GF  I+TKSFT
Sbjct  121  PYAAVTEESAIAALKRAFGSLNTHLASNTFLVGHSVTLADIVLTCNLYMGFSRILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPH+ERYFWT+
Sbjct  181  SEFPHIERYFWTM  193



>ref|XP_010242290.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
 ref|XP_010242291.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
Length=424

 Score =   312 bits (799),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M+LVLH+ N NKNAFKALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MSLVLHASNVNKNAFKALIAAEYSGVKVELVPNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF-  471
            DGP+FESNAIARYVA++K D  L+GSSLIEY  +EQW DFA+ E+D N ++WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDAILYGSSLIEYARVEQWIDFASLEVDTNISRWLYPRLGFG  120

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
              YLPPAEEA+I++LKR+L ALN HLASNTYLVGHS+TLADI+M CNL +GF  I+TKSF
Sbjct  121  QPYLPPAEEASISALKRALDALNKHLASNTYLVGHSITLADIIMTCNLFLGFSRILTKSF  180

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  181  TSEFPHVERYFWTM  194



>ref|XP_009759973.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M  VLHS N NKNA KALI AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV K+KPDNPLFGSSLI+Y  IEQW DF+ TEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIQYAQIEQWNDFSTTEIDANIARWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVG S+TLADI+M CNLSIGF  IMTKSFT
Sbjct  121  PYIPPAEEAAVAALKRALDALNTHLASNTYLVGESITLADIIMGCNLSIGFGMIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTV  193



>ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays]
 gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   311 bits (796),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M LVLH+ + NKNAFK LI AEY GVKVEL K+FQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MVLVLHANSGNKNAFKTLIAAEYSGVKVELVKDFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            D P+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDAN  KWLYPR+GF 
Sbjct  61   DDPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWIDFAATEIDANIGKWLYPRMGFY  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +    EE+ IA+LKR+L +L+THLASNT+LVGHSVTLADIVM CNL +GF  I+TKSFT
Sbjct  121  PHAGVVEESTIAALKRALGSLSTHLASNTFLVGHSVTLADIVMTCNLCMGFSRILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|ADB11388.1| gamma class glutathione transferase EF1Bgamma3 [Populus trichocarpa]
Length=421

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKNA+K LI AEY GV V+L +NF+M V+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHAGKTNKNAYKTLIAAEYSGVDVKLAENFEMRVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV ++K DN L+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNHLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPPAEEAAI +LKR+L ALN HL SNTYLVGHSVTLADI+M CNL  GF ++MTKSFT
Sbjct  121  PYLPPAEEAAIFALKRALGALNLHLTSNTYLVGHSVTLADIIMTCNLYTGFSYVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_007222927.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
 gb|EMJ24126.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
Length=472

 Score =   311 bits (796),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  100  F*SEAMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVP  279
            F ++AMALVLH+   NKNAFK LIVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP
Sbjct  46   FSAKAMALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVP  105

Query  280  VLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  459
            +L TPDGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  P
Sbjct  106  LLVTPDGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRP  165

Query  460  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIM  639
            R G  +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLADI++ CNL IGF  +M
Sbjct  166  RFGSAVYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLADIIVTCNLLIGFTKLM  225

Query  640  TKSFTKEFPHVERYFWTL  693
            TKSFT EFPHVERYFWTL
Sbjct  226  TKSFTSEFPHVERYFWTL  243



>ref|NP_001057916.1| Os06g0571400 [Oryza sativa Japonica Group]
 sp|Q5Z627.1|EF1G3_ORYSJ RecName: Full=Elongation factor 1-gamma 3; Short=EF-1-gamma 3; 
AltName: Full=eEF-1B gamma 3 [Oryza sativa Japonica Group]
 dbj|BAD61828.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAD61932.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAF19830.1| Os06g0571400 [Oryza sativa Japonica Group]
 dbj|BAG90811.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96325.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   308 bits (790),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH  + NKNAFKALI AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   EGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLADIVM CNL  GF  I+ KSFT
Sbjct  121  PYVPVLEEFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYYGFVRILIKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_008789739.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Phoenix dactylifera]
Length=419

 Score =   308 bits (790),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+ N NKN FKALI A Y GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHAGNTNKNGFKALIAAAYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV ++K +NPL+GSSLIEY  IEQW DFA+ EIDAN A+WL PRLGFV
Sbjct  61   DGPIFESNAIARYVTRLKAENPLYGSSLIEYARIEQWIDFASMEIDANIARWLLPRLGFV  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   AEE AI +LKRSL ALNTHLA+NTYLVGHSVTLADI+  CNL +GF  IMTK+FT
Sbjct  121  PFAAVAEEFAITALKRSLGALNTHLATNTYLVGHSVTLADIITTCNLYMGFIRIMTKNFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|EMT20600.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=413

 Score =   308 bits (790),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNAFKALI AEYCGVKVELTKNF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYCGVKVELTKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG +FESNAIARYVA+ K DN L+G SLIEY  +EQW DF ATE+D N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDNLLWGGSLIEYARVEQWMDFGATEVDPNIARWLYPRLGYM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y   +EE  IA LKR+L ALNTHLASNT+LVGHSVTLADIVM CNL  GF  I+TK+FT
Sbjct  121  PYNAQSEEFGIAGLKRALEALNTHLASNTFLVGHSVTLADIVMTCNLYHGFARILTKTFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_004966044.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNA+KALI AEY GVKVEL KNF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSFPGNKNAYKALIAAEYSGVKVELNKNFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG +FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A++L+PRLGF+
Sbjct  61   DGAVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWIDFAATEVDPGIARYLFPRLGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+  AEE AIASLKR+L +LNTHLAS T+LVGHSVTLADIV+ CNL  GF +I+TKSFT
Sbjct  121  PYVQTAEETAIASLKRALGSLNTHLASKTFLVGHSVTLADIVLTCNLYTGFMYILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|EAZ37421.1| hypothetical protein OsJ_21756 [Oryza sativa Japonica Group]
Length=440

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = +1

Query  112  AMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  291
             MALVLH  + NKNAFKALI AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLET
Sbjct  24   GMALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLET  83

Query  292  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            P+G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF
Sbjct  84   PEGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGF  143

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
              Y+P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLADIVM CNL  GF  I+ KSF
Sbjct  144  GPYVPVLEEFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYYGFVRILIKSF  203

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  204  TSEFPHVERYFWTM  217



>ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
 gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
Length=417

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY GVKVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG +FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLGF+
Sbjct  61   DGAVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWVDFAATEVDPGVAWYLYPRLGFI  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y    EE AIASLKRSL ALNTHLASNTYLVGHSVTLADIV+ CNL  G   I+TKSFT
Sbjct  121  PYAHTTEETAIASLKRSLGALNTHLASNTYLVGHSVTLADIVLTCNLYHGIARILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             +FPHVERYFWT+
Sbjct  181  SDFPHVERYFWTM  193



>sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Prunus avium]
 gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium]
Length=422

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNAFK LIVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+LETP
Sbjct  1    MALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLADI++ CNL  GF  +M KSFT
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLADIIVTCNLFFGFTKLMIKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|EEC80835.1| hypothetical protein OsI_23436 [Oryza sativa Indica Group]
Length=458

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH  + NKNAFKALI AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   EGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLADIVM CNL  GF  I+ KSFT
Sbjct  121  PYVPALEEFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYYGFVRILIKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_004966045.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGPGNKNAFKALIAAEYSGVKVELTKNFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG IFESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D+  A +LYPRLG++
Sbjct  61   DGAIFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDSGVAWYLYPRLGYI  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y    EE AIASLKR+L +LNTHLAS T+LVGHSVTLADIV+ CNL  GF  I+TKSFT
Sbjct  121  PYAQTTEETAIASLKRALGSLNTHLASKTFLVGHSVTLADIVLTCNLYHGFARILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|ACG36145.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+VTLADIVM CNL  G   I+TK+FT
Sbjct  121  PYVSTTEETAISSLKRSLGALNTHLASNTYLVGHAVTLADIVMTCNLYHGIARILTKTFT  180

Query  655  KEFPHVERYFWTL  693
             +FPHVERYFWT+
Sbjct  181  SDFPHVERYFWTM  193



>ref|XP_008647353.1| PREDICTED: uncharacterized protein LOC100192872 isoform X1 [Zea 
mays]
 gb|AFW76478.1| elongation factor gamma1 [Zea mays]
Length=417

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+VTLADIVM CNL  G   I+TK+FT
Sbjct  121  PYVSTTEETAISSLKRSLGALNTHLASNTYLVGHAVTLADIVMTCNLYHGIARILTKTFT  180

Query  655  KEFPHVERYFWTL  693
             +FPHVERYFWT+
Sbjct  181  SDFPHVERYFWTM  193



>ref|XP_006389499.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ERP48413.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=421

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+L++   NKNA+K LI AEY GV V+L +NF+M V+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILYAGKTNKNAYKTLIAAEYSGVDVKLAENFEMRVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV ++K DN L+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNHLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPPAEEAAI +LKR+L ALN HL SNTYLVGHSVTLADI+M CNL  GF ++MTKSFT
Sbjct  121  PYLPPAEEAAIFALKRALGALNLHLTSNTYLVGHSVTLADIIMTCNLYTGFSYVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|KJB47886.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=314

 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNAFKALI AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYVA+ K +NP+ GSSLI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSSLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH VTLADI+M CNL +GF  IMTKSFT
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHFVTLADIIMTCNLYLGFFQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|ACJ84952.1| unknown [Medicago truncatula]
Length=227

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LHS   NKNA+KA I AEY  V+++LT NF+MGVSNKTP+FL MNP+GKVPVLETP
Sbjct  1    MALILHSGEINKNAYKARIAAEYASVQLQLTPNFEMGVSNKTPQFLDMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA+   +N L+GSSLI+Y  IEQW DF++ E+D+N  KWLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIEQWIDFSSLEVDSNINKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEE AI  LKR+L ALNTHLASNTYLVGHSVTLADI+  CNL +GF  +  KSF+
Sbjct  121  VYLPPAEEIAITGLKRALNALNTHLASNTYLVGHSVTLADIITTCNLYVGFTRLFVKSFS  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|AGC13156.1| EF1Bgamma class glutathione S-transferase, partial [Pinus tabuliformis]
Length=225

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 160/193 (83%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL LH+ + NKNAFKALI AEY GVKV L  NF+MG   K+PEFLKMNPIGKVPVLETP
Sbjct  1    MALTLHAGSTNKNAFKALISAEYVGVKVSLAPNFEMG-GTKSPEFLKMNPIGKVPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYVA++K  N LFGSS+I+Y H+EQW DF+  EID N  +W YPRLGF 
Sbjct  60   EGAVFESNAIARYVARLKGVNSLFGSSVIDYAHVEQWIDFSTLEIDINITRWFYPRLGFG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEA IA LKRSL ALN+HLA+NTYLVGHS+TLADI+M CNL +GF   MTK FT
Sbjct  120  VYLPPAEEATIAGLKRSLAALNSHLATNTYLVGHSITLADIIMTCNLYLGFTSCMTKDFT  179

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  180  KEFPHVERYFWTM  192



>ref|XP_011623896.1| PREDICTED: elongation factor 1-gamma [Amborella trichopoda]
 ref|XP_011623897.1| PREDICTED: elongation factor 1-gamma [Amborella trichopoda]
Length=423

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+ + NKNAFK LI AEY GV+V+L ++F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALILHAGSNNKNAFKPLIAAEYTGVEVKLVESFEMGVSNKTPEFLKMNPMGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
             GPIFESNAIARYVA++K DN L+GSSL EY  IEQW DFA+ EID +T++W YPRLGF+
Sbjct  61   KGPIFESNAIARYVARLKGDNILYGSSLFEYALIEQWIDFASLEIDTHTSRWFYPRLGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLP  EEAAIA+LKR+L ALNTHLA NTYLVGHSVTLADIVM CNL +GF  IM KSFT
Sbjct  121  VYLPLVEEAAIAALKRALGALNTHLALNTYLVGHSVTLADIVMTCNLCMGFCCIMIKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|NP_001148829.1| elongation factor 1-gamma 3 [Zea mays]
 gb|ACG33050.1| elongation factor 1-gamma 3 [Zea mays]
 gb|AFW87009.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY GVKVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D     +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVGWYLYPRLGYI  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y    EE AIASLKRSL ALNTHLA NTYLVGHSVTLADIV+ CNL  G   I+TKSFT
Sbjct  121  PYAHTTEETAIASLKRSLGALNTHLALNTYLVGHSVTLADIVLTCNLYHGIARILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             +FPHVERYFWT+
Sbjct  181  SDFPHVERYFWTM  193



>ref|XP_008365338.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=331

 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKN +KALIVAEY GVKVEL  NF+MGV+NKTPEFLK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIVAEYSGVKVELAPNFEMGVTNKTPEFLKLNPIGKVPLLVTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+Y  IEQW DF + EIDAN   W  PR+G  
Sbjct  61   DGPIFESNAIARYVARLKXDNPLCGSSLIDYARIEQWIDFGSMEIDANVLNWWVPRMGRR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPPAEE AI+SLKR+L ALNTHLASNTYLVGHSVTLADIV+ CNL  GF  I+TKSFT
Sbjct  121  AYLPPAEEFAISSLKRALGALNTHLASNTYLVGHSVTLADIVIGCNLYFGFTEILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|EMS60520.1| Elongation factor 1-gamma 2 [Triticum urartu]
Length=413

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS + NKNAFKALI AEYCGVKVELTKNF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYCGVKVELTKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG +FESNAIARYVA+ K D+ L+G SLIEY  +EQW DF ATE+D N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDSLLWGGSLIEYARVEQWMDFGATEVDPNIARWLYPRLGYM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y   +EE  IA LKR+L ALNTHLASNT+LVGHSVTLADIV+ CNL  GF  I+TK+FT
Sbjct  121  PYNAQSEEFGIAGLKRALEALNTHLASNTFLVGHSVTLADIVITCNLYHGFARILTKTFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_008218696.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
 ref|XP_008218697.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
Length=422

 Score =   304 bits (778),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNAFK LIVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESN IARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G  
Sbjct  61   DGPIFESNTIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGHA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLADI++ CNL  GF  +MTKSFT
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLADIIVTCNLFFGFTKLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|AHZ94964.1| elongation factor 1, partial [Lilium regale]
Length=405

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            NKNAFKALI AEY GVK+EL KNF+MGVSNKTP+FLKMNP+GK+PVLETPDG +FESNAI
Sbjct  1    NKNAFKALIAAEYSGVKIELVKNFEMGVSNKTPDFLKMNPLGKIPVLETPDGAVFESNAI  60

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYV + KPDNPL GSSLIEY  IEQW DFA+ EID N  +WLYPRLG+VIY+  AEE A
Sbjct  61   ARYVTRTKPDNPLHGSSLIEYAQIEQWIDFASFEIDINLGRWLYPRLGYVIYIAQAEELA  120

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYF  684
            I++LKRSL ALNTHLA+ T+LVG SVTLADIV +CNL  GF WI+TKSFT EFPHVERYF
Sbjct  121  ISALKRSLGALNTHLATTTFLVGDSVTLADIVTVCNLYYGFAWILTKSFTSEFPHVERYF  180

Query  685  WTL  693
            WTL
Sbjct  181  WTL  183



>gb|AAO72563.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=413

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            VLH  + NKNAFKALI AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP+G 
Sbjct  1    VLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETPEGA  60

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF  Y+
Sbjct  61   VFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFGPYV  120

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
            P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLADIVM CNL  GF  I+ KSFT EF
Sbjct  121  PVLEEFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYYGFVRILIKSFTSEF  180

Query  664  PHVERYFWTL  693
            PHVERYFWT+
Sbjct  181  PHVERYFWTM  190



>ref|XP_010030200.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 ref|XP_010030201.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 gb|KCW57149.1| hypothetical protein EUGRSUZ_I02782 [Eucalyptus grandis]
Length=419

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+H+   NKN +KALI AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGK+PVLETP
Sbjct  1    MALVVHA-TSNKNVYKALIAAEYTGVKVELAPNFEMGVSNKTPEFIKMNPIGKIPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DF++ E+DAN   WL PR+G  
Sbjct  60   DGPVFESNAIARYVCRLKADNPLYGSSLIDYAHIEQWIDFSSLEVDANILNWLRPRMGRA  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEA IA+LKR+L ALN HL+SNTYLVGHSVTLADI+  CNL +GF  ++ KSFT
Sbjct  120  VYLPPAEEAVIAALKRALGALNVHLSSNTYLVGHSVTLADIITTCNLFMGFTKLLPKSFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  180  SEFPHVERYFWTM  192



>ref|NP_001274793.1| elongation factor 1-gamma 2-like [Solanum tuberosum]
 gb|ABB87108.1| putative elongation factor 1-gamma-like [Solanum tuberosum]
Length=414

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LHS N NKN  KALI AEY GVKV+L K+FQMGVSNKTPEFL+MNPIGKVPVL+TP
Sbjct  1    MALILHSTNNNKNTSKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPL-FGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
             GP+FESNAIARYV   +    L FGSS  EY   EQW DF+ATE+DAN A+WLYPRLG+
Sbjct  61   YGPVFESNAIARYVTNNETLTILYFGSSFFEYPLCEQWNDFSATEVDANIARWLYPRLGY  120

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
             +Y+P AEE A+A+LKR+L ALNTHLASNTYLVGH +TLADI+M+CNLSIGF+ IMTKSF
Sbjct  121  GVYIPQAEEGAVAALKRALGALNTHLASNTYLVGHCITLADIIMVCNLSIGFRMIMTKSF  180

Query  652  TKEFPHVERYFWTL  693
            TKEFPHVERYFWT+
Sbjct  181  TKEFPHVERYFWTV  194



>ref|XP_008456982.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=422

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M LVLH+   NKN+FKALI AEY GV+V++  +F+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MVLVLHAGKTNKNSFKALIAAEYNGVEVKVVPDFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYVA++K D+PL+GS LI+YGHIEQW +FA+ E+D+N   W  PR+G  
Sbjct  61   NGPIFESNAIARYVARLKADSPLYGSFLIDYGHIEQWIEFASLEVDSNILTWFRPRMGRA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPP EEAAIA+LKR+L ALNTHLASNTYLVGHS+TLADIVM CNL +GF  +MTK+FT
Sbjct  121  AYLPPVEEAAIAALKRALGALNTHLASNTYLVGHSITLADIVMTCNLLLGFTKLMTKNFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_010683294.1| PREDICTED: elongation factor 1-gamma 2-like [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNA+KALI AEY GVKV++ K+FQMGV+NK+PEFLKMNPIGKVPVL TP
Sbjct  1    MALVLHSGLPNKNAYKALIAAEYSGVKVDVVKDFQMGVTNKSPEFLKMNPIGKVPVLATP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV ++K DNPLFGSS  EY  IEQW DFA+ EIDA+ A+WLYPRLG+ 
Sbjct  61   EGPLFESNAIARYVTRLKADNPLFGSSTYEYALIEQWIDFASLEIDAHIARWLYPRLGYF  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            ++LPPAEE AIA+LKRSL AL+ HLASNTYLVG SVTLADI+M  NL  GF  IMTKSFT
Sbjct  121  VHLPPAEEGAIAALKRSLEALSKHLASNTYLVGDSVTLADIIMAVNLFYGFSQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERY WT+
Sbjct  181  SEFPHVERYVWTM  193



>gb|KJB47883.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47887.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47888.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=421

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNAFKALI AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYVA+ K +NP+ GSSLI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSSLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH VTLADI+M CNL +GF  IMTKSFT
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHFVTLADIIMTCNLYLGFFQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|KHG04277.1| hypothetical protein F383_29497 [Gossypium arboreum]
Length=421

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNAFKALI AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYVA++K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKW YPRLG+ 
Sbjct  61   EGPVFESNAIARYVARLKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWFYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH+VTLADI+M CNL +GF  IMTKSFT
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHAVTLADIIMTCNLYLGFFQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|KHG12420.1| hypothetical protein F383_17048 [Gossypium arboreum]
Length=421

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKNAFKALI AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALILHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYVA+ K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH+VTLADI+M CNL +GF  IMTKSFT
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHAVTLADIIMTCNLYLGFFQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|KHN03584.1| Elongation factor 1-gamma [Glycine soja]
Length=420

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            L+LH+   NKN++K LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLADI+M CNL +GF  I+ KSFT E
Sbjct  124  LPPAEEAAISALKRALGALNTHLASNTYLVGHSVTLADIIMTCNLYLGFANILVKSFTSE  183

Query  661  FPHVERYFWTL  693
            FPHVERYFWTL
Sbjct  184  FPHVERYFWTL  194



>gb|AIZ68134.1| translation elongation factor 1-gamma [Ornithogalum saundersiae]
Length=414

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS ++NKNA+K+LI AEY GV+VEL K+FQMGVSNKTPEF+KMNP+GK+PVL+TP
Sbjct  1    MALVLHSTSDNKNAWKSLIAAEYSGVQVELVKDFQMGVSNKTPEFIKMNPLGKIPVLQTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL GSSLIEY +IEQW DFA TEID++ + WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLHGSSLIEYANIEQWMDFAVTEIDSSISAWLYPRLGYR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             ++  AEE AIA+LKR+L ALNTHLA+NTYLVGH+VTLADI++ CNL  GF  ++TKSF+
Sbjct  121  PFIQQAEEIAIANLKRALEALNTHLATNTYLVGHAVTLADIIVTCNLHSGFTGVITKSFS  180

Query  655  KEFPHVERYFWTL  693
             ++PHVERYFWTL
Sbjct  181  SQYPHVERYFWTL  193



>ref|XP_006600242.1| PREDICTED: elongation factor 1-gamma isoform X1 [Glycine max]
 gb|AJE59628.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            L+LH+   NKN++K LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLADI+M CNL +GF  I+ KSFT E
Sbjct  124  LPPAEEAAISALKRALGALNTHLASNTYLVGHSVTLADIIMTCNLYLGFANILVKSFTSE  183

Query  661  FPHVERYFWTL  693
            FPHVERYFWTL
Sbjct  184  FPHVERYFWTL  194



>ref|XP_009355338.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKN +KALIVAEY GVKVEL  NF+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIVAEYSGVKVELAPNFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W   R+G  
Sbjct  61   DGPIFESNAIARYVARLKADNPLCGSSLIDYAHIEQWIDFGSLEIDANILNWWLSRVGRR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPP EEA I++LKR+L ALNTHLASNTYLVGHSVTLADIV+ CNL  GF  I+TKSFT
Sbjct  121  VYLPPDEEATISALKRALGALNTHLASNTYLVGHSVTLADIVVGCNLYFGFTQILTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|ERN07474.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
Length=430

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            +LH+ + NKNAFK LI AEY GV+V+L ++F+MGVSNKTPEFLKMNP+GKVPVLETP GP
Sbjct  11   ILHAGSNNKNAFKPLIAAEYTGVEVKLVESFEMGVSNKTPEFLKMNPMGKVPVLETPKGP  70

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            IFESNAIARYVA++K DN L+GSSL EY  IEQW DFA+ EID +T++W YPRLGF++YL
Sbjct  71   IFESNAIARYVARLKGDNILYGSSLFEYALIEQWIDFASLEIDTHTSRWFYPRLGFMVYL  130

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
            P  EEAAIA+LKR+L ALNTHLA NTYLVGHSVTLADIVM CNL +GF  IM KSFT EF
Sbjct  131  PLVEEAAIAALKRALGALNTHLALNTYLVGHSVTLADIVMTCNLCMGFCCIMIKSFTSEF  190

Query  664  PHVERYFWTL  693
            PHVERYFWT+
Sbjct  191  PHVERYFWTM  200



>ref|XP_008352808.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=424

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            LVLH+ + NKN FKALI AE+ GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETPDG
Sbjct  5    LVLHAGSTNKNGFKALIAAEFSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETPDG  64

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
            PIFESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL P +GF +Y
Sbjct  65   PIFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPLIGFSVY  124

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
            LPP     I   KR+LTALNTHL+SNTYLVGHSVTLADI++ CNL++GF  + TKSFT E
Sbjct  125  LPPVSHYCIXXXKRALTALNTHLSSNTYLVGHSVTLADIILTCNLTLGFSRLFTKSFTSE  184

Query  661  FPHVERYFWTL  693
            FPHVERYFWTL
Sbjct  185  FPHVERYFWTL  195



>gb|ABK25057.1| unknown [Picea sitchensis]
Length=424

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL LH+ + NKNAFKALI AEY GVK+ L  NF+MGV+NK+ +FL MNPIGKVPVLETP
Sbjct  1    MALTLHAGHTNKNAFKALIAAEYVGVKINLAPNFEMGVTNKSQKFLSMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYVA++K DN LFGSSLI+YGH+EQW DF++ EID N  +W +PR+G  
Sbjct  61   EGAVFESNAIARYVARLKDDNSLFGSSLIDYGHVEQWIDFSSLEIDINIMRWYFPRMGHG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEA IA LKR L ALN+HLA+NTYLVGHS+TLADI+M CNL +GF   MTK FT
Sbjct  121  LYLPPAEEATIAGLKRGLAALNSHLATNTYLVGHSITLADIIMTCNLYLGFSRCMTKDFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTM  193



>ref|XP_010907209.1| PREDICTED: elongation factor 1-gamma 2-like [Elaeis guineensis]
Length=419

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+L++ + NKN FKALI AE  GV+VEL KNF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALILYAGSTNKNGFKALIAAECSGVQVELAKNFEMGVSNKTPEFLKMNPMGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPI ESNAIARYV ++K DNPLFG SLI+Y  IEQW DFA+ EIDAN + WLYPR+G++
Sbjct  61   DGPISESNAIARYVTRLKADNPLFGYSLIDYARIEQWIDFASIEIDANISWWLYPRMGYI  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +    EE AI++LKRSL ALNTHL++NTYLVGHSVTLADI+M CNL IGF  IMTKSFT
Sbjct  121  PFTAVVEEFAISALKRSLGALNTHLSTNTYLVGHSVTLADIIMTCNLYIGFIQIMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>gb|AHC03515.1| gamma class glutathione S-transferase [Larix kaempferi]
Length=422

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL LH+ N NKNAFKALI AEY GVK+ L  NF+MGV+NK+PEFL MNPIGKVPVLETP
Sbjct  1    MALTLHAGNGNKNAFKALIAAEYVGVKIGLAPNFEMGVTNKSPEFLNMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYVA++K DN LFG SLI+  H+EQW DF++ EID N  +W +PRLG+ 
Sbjct  61   EGTVFESNAIARYVARLKGDNTLFGFSLIDCAHVEQWIDFSSLEIDINITRWYFPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEA IA LKR L ALN HLA+NTYLVGHS+TLADI+M CNL +GF   MTK FT
Sbjct  121  LYLPPAEEATIAGLKRGLVALNLHLATNTYLVGHSITLADIIMTCNLYLGFARCMTKDFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTM  193



>ref|XP_010414808.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=244

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK AFKAL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PRLG+ 
Sbjct  61   EGAIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRLGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>gb|KEH32762.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LHS   NKNA+KA I AEY  V+++LT NF+MGVSNKTP+FL MNP+GKVPVLETP
Sbjct  1    MALILHSGEINKNAYKARIAAEYASVQLQLTPNFEMGVSNKTPQFLDMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA+   +N L+GSSLI+Y  IEQW DF++ E+D+N  KWLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIEQWIDFSSLEVDSNINKWLYPRLGYG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEE AI  LKR+L ALNTHLASNTYLVGHSVTLADI+  CNL +GF  +  KSF+
Sbjct  121  VYLPPAEEIAITGLKRALNALNTHLASNTYLVGHSVTLADIITTCNLYVGFTRLFVKSFS  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max]
 gb|KHN11054.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59626.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=418

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKNAFK LI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKTNKNAFKTLIAAEYSGVQVELAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K L PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANLMKLLLPRLGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPP EE A ++LKR+  ALNTHLASNTYLVGHSVTLADI+  CNL +GF  ++ KSFT
Sbjct  121  PYLPPVEEGANSALKRAFEALNTHLASNTYLVGHSVTLADIITTCNLYLGFSQLLVKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_010101278.1| Elongation factor 1-gamma [Morus notabilis]
 gb|EXB88213.1| Elongation factor 1-gamma [Morus notabilis]
Length=460

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 162/204 (79%), Gaps = 14/204 (7%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            VL++ N NKN FK LI AEY GVK+EL KNF+MG+SNKTPEFLKMNPIGKVPVL+TPDGP
Sbjct  23   VLYAGNTNKNGFKVLIAAEYSGVKIELVKNFEMGISNKTPEFLKMNPIGKVPVLQTPDGP  82

Query  304  IFESNAIARY--------------VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANT  441
            IFESNAIARY                 +K DNPLFGSSLI+Y H+EQW DFA  EID N 
Sbjct  83   IFESNAIARYGENKLRIPYSAYENFTHLKADNPLFGSSLIDYAHVEQWIDFATLEIDTNI  142

Query  442  AKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSI  621
             +W  PR+GF +YLPPAEEA IA+LKR+L ALNT+LASNTYLVGHS TLADI++ CNL++
Sbjct  143  LRWFIPRIGFSVYLPPAEEATIAALKRALGALNTYLASNTYLVGHSATLADIILTCNLTL  202

Query  622  GFKWIMTKSFTKEFPHVERYFWTL  693
            GF  IMTKSFT +FPHVERYFWT+
Sbjct  203  GFTRIMTKSFTSDFPHVERYFWTM  226



>gb|ACU24584.1| unknown [Glycine max]
Length=418

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKNAFK LI AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKTNKNAFKTLIAAEYSGVQVELAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K L PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANLMKLLLPRLGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPP EE A ++LKR+  ALNTHLASNTYLVGHSVTLADI+  CNL +GF  ++ KSFT
Sbjct  121  PYLPPVEEGANSALKRAFEALNTHLASNTYLVGHSVTLADIITTCNLYLGFSQLLVKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_002325529.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|EEE99910.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa]
Length=426

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNA K LI AEY GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNALKTLIAAEYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV ++K DNPL+GSSLIEY  IEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFATLEIDANILRWFIPRIGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+LTALNTHL+++TYLVGHS+TLADIV+ CNL++GF  ++TK+FT
Sbjct  121  VYLPPAEEAAIAALKRALTALNTHLSTSTYLVGHSLTLADIVLTCNLTLGFSRLLTKTFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_012066699.1| PREDICTED: elongation factor 1-gamma [Jatropha curcas]
 gb|KDP42461.1| hypothetical protein JCGZ_00258 [Jatropha curcas]
Length=423

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFK LI AEY GV V+L +NF+MGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHSGKTNKNAFKTLIAAEYSGVNVKLVENFEMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K +NPL GSS  EY  IEQW DFA+ EIDAN   WL PR G  
Sbjct  61   DGPLFESNAIARYVTRLKANNPLLGSSTYEYALIEQWIDFASLEIDANILGWLVPRFGRS  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPPAEE  I++LKR+L ALNTHLASNTYLVGHSVTLADI+M  NL  GF  ++TKSFT
Sbjct  121  PYLPPAEEHVISTLKRALNALNTHLASNTYLVGHSVTLADIIMTMNLYSGFTRLLTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|NP_001241223.1| uncharacterized protein LOC100787125 [Glycine max]
 gb|ACU24574.1| unknown [Glycine max]
 gb|AJE59627.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=419

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKNAFK LI AEY GV+VEL  NF+MGVSN+TPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKANKNAFKTLIAAEYSGVQVELAPNFEMGVSNRTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K   PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANIMKLYLPRLGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPP EE A ++LKR+  ALNTHLASNTYLVGHSVTLADI+  CNL +GF  ++ KSFT
Sbjct  121  PYLPPVEEGANSALKRAFEALNTHLASNTYLVGHSVTLADIITTCNLYLGFSQLLVKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_006392370.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 ref|XP_006392371.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29656.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29657.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=414

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK A+KALI AEY GVK+E   NFQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAYKALIAAEYVGVKIEEPSNFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  +N L GSSLI+Y HIEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIDYAHIEQWIDFATLEIDANMLRWFAPRMGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAIA L R L ALNTHLASNTYLVGHSVTLADIV ICNL++GF  +MTKSFT
Sbjct  121  PFSAPAEEAAIAGLNRGLDALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>gb|KHN40193.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59625.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            L+LH    NKN++K LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
            P+FESNAIARYV ++K DN L+GSSLIE+ HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PVFESNAIARYVTQLKGDNTLYGSSLIEHAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLADI+M CNL +GF  I+ K FT E
Sbjct  124  LPPAEEAAISALKRALAALNTHLASNTYLVGHSVTLADIIMTCNLYLGFANILVKCFTSE  183

Query  661  FPHVERYFWTL  693
            FPHVERYFWTL
Sbjct  184  FPHVERYFWTL  194



>ref|NP_001235707.1| elongation factor 1-gamma [Glycine max]
 gb|AAL82617.1|AF475939_1 elongation factor 1-gamma [Glycine max]
Length=420

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            L+LH+   NKN++K LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
            LPP EEA+ +SLKR+L ALNTHLASNTYLVGHSVTLADI+M CNL +GF  I+ KSFT E
Sbjct  124  LPPTEEASNSSLKRALGALNTHLASNTYLVGHSVTLADIIMTCNLYLGFANILVKSFTSE  183

Query  661  FPHVERYFWTL  693
            FPHVERYFWTL
Sbjct  184  FPHVERYFWTL  194



>ref|XP_011031541.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031542.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031543.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
Length=426

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNA K LI AEY GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNALKTLIAAEYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV ++K DNPL+GSSL+EY  IEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLMEYARIEQWIDFATLEIDANILRWFIPRIGFS  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+LTALNTHL+++TYLVGHS+TLADI++ CNL++GF  ++TK+FT
Sbjct  121  VYLPPAEEAAIAALKRALTALNTHLSTSTYLVGHSLTLADIILTCNLTLGFSRLLTKTFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_009388887.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=290

 Score =   289 bits (740),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            VLH+   NKN  KALI AEY GV++E+ KNFQMGVSN TPEFLKMNPIGKVP+LETPDGP
Sbjct  32   VLHATRTNKNGIKALIAAEYSGVEIEMAKNFQMGVSNTTPEFLKMNPIGKVPLLETPDGP  91

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            IFESNAIARYVA++K DNPL+GSSL EY  IEQW DFA+TEID N A+W YPR G   Y 
Sbjct  92   IFESNAIARYVARLKADNPLYGSSLFEYALIEQWIDFASTEIDPNIAQWFYPRHGLKPYF  151

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
              AEEAA+ +LKR+L ALNTHLAS TYLVGHSVTLADI+M CNL +GF  IMTKSFT EF
Sbjct  152  AAAEEAAVRALKRALRALNTHLASKTYLVGHSVTLADIIMACNLYLGFLCIMTKSFTAEF  211

Query  664  PHVERYFWTL  693
            PHVERY+WT+
Sbjct  212  PHVERYYWTM  221



>ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max]
 gb|ACU18062.1| unknown [Glycine max]
Length=420

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            L+LH    NKN++K LI AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
            P+FESNAIARYV ++K DN L+GSSLIE+ HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PVFESNAIARYVTQLKGDNTLYGSSLIEHAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTL DI+M CNL +GF  I+ K FT E
Sbjct  124  LPPAEEAAISALKRALAALNTHLASNTYLVGHSVTLTDIIMTCNLYLGFANILVKCFTSE  183

Query  661  FPHVERYFWTL  693
            FPHVERYFWTL
Sbjct  184  FPHVERYFWTL  194



>dbj|BAH56923.1| AT1G57720 [Arabidopsis thaliana]
Length=391

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+H+   NK A KALI AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNT+LVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLADIVTICNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>ref|XP_007153909.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
 gb|ESW25903.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
Length=420

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            L+LH    NKN++K LI A+Y GV+VEL  NF+MGVSNKTP+FL+MNPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAQYAGVQVELAPNFEMGVSNKTPQFLQMNPIGKVPVLETPDG  63

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
            P+FESN+IARYVA++  DN L+GSS  EY  IEQW DF++ EIDAN  KW  PR G   Y
Sbjct  64   PVFESNSIARYVARLSGDNTLYGSSFFEYAQIEQWIDFSSLEIDANIIKWYAPRFGRGPY  123

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLADI++ CNL +GF  I+ KSFT E
Sbjct  124  LPPAEEAAISALKRALDALNTHLASNTYLVGHSVTLADIILTCNLYLGFANILVKSFTSE  183

Query  661  FPHVERYFWTL  693
            FPHVERYFWTL
Sbjct  184  FPHVERYFWTL  194



>ref|XP_008218698.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=420

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVL++   ++  FK  IVAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLYAVKGHEYGFKTRIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G  
Sbjct  61   DGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANVMSWFKPRFGSA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLADI++ CNL  GF  +MTKSFT
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLADIIVTCNLFWGFTKLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_010553691.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=415

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+H+   NK AFKALI AEY GVK+E+  +FQMGV+NK+PEFLK+NPIGKVPVLETP
Sbjct  1    MALVMHTYPGNKGAFKALIAAEYTGVKIEVPSDFQMGVTNKSPEFLKLNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++K DN L GSSLIEY  IEQW DFA+ E+D N  +W  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRLKGDNSLVGSSLIEYAQIEQWIDFASMEVDVNILRWFAPRMGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +L PAEEA I++LKR+L  LNTHLASNTYLVGHSVTLADIV++CN+ +G + ++TKSFT
Sbjct  121  PFLAPAEEATISALKRALDVLNTHLASNTYLVGHSVTLADIVLVCNMYLGIRTVVTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWTL
Sbjct  181  SAFPHVERYFWTL  193



>ref|XP_002892012.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68271.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+H+   NK A KAL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALVAAEYAGVKIEEASDFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV++   DN L GSSLIEY H+EQW DFA+ EIDA+  KW  PRLGF 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHVEQWIDFASLEIDAHMLKWFAPRLGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>ref|XP_010511351.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=414

 Score =   291 bits (744),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK AFKAL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 ref|NP_001031202.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|Q9FVT2.1|EF1G2_ARATH RecName: Full=Probable elongation factor 1-gamma 2; Short=EF-1-gamma 
2; AltName: Full=eEF-1B gamma 2 [Arabidopsis thaliana]
 gb|AAG50755.1|AC079733_23 elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAK43879.1|AF370502_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL11623.1|AF424630_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL16277.1|AF428347_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL47343.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47351.1| At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAM62488.1| elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAN41373.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
 gb|AEE33455.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 gb|AEE33456.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=413

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+H+   NK A KALI AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNT+LVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLADIVTICNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
Length=413

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+H+   NK A KALI AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNT+LVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLADIVTICNLNLGFATVMTKEFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>ref|XP_004300001.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=420

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNA+K LI AEY GVKV L  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNAYKTLIAAEYTGVKVALAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL PR+G  
Sbjct  61   DGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLRPRMGRG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+L ALNT+LAS+TYLVGHSVTLADIVM CNL +GF  +MTKSFT
Sbjct  121  VYLPPAEEAAIAALKRALGALNTYLASSTYLVGHSVTLADIVMTCNLFMGFTRLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_011470423.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +1

Query  97   SF*SEAMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKV  276
            SF  +AMALVLH+ + NKNA+K LI A Y GV+V L  NF+MGVSNKTPEFLKMNPIGKV
Sbjct  54   SFFPQAMALVLHAGSTNKNAYKTLIAAGYTGVQVALAPNFEMGVSNKTPEFLKMNPIGKV  113

Query  277  PVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLY  456
            PVLETPDGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL 
Sbjct  114  PVLETPDGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLR  173

Query  457  PRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWI  636
            PR+G  +YLPPAEEAAIA+LKR+L ALNT+LAS+TYLVGHSVTLADIVM CNL +GF  +
Sbjct  174  PRMGRGVYLPPAEEAAIAALKRALGALNTYLASSTYLVGHSVTLADIVMTCNLFMGFTRL  233

Query  637  MTKSFTKEFPHVERYFWTL  693
            MTKSFT EFPHVERYFWT+
Sbjct  234  MTKSFTSEFPHVERYFWTM  252



>ref|XP_010470318.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=413

 Score =   288 bits (737),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK AFKAL+ AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PRLG+ 
Sbjct  61   EGAIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRLGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>ref|XP_006302321.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
 gb|EOA35219.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
Length=413

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK AFKALI  EY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALIAGEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV++   DN L GSSLIEY  IEQW DF+  EID++  KW  PR G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAQIEQWIDFSTLEIDSHMLKWFAPRAGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLADIV ICNL++GF  +MTK FT
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTM  193



>gb|EPS67955.1| elongation factor 1 gamma-like protein, partial [Genlisea aurea]
Length=422

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            +LHS  +NKN  KALI AEY GVKVEL K+F+MGVSNKTPEF+KMNPIGK+PVLETPDG 
Sbjct  1    ILHS-TQNKNTNKALIAAEYNGVKVELVKDFEMGVSNKTPEFIKMNPIGKIPVLETPDGA  59

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            IFESNAIARYVA+  P+  LFG++LI+Y HIEQW DF+  EIDAN   WL PR+G   Y 
Sbjct  60   IFESNAIARYVARSNPNTELFGANLIDYAHIEQWIDFSTNEIDANILSWLLPRVGRRPYF  119

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
            PPAEEA IA+LKR+L AL++HL SNTYLVGH VTLADI++ CNL+ GFK I+TKSFT EF
Sbjct  120  PPAEEATIAALKRALEALSSHLVSNTYLVGHGVTLADIILTCNLAFGFKNILTKSFTSEF  179

Query  664  PHVERYFWTL  693
            PHVERYFWTL
Sbjct  180  PHVERYFWTL  189



>ref|XP_004485430.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Cicer arietinum]
 ref|XP_004485431.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Cicer arietinum]
Length=420

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKNA+KALI AEY GV+VEL  +FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKGNKNAYKALIAAEYVGVQVELVPDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYVA+   D  LFGSSLI++ +++QW DF++ EID N  K   PRLG+ 
Sbjct  61   EGPVFESNAIARYVARSNGDKTLFGSSLIDHANVDQWIDFSSFEIDTNIMKLYLPRLGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YLPP EEA++ SLKR+  ALNTHLA+NTYLVGHSVTLADI+  CNL  GF  ++ KSFT
Sbjct  121  PYLPPVEEASLTSLKRAFEALNTHLATNTYLVGHSVTLADIITTCNLYYGFAKLLVKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>gb|AGC13144.1| EF1Bgamma class glutathione S-transferase [Pinus tabuliformis]
Length=421

 Score =   286 bits (731),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL LH+ + NKN FKA I AEY GVK+ L  NF MG SNK+PEFLKMNPIGK+PVLETP
Sbjct  1    MALTLHASSINKNGFKARITAEYAGVKLNLAPNFVMGESNKSPEFLKMNPIGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESN IARYVA++K DN LFGSSLI+Y H+EQW DF++ EIDAN  +W +PR+G  
Sbjct  61   EGAVFESNVIARYVARLKGDNTLFGSSLIDYAHVEQWIDFSSIEIDANVMRWYFPRIGSG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAI+ LK  L ALN++LA+NTYLVGHS+TLADI++ CNL  GF   MTK FT
Sbjct  121  VYLPPAEEAAISDLKIGLLALNSYLATNTYLVGHSITLADIIVTCNLYQGFTRCMTKDFT  180

Query  655  KEFPHVERYFWTL  693
            KEFPHVERYFWT+
Sbjct  181  KEFPHVERYFWTM  193



>ref|NP_001184949.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 dbj|BAH56947.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28473.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=265

 Score =   280 bits (717),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GV++++  +FQMGV+NKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSAEKALIAAEYVGVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  PAEE AI++LKR+L ALNTHL SNTYLVGHS+TLADI+ +CNL++GF  +MTK FT
Sbjct  121  PYSAPAEEGAISTLKRALDALNTHLTSNTYLVGHSITLADIITVCNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTV  193



>ref|XP_004308137.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ + NKNA+K LI A Y GV+V L  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNAYKTLIAAGYTGVQVALAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL PR+G  
Sbjct  61   DGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLRPRMGRG  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAAIA+LKR+L ALNT+LAS+TYLVGHSVTLADIVM CNL +GF  +MTKSFT
Sbjct  121  VYLPPAEEAAIAALKRALGALNTYLASSTYLVGHSVTLADIVMTCNLFMGFTRLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTM  193



>ref|XP_010544111.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=416

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK A KALI AEY GV++E+  +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGANKALIAAEYTGVQIEVPSDFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++K DN L GSSLIEY  IEQW DFA+ E+D N  +W  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRLKGDNSLVGSSLIEYAQIEQWIDFASMEVDVNILRWFIPRVGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +L P EEA IA+LKR+   LNTHL+SNTYLVGHS+TLADI ++CN+S G   +MTKSFT
Sbjct  121  PFLAPVEEATIAALKRAFDVLNTHLSSNTYLVGHSITLADIALVCNMSFGISTLMTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERY+WTL
Sbjct  181  SAFPHVERYYWTL  193



>emb|CDY22629.1| BnaC08g42630D [Brassica napus]
Length=415

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA KALI AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR L ALNTHL SNTYLVGHS+TLADI+ +CNL++GF  +MTKSFT
Sbjct  121  PYSAPGEEAAISALKRGLDALNTHLTSNTYLVGHSITLADIITVCNLNLGFATVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTV  193



>ref|XP_009118302.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA KALI AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR L ALNTHL SNTYLVGHS+TLADI+ +CNL++GF  +MTKSFT
Sbjct  121  PYSAPGEEAAISALKRGLDALNTHLTSNTYLVGHSITLADIITVCNLNLGFATVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTV  193



>emb|CDY20681.1| BnaC08g13770D [Brassica napus]
Length=558

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+HS   NKN+ KA I AE+ GVK+++   F+MGV+NKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTPEFLKMNPLGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  DN L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGDNSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR L ALNTHLASNTYLVGHSVTLADI+ +CNL++GF  +MTKSFT
Sbjct  121  PYSVPGEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIITVCNLNLGFSTVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWTL
Sbjct  181  SAFPHVERYFWTL  193



>gb|EMT01475.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=604

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  142  ENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  321
            E +   + LI AEY GV VEL K+FQMGVSN TP+FLKMNPIGKVPVLETPDGP+FESNA
Sbjct  191  ETRMRLRHLIAAEYSGVNVELVKDFQMGVSNHTPDFLKMNPIGKVPVLETPDGPVFESNA  250

Query  322  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  501
            IARYVA++K D+PL+GSSL+EY HIEQW DF+ TE+DAN  KWLYPRLGF  Y+   E+ 
Sbjct  251  IARYVARMKADSPLYGSSLMEYSHIEQWIDFSTTEVDANIGKWLYPRLGFYPYVAVIEDT  310

Query  502  AIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERY  681
             I +LKR+L AL+THLASNTYLVGHSV LADIVM CNL  GF  IMTKSFT EFPHVERY
Sbjct  311  FITALKRALGALDTHLASNTYLVGHSVILADIVMACNLYHGFTRIMTKSFTSEFPHVERY  370

Query  682  FWTL  693
            FWT+
Sbjct  371  FWTM  374



>ref|XP_002889762.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66021.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   281 bits (718),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVKIDVPSDFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYV+++  DN L GSSLIEY  +EQW+DFA+ EI  N  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQVEQWSDFASLEIYGNILRWFGPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  PAEE  I++LKR+L ALNTHLASNTYLVGH +TLADI+ +CNL++GF  +MTK FT
Sbjct  121  PYSAPAEEGTISALKRALDALNTHLASNTYLVGHCITLADIITVCNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTV  193



>emb|CDY31074.1| BnaA08g26240D [Brassica napus]
Length=412

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+HS   NKN+ KA I AE+ GVK+++   F+MGV+NKT EFLKMNP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTTEFLKMNPLGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  +N L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR L ALNTHLASNTYLVGHSVTLADI+ +CNL++GF  +MTKSFT
Sbjct  121  PYSVPGEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIITVCNLNLGFSTVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWTL
Sbjct  181  SAFPHVERYFWTL  193



>ref|XP_010490215.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKP-DNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DFA+ EI  NT +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFASLEIYGNTLRWFGPRMGF  120

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLADI+ +CNL++GF  +MTK F
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLADIITVCNLNLGFATVMTKKF  180

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  181  TSEFPHVERYFWTV  194



>ref|XP_007148576.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
 gb|ESW20570.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
Length=419

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKN +K+LI AEY GV++EL  NF+M V+ KTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATRRNKNVYKSLIAAEYSGVELELAPNFEMFVTTKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++  DN L+ S+ I+   I+QW DF++ EIDAN  K   PRLG+ 
Sbjct  61   DGPIFESNAIARYVARLNGDNALYLSTPIDNARIDQWIDFSSLEIDANILKVYIPRLGYT  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y PP EEAA ++LKR+L ALNTHLASNTYLVGHSVTLADI+MICNL +GF  I+ KSFT
Sbjct  121  PYFPPVEEAANSALKRALGALNTHLASNTYLVGHSVTLADIIMICNLYLGFTQILVKSFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  181  SEFPHVERYFWTL  193



>ref|XP_010458260.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKP-DNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DFA+ EI  NT +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFASLEIYGNTLRWFGPRMGF  120

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLADI+ +CNL++GF  +MTK F
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLADIITVCNLNLGFATVMTKKF  180

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  181  TSEFPHVERYFWTV  194



>ref|XP_009110814.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=412

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALV+HS   NKN+ KA I AE+ GVK+++   F+MGV+NKTPEFLK+NP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTPEFLKINPLGKIPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  +N L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR L ALNTHLASNTYLVGHSVTLADI+ +CNL++GF  ++TKSFT
Sbjct  121  PYSVPGEEAAISALKRGLEALNTHLASNTYLVGHSVTLADIITVCNLNLGFSTVLTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWTL
Sbjct  181  SAFPHVERYFWTL  193



>ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|O04487.1|EF1G1_ARATH RecName: Full=Probable elongation factor 1-gamma 1; Short=EF-1-gamma 
1; AltName: Full=eEF-1B gamma 1 [Arabidopsis thaliana]
 gb|AAB60721.1| Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 
come from this gene [Arabidopsis 
thaliana]
 dbj|BAH20206.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28472.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=414

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GV++++  +FQMGV+NKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSAEKALIAAEYVGVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G +FESNAIARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  PAEE AI++LKR+L ALNTHL SNTYLVGHS+TLADI+ +CNL++GF  +MTK FT
Sbjct  121  PYSAPAEEGAISTLKRALDALNTHLTSNTYLVGHSITLADIITVCNLNLGFATVMTKKFT  180

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWT+
Sbjct  181  SEFPHVERYFWTV  193



>emb|CDY06365.1| BnaA09g48380D [Brassica napus]
Length=413

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA KALI AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y    EEAAI++L+R L ALNTHL SNTYLVGHS+TLADI+ +CNL++GF  +MTKSFT
Sbjct  121  PYSALGEEAAISALERGLDALNTHLTSNTYLVGHSITLADIITVCNLNLGFATVMTKSFT  180

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  181  SAFPHVERYFWTV  193



>ref|XP_008452241.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=410

 Score =   278 bits (710),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY GVKV+L+ +F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAFKALIAAEYNGVKVDLSPDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID N +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDNNLSVILRPRFGYA  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y P  EE A A+LKRS  ALN++LASNT+LVGHSVTLADI++ CNL +GF +++TKSFT
Sbjct  120  VYHPGVEETANAALKRSFGALNSYLASNTFLVGHSVTLADIILTCNLYLGFTYLLTKSFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  180  SEFPHVERYFWTL  192



>ref|XP_003592901.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|ABE91935.1| Elongation factor 1, gamma chain; Glutathione S-transferase, 
C-terminal; Thioredoxin-like fold [Medicago truncatula]
 gb|AES63152.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   278 bits (710),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = +1

Query  118  ALVLHSPNE-NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            AL+LH+PN  NKN +K LI AEY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAAEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y PP EE AI+SLKR+L ALN+HLA NTYLVGHSVTLADI+   NL IGF  ++ KSFT
Sbjct  122  TYFPPVEENAISSLKRALEALNSHLAHNTYLVGHSVTLADIITTSNLYIGFAKLLVKSFT  181

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  182  SEFPHVERYFWTL  194



>gb|KEH34076.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   278 bits (710),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL+LH+   NKNA+K LI AEY G+KVEL  +FQMGVSNK+P+F+ MNPIGKVPVLETP
Sbjct  1    MALILHAQKGNKNAYKTLIAAEYSGIKVELAPDFQMGVSNKSPQFINMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNA+ARYVA++   N LFGSS I+  H+EQW DF++ EID N  K   PR GF 
Sbjct  61   DGPVFESNAMARYVARLGESN-LFGSSPIDQAHVEQWIDFSSMEIDDNIMKLYRPRRGFS  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             YL P EEAAI+SLKR+  ALNTHLA NTYLVGHSVTLADI+  CNL +GF  ++ KSFT
Sbjct  120  PYLAPVEEAAISSLKRAFEALNTHLAHNTYLVGHSVTLADIIAACNLYLGFAQLLVKSFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  180  SEFPHVERYFWTL  192



>ref|XP_006417552.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
 gb|ESQ35905.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
Length=413

 Score =   277 bits (709),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 161/193 (83%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYAGVKIDVP-DFEMGVTNKTPEFLKMNPIGKVPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  DN L GSSLIEY HIEQW+DF++ EI  N  KWL PRLG++
Sbjct  60   EGPIFESNAIARYVSRLNGDNSLNGSSLIEYAHIEQWSDFSSLEIYGNFWKWLGPRLGYM  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y    EEAAI++LKR+L ALNTHL SNTYLVGHS+TLADI+ +CNL++ F  IMTKSFT
Sbjct  120  PYNAQDEEAAISALKRALDALNTHLTSNTYLVGHSITLADIITVCNLNLAFSNIMTKSFT  179

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  180  SAFPHVERYFWTV  192



>ref|XP_011650572.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Cucumis sativus]
Length=390

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNA+KALI AEY GVKV+L+++F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSQDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             + P  EE A A+LKRS  ALN++LASNT+LVGHSVTLADI++ CNL +GF +I+TKSFT
Sbjct  120  AFHPGVEETADAALKRSFGALNSYLASNTFLVGHSVTLADIILTCNLYLGFNYILTKSFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  180  SEFPHVERYFWTL  192



>gb|AFK34308.1| unknown [Medicago truncatula]
Length=418

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 155/193 (80%), Gaps = 2/193 (1%)
 Frame = +1

Query  118  ALVLHSPNE-NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            AL+LH+PN  NKN +K LI  EY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAVEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y PP EE AI+SLKR+L ALN+HLA NTYLVGHSVTLADI+   NL IGF  ++ KSFT
Sbjct  122  TYFPPVEENAISSLKRALEALNSHLAHNTYLVGHSVTLADIITTSNLYIGFAKLLVKSFT  181

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  182  SEFPHVERYFWTL  194



>ref|XP_003592902.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|AES63153.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = +1

Query  118  ALVLHSPNE-NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            AL+LH+PN  NKN +K LI AEY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAAEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y PP +E AI+SLKR+L ALN+HLA NTYLVGHSVTLADI+   NL IGF  ++ KSFT
Sbjct  122  TYFPPVKENAISSLKRALEALNSHLAHNTYLVGHSVTLADIITTSNLYIGFAKLLVKSFT  181

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  182  SEFPHVERYFWTL  194



>gb|KGN56265.1| hypothetical protein Csa_3G110620 [Cucumis sativus]
Length=379

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNA+KALI AEY GVKV+L+++F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSQDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             + P  EE A A+LKRS  ALN++LASNT+LVGHSVTLADI++ CNL +GF +I+TKSFT
Sbjct  120  AFHPGVEETADAALKRSFGALNSYLASNTFLVGHSVTLADIILTCNLYLGFNYILTKSFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  180  SEFPHVERYFWTL  192



>ref|XP_010475804.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X1 [Camelina 
sativa]
Length=415

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKP-DNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLADI+ +CNL++GF  +MTK F
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLADIITVCNLNLGFATVMTKKF  180

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  181  TSEFPHVERYFWTV  194



>ref|XP_010475805.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X2 [Camelina 
sativa]
Length=435

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKP-DNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLADI+ +CNL++GF  +MTK F
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLADIITVCNLNLGFATVMTKKF  180

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  181  TSEFPHVERYFWTV  194



>emb|CBI39244.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+ N NKNAFKALI AEY GVKVEL KNF+MGVSNK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELVKNFEMGVSNKSPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GS+LIEY HIEQW DF + EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSTLIEYAHIEQWIDFGSLEIDANILRWFIPRIGFA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  591
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGHS+ L 
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHSLYLG  159



>gb|ACJ85171.1| unknown [Medicago truncatula]
Length=418

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 154/193 (80%), Gaps = 2/193 (1%)
 Frame = +1

Query  118  ALVLHSPNE-NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            AL+LH+PN  NKN +K LI  EY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLET 
Sbjct  3    ALILHAPNNGNKNVYKTLIAVEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETR  62

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y PP EE AI+SLKR+L ALN+HLA NTYLVGHSVTLADI+   NL IGF  ++ KSFT
Sbjct  122  TYFPPVEENAISSLKRALEALNSHLAHNTYLVGHSVTLADIITTSNLYIGFAKLLVKSFT  181

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  182  SEFPHVERYFWTL  194



>ref|XP_006307657.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
 gb|EOA40555.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
Length=415

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK+A KALI AEY GV++++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPD-NPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            +G +FESNAIARYV+++  + N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGEKNSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + Y   AEE  I++LKR+L ALNTHLASNTYLVGHS+TLADI+ +CNL++GF  +MTK F
Sbjct  121  MPYNASAEEGTISALKRALDALNTHLASNTYLVGHSITLADIITVCNLNLGFATVMTKKF  180

Query  652  TKEFPHVERYFWTL  693
            T EFPHVERYFWT+
Sbjct  181  TSEFPHVERYFWTV  194



>gb|KDO42760.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=387

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  220  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  399
            MGV+NKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVA++K DNPL GSSLI+  HIE
Sbjct  1    MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIE  60

Query  400  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  579
            QW DF++ EID N  +W  PR+GF +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHS
Sbjct  61   QWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHS  120

Query  580  VTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            VTLADI+M CNL++GF  I++KSFT EFPH+ERYFWT+
Sbjct  121  VTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTM  158



>ref|XP_004133719.2| PREDICTED: elongation factor 1-gamma [Cucumis sativus]
 gb|KGN56266.1| hypothetical protein Csa_3G110630 [Cucumis sativus]
Length=402

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 157/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   +KN +K LI AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAI RYVA++K D+ LFGSS I+YGH+EQW DF++ EID + +  L PR G+ 
Sbjct  61   DGPIFESNAITRYVARLK-DSILFGSSPIDYGHVEQWIDFSSLEIDIHISTILAPRFGYG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y  PAEEAA  +LKRS  AL+++LASNT+LVGHSVTLADIV+ CNL  GF +I+ KSFT
Sbjct  120  VYHAPAEEAANVALKRSFGALDSYLASNTFLVGHSVTLADIVLTCNLYYGFVYILPKSFT  179

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWTL
Sbjct  180  SAFPHVERYFWTL  192



>ref|XP_008365322.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Malus domestica]
Length=419

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 157/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKN +K LIVAEY GVKV L  NF++GV+NKTPE+LK+NPIGK P+L TP
Sbjct  1    MALVLHAGKTNKNGYKVLIVAEYSGVKV-LAPNFEIGVTNKTPEYLKLNPIGKYPLLITP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPIFESNAIARYVA++KPDNPL GSSLI+Y HIEQW DF + EIDAN   W  PR+G  
Sbjct  60   DGPIFESNAIARYVARLKPDNPLCGSSLIDYAHIEQWIDFGSMEIDANVLNWWLPRVGQR  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +YLPPAEEAA  +LKR+L ALNTHLASNT LVGHSVTLAD V  CNL  GF  I+ KSFT
Sbjct  120  VYLPPAEEAAXXALKRALGALNTHLASNTXLVGHSVTLADJVXGCNLYFGFTZILXKSFT  179

Query  655  KEFPHVERYFWTL  693
             EFPHVERYFWTL
Sbjct  180  SEFPHVERYFWTL  192



>emb|CDX93494.1| BnaA06g05540D [Brassica napus]
Length=413

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK A KALI AEY GVK+ +  +F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVKINVP-DFEMGVSNKTPEFLKMNPIGKVPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR+L ALNTHLAS T+LVGHS+TLADI+ +CNLS+G+  +MTKSFT
Sbjct  120  PYSVPGEEAAISALKRALDALNTHLASKTFLVGHSITLADIITVCNLSLGYTTVMTKSFT  179

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  180  SAFPHVERYFWTV  192



>ref|XP_009148264.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK A KALI AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVKIDVP-DFEMGVANKTPEFLKMNPIGKVPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR+L ALNTHLAS T+LVGHS+TLADI+ +CNLS+G+  +MTKSFT
Sbjct  120  PYSVPGEEAAISALKRALDALNTHLASKTFLVGHSITLADIITVCNLSLGYTTVMTKSFT  179

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  180  SAFPHVERYFWTV  192



>ref|XP_001758671.1| predicted protein [Physcomitrella patens]
 gb|EDQ76649.1| predicted protein [Physcomitrella patens]
 gb|AFZ39148.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  297
             LVLHSP  NKNA+K LI AEY GVKVE T +FQMGV+NKTPEFLK+NPIGKVPVL+TPD
Sbjct  3    GLVLHSPKVNKNAYKTLIAAEYVGVKVETTPDFQMGVTNKTPEFLKLNPIGKVPVLQTPD  62

Query  298  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  477
            GPIFESNA+ARYVA  K D  L GSS  E   +EQW DF++ E+DAN  +W+YPRLG+  
Sbjct  63   GPIFESNAMARYVAN-KKDVGLTGSSAYEKALVEQWIDFSSLEVDANIGRWVYPRLGYFA  121

Query  478  YLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTK  657
            ++   E  AI++LKR+LT LN HLAS TYLVG SVTLADIV+ CNL+  FK   TK FT 
Sbjct  122  FIEEVEAFAISNLKRALTCLNGHLASRTYLVGESVTLADIVLTCNLATLFKVAATKEFTS  181

Query  658  EFPHVERYFWTL  693
            E+PHVERYFWTL
Sbjct  182  EYPHVERYFWTL  193



>emb|CBI29689.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NKNA+K LI AEY G+KVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRIGRA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  591
            +YLPP EEAAIA+LKR+L ALNTHLASNT+LVGHS+ L 
Sbjct  121  VYLPPFEEAAIAALKRALGALNTHLASNTFLVGHSLYLG  159



>emb|CDY50887.1| BnaCnng19790D [Brassica napus]
Length=413

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLH+   NK A KALI AEY GV++ +  +F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVQINVP-DFEMGVSNKTPEFLKMNPIGKVPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y  P EEAAI++LKR+L ALNTHL S T+LVGHS+TLADI+ +CNLS+G+  +MTKSFT
Sbjct  120  PYSVPGEEAAISALKRALDALNTHLTSKTFLVGHSITLADIITVCNLSLGYTTVMTKSFT  179

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWT+
Sbjct  180  SAFPHVERYFWTV  192



>ref|XP_008789740.1| PREDICTED: elongation factor 1-gamma 1 isoform X2 [Phoenix dactylifera]
Length=384

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  220  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  399
            MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYV ++K +NPL+GSSLIEY  IE
Sbjct  1    MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVTRLKAENPLYGSSLIEYARIE  60

Query  400  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  579
            QW DFA+ EIDAN A+WL PRLGFV +   AEE AI +LKRSL ALNTHLA+NTYLVGHS
Sbjct  61   QWIDFASMEIDANIARWLLPRLGFVPFAAVAEEFAITALKRSLGALNTHLATNTYLVGHS  120

Query  580  VTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            VTLADI+  CNL +GF  IMTK+FT EFPHVERYFWT+
Sbjct  121  VTLADIITTCNLYMGFIRIMTKNFTSEFPHVERYFWTM  158



>ref|XP_008452240.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=409

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   +KN +K LI AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DG IFESNAI RYVA++K D+ L+GSS I+YGHIEQW DF++ EID++ +  L PR G+ 
Sbjct  61   DGAIFESNAITRYVARLK-DSGLYGSSPIDYGHIEQWIDFSSLEIDSHISTILAPRYGYG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
            +Y  PAEEAA A+LKRSL ALN++LASNT+LVGHSVTLADIV+ CNL  GF +I+ KSFT
Sbjct  120  VYYAPAEEAANAALKRSLGALNSYLASNTFLVGHSVTLADIVLTCNLYYGFTYILPKSFT  179

Query  655  KEFPHVERYFWTL  693
              FPHVERYFWTL
Sbjct  180  SAFPHVERYFWTL  192



>gb|KEH32761.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=384

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  220  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  399
            MGVSNKTP+FL MNP+GKVPVLETPDGP+FESNAIARYVA+   +N L+GSSLI+Y  IE
Sbjct  1    MGVSNKTPQFLDMNPLGKVPVLETPDGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIE  60

Query  400  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  579
            QW DF++ E+D+N  KWLYPRLG+ +YLPPAEE AI  LKR+L ALNTHLASNTYLVGHS
Sbjct  61   QWIDFSSLEVDSNINKWLYPRLGYGVYLPPAEEIAITGLKRALNALNTHLASNTYLVGHS  120

Query  580  VTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            VTLADI+  CNL +GF  +  KSF+ EFPHVERYFWTL
Sbjct  121  VTLADIITTCNLYVGFTRLFVKSFSSEFPHVERYFWTL  158



>gb|AFW76480.1| elongation factor gamma1 [Zea mays]
Length=382

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  220  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  399
            MGVSNKTPEFLKMNP+GKVPVLETPDGP+FESNAIARYVA++K DNPLFGSS IE  H+E
Sbjct  1    MGVSNKTPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVE  60

Query  400  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  579
            QW DFAATE+D   A +LYPRLG++ Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+
Sbjct  61   QWMDFAATEVDPGVAWYLYPRLGYLPYVSTTEETAISSLKRSLGALNTHLASNTYLVGHA  120

Query  580  VTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            VTLADIVM CNL  G   I+TK+FT +FPHVERYFWT+
Sbjct  121  VTLADIVMTCNLYHGIARILTKTFTSDFPHVERYFWTM  158



>ref|XP_001771013.1| predicted protein [Physcomitrella patens]
 gb|EDQ64168.1| predicted protein [Physcomitrella patens]
 gb|AFZ39147.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=431

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  297
             LV+HS   NKN++K+LI AEY GVKVE+  +FQMGV+NK+PEFLKMNPIGKVPVL+TP+
Sbjct  3    GLVIHSQKVNKNSYKSLIAAEYVGVKVEIVPDFQMGVTNKSPEFLKMNPIGKVPVLQTPE  62

Query  298  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  477
            GPIFESNA+ARYVA  K D  L GSS  E   +EQW DFA  EID N   W+YPRLGF +
Sbjct  63   GPIFESNAMARYVAN-KKDVGLVGSSAYEKALVEQWIDFATMEIDVNAGGWVYPRLGFGL  121

Query  478  YLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTK  657
            Y    E + I++LKR+LT LN HLAS TYLVG S+TLADIV+ CN+ +  K   TK FT 
Sbjct  122  YNEEVEASKISNLKRALTFLNAHLASRTYLVGESITLADIVLTCNMIVLVKLAATKEFTS  181

Query  658  EFPHVERYFWTL  693
            EFPHVERYFWTL
Sbjct  182  EFPHVERYFWTL  193



>gb|AFW87006.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
 gb|AFW87007.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
Length=382

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +1

Query  220  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  399
            MGVSNKTPEFLKMNP+GKVPVLETPDGP+FESNAIARYVA++K DNPLFGSS IE  H+E
Sbjct  1    MGVSNKTPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVE  60

Query  400  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  579
            QW DFAATE+D     +LYPRLG++ Y    EE AIASLKRSL ALNTHLA NTYLVGHS
Sbjct  61   QWMDFAATEVDPGVGWYLYPRLGYIPYAHTTEETAIASLKRSLGALNTHLALNTYLVGHS  120

Query  580  VTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            VTLADIV+ CNL  G   I+TKSFT +FPHVERYFWT+
Sbjct  121  VTLADIVLTCNLYHGIARILTKSFTSDFPHVERYFWTM  158



>ref|XP_002984514.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
 gb|EFJ14564.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
Length=430

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +1

Query  118  ALVLH-SPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
             LVLH +   NKNA K LIVAE  GVKV+L  +F+MGVSNKTPEFLK+NP+GKVPVLETP
Sbjct  3    GLVLHVNAGINKNAHKVLIVAEIVGVKVDLVPDFEMGVSNKTPEFLKLNPLGKVPVLETP  62

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGPI ESNAIARYVA +K    L GS+L +   ++QW DFA TE+D +  +WLYPR G++
Sbjct  63   DGPISESNAIARYVANLK--GKLTGSTLYQTALVDQWIDFATTEVDTSLGRWLYPRFGYL  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFK-WIMTKSF  651
             Y P  EE AI ++KR+  ALN++LAS TYLVGH VTLAD++ ICNL+ GF+  + ++ F
Sbjct  121  PYAPEVEEHAIEAIKRAFGALNSYLASRTYLVGHFVTLADVITICNLTWGFRSGVFSEEF  180

Query  652  TKEFPHVERYFWTL  693
               FPHVERYFWT+
Sbjct  181  MAPFPHVERYFWTV  194



>ref|XP_002973046.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
 gb|EFJ26267.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
Length=418

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            NKNA K LIVAE  GVKV+L  +F+MGVSNKTPEFLK+NP+GKVPVLETPDGPI ESNAI
Sbjct  1    NKNAHKVLIVAEIVGVKVDLVPDFEMGVSNKTPEFLKLNPLGKVPVLETPDGPISESNAI  60

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYVA +K    L GS++ +   ++QW DFA TE+D +  +WLYPR G++ Y P  EE A
Sbjct  61   ARYVANLK--GKLTGSTVYQTALVDQWIDFATTEVDTSLGRWLYPRFGYLPYAPEVEEHA  118

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFK-WIMTKSFTKEFPHVERY  681
            I ++KR+  ALN++LAS TYLVGH VTLAD++ ICNL+ GF+  + ++ F   FPHVERY
Sbjct  119  IEAIKRAFGALNSYLASRTYLVGHFVTLADVITICNLTWGFRSGVFSEEFMAPFPHVERY  178

Query  682  FWTL  693
            FWT+
Sbjct  179  FWTV  182



>ref|XP_001774148.1| predicted protein [Physcomitrella patens]
 gb|EDQ61062.1| predicted protein [Physcomitrella patens]
 gb|AFZ39149.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 133/192 (69%), Gaps = 2/192 (1%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  297
             L L++   NKNA+KALI AEY GVK+E T+      + K+P++L MNP+GKVPVLETP+
Sbjct  3    GLKLYANPVNKNAYKALIAAEYVGVKIEFTEITDWSTT-KSPQYLAMNPMGKVPVLETPE  61

Query  298  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  477
            G IFESNAIARYVA +K D  L G        I+QW DFAA EID N   W+ P LG   
Sbjct  62   GSIFESNAIARYVAGLK-DVGLLGVPGYNKAQIDQWIDFAALEIDINARAWVLPHLGLGF  120

Query  478  YLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTK  657
            +    E   I +LKR+LT LN++LAS TYLVG SVTLADIV+ICNLS  ++   TK FT 
Sbjct  121  FNEEVEAFIINNLKRALTTLNSYLASRTYLVGESVTLADIVLICNLSFIWRRAATKEFTA  180

Query  658  EFPHVERYFWTL  693
            E+PHVERYFWTL
Sbjct  181  EYPHVERYFWTL  192



>gb|AFW76477.1| elongation factor gamma1 [Zea mays]
Length=291

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MALVLHS   NKNAFKALI AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYP+   V
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPK---V  117

Query  475  IYLPPAEEAAIASLKRSLTAL  537
            +  P  EEA     K  L  L
Sbjct  118  VEAPAEEEAPKPKPKNPLDLL  138



>ref|XP_005645852.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE21308.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
Length=441

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = +1

Query  121  LVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  300
            L L++   NKNA+KA I AEY GVK+++   F+MG +NK+P+FLK+NP GKVP L+TP+G
Sbjct  4    LRLYTFPGNKNAWKAQIAAEYVGVKLDVPA-FEMGKTNKSPQFLKLNPNGKVPTLQTPEG  62

Query  301  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
             I+ESNAIARYVA++  D  LFG++  +   +EQW +FA  E+DA  A W YP  G++ Y
Sbjct  63   GIWESNAIARYVARLA-DKGLFGATAYDAALVEQWIEFATGELDAPLASWYYPIAGYMEY  121

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
                EEAAIA++K+SL  LN +LA++T+LVG+SVTLADIV   NL  G+  +  ++F K+
Sbjct  122  NKKKEEAAIATVKKSLGVLNEYLATHTFLVGNSVTLADIVGAANLYHGYTKLFDEAFRKD  181

Query  661  FPHVERYFWTL  693
            FP+V+R+F TL
Sbjct  182  FPNVQRWFLTL  192



>ref|XP_008867564.1| hypothetical protein H310_04829 [Aphanomyces invadans]
 gb|ETW03335.1| hypothetical protein H310_04829 [Aphanomyces invadans]
Length=418

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 122/193 (63%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M+  L  P  +  AFK LI AEY GV +E+ ++FQMGV NK+ EFLK+NP+GKVPVL+TP
Sbjct  1    MSYKLFVPQGSSRAFKILIAAEYNGVNLEIPEHFQMGVDNKSAEFLKLNPLGKVPVLQTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARYVA+++ D  L G +  E G ++QW DF A E++      LYP  G+ 
Sbjct  61   EGPIFESNAIARYVARIRADTGLLGKTFYESGQVDQWVDFVANELEVPLNALLYPIFGYR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +    E+ AI   K+ L  L  HL   TY VG  +TLADI +   L   FK+ + K F 
Sbjct  121  KWEAELEKKAIEDTKKVLQILENHLLLRTYFVGEQITLADISVFGALIYAFKFALDKDFR  180

Query  655  KEFPHVERYFWTL  693
            K + ++ R+F T+
Sbjct  181  KPYSNLLRWFTTV  193



>ref|XP_008605170.1| hypothetical protein SDRG_01423 [Saprolegnia diclina VS20]
 gb|EQC41456.1| hypothetical protein SDRG_01423 [Saprolegnia diclina VS20]
Length=416

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 118/193 (61%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MA  L++P     AFK LI AEY GV + + + F MGV NKTPEFL +NP+GKVPVL TP
Sbjct  1    MAYTLYAPQAGSRAFKILIAAEYNGVDLNVPETFVMGVDNKTPEFLALNPLGKVPVLATP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPI+ESNAIARYVA+++ D  L G +  E G ++QW DF   E++      LYP  G+ 
Sbjct  61   EGPIYESNAIARYVARLRADTGLTGKTFYESGQVDQWVDFVTNEMETPLGALLYPIFGYA  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y       A+  +K+SL  L  HL   TY VG  VTLADI +   L   FK+I  K F 
Sbjct  121  KYNHDVHTKALEDIKKSLHILENHLLLRTYFVGEQVTLADICVFGALIYPFKFIFDKDFR  180

Query  655  KEFPHVERYFWTL  693
            K F ++ R+F T+
Sbjct  181  KPFSNLSRWFSTV  193



>gb|AAL87298.1| unknown protein [Arabidopsis thaliana]
Length=345

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  322  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  501
            IARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+ Y  PAEE 
Sbjct  1    IARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFMPYSAPAEEG  60

Query  502  AIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERY  681
            AI++LKR+L ALNTHL SNTYLVGHS+TLADI+ +CNL++GF  +MTK FT EFPHVERY
Sbjct  61   AISTLKRALDALNTHLTSNTYLVGHSITLADIITVCNLNLGFATVMTKKFTSEFPHVERY  120

Query  682  FWTL  693
            FWT+
Sbjct  121  FWTV  124



>ref|XP_006392372.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29658.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=350

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  334  VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIAS  513
            V+++  +N L GSSLI+Y HIEQW DFA  EIDAN  +W  PR+GF  +  PAEEAAIA 
Sbjct  10   VSRLNGENSLNGSSLIDYAHIEQWIDFATLEIDANMLRWFAPRMGFAPFSAPAEEAAIAG  69

Query  514  LKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            L R L ALNTHLASNTYLVGHSVTLADIV ICNL++GF  +MTKSFT  FPHVERYFWT+
Sbjct  70   LNRGLDALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKSFTSAFPHVERYFWTM  129



>ref|XP_009825362.1| hypothetical protein H257_03107 [Aphanomyces astaci]
 gb|ETV85344.1| hypothetical protein H257_03107 [Aphanomyces astaci]
Length=419

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 118/193 (61%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MA  L  P     AFK  I AEY GV +E+ + F MGV NK+ EFLK+NP+GKVPVL+TP
Sbjct  1    MAYKLFVPQGGARAFKIFIAAEYSGVNLEIPETFVMGVDNKSAEFLKLNPLGKVPVLQTP  60

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +GPIFESNAIARY+A+++ DN L G +  E G ++QW DF + E++      LYP  G+ 
Sbjct  61   EGPIFESNAIARYIARIRADNGLLGKTFYESGQVDQWVDFVSNELELPLNALLYPIFGYR  120

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +    E  AI   K+ L  L  HL   TY VG  +TLADI +   L   FK+ + K F 
Sbjct  121  KWEAALEAKAIEDTKKVLQILENHLLLRTYFVGEQITLADIAVFGALIYAFKFALDKDFR  180

Query  655  KEFPHVERYFWTL  693
            K + ++ R+F T+
Sbjct  181  KPYSNLLRWFTTV  193



>gb|ABB02642.1| unknown [Solanum tuberosum]
Length=144

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +1

Query  340  KVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLK  519
             +KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+ +Y+P AEEA +A+LK
Sbjct  16   NLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGYRVYIPAAEEAVVAALK  75

Query  520  RSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFP  666
            RSL ALNTHL+ NTYLVGH +TLADI+M CNLSIGF+ IMTKSFTKEFP
Sbjct  76   RSLGALNTHLSCNTYLVGHLITLADIIMGCNLSIGFRMIMTKSFTKEFP  124



>gb|ETO78833.1| hypothetical protein F444_06337, partial [Phytophthora parasitica 
P1976]
Length=190

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 113/189 (60%), Gaps = 1/189 (1%)
 Frame = +1

Query  127  LHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  306
            L++   N   FK LI AEY GV +EL + F      K+ EF    PIGKVP+LET +G +
Sbjct  3    LYTYPGNYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTL  61

Query  307  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  486
            FES AIARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +  
Sbjct  62   FESGAIARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNA  121

Query  487  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFP  666
             A   A A +K++L  L  HL   TYLVG  VTLADIV+   L   FK+++ K F K + 
Sbjct  122  AALTKAKADVKKALQTLENHLHLRTYLVGEQVTLADIVVASALVYPFKFVLDKEFRKPYS  181

Query  667  HVERYFWTL  693
             V R+F TL
Sbjct  182  AVNRWFSTL  190



>ref|XP_009040775.1| hypothetical protein AURANDRAFT_70385 [Aureococcus anophagefferens]
 gb|EGB04522.1| hypothetical protein AURANDRAFT_70385 [Aureococcus anophagefferens]
Length=421

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 118/190 (62%), Gaps = 1/190 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M L L++   N  AFKAL+ AEY GV +++  +F M  + KTP FL M+P+GKVPVL+TP
Sbjct  1    MTLQLYTYPGNFRAFKALVAAEYVGVDIDVP-DFDMEKTAKTPSFLAMSPMGKVPVLKTP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
             G IFESNAIARYVA+++ D+ ++G +  E   I+ W DF A E++     W+YP +G++
Sbjct  60   QGAIFESNAIARYVARLRKDSEIYGRTFYESALIDSWVDFCAHELELPCTMWVYPIIGYM  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   A   A   +  +L +L  HL   TY+VG ++TLADI ++  L    K  M K F 
Sbjct  120  PFNAAASAKAKEHVTDALDSLERHLVDKTYIVGDAITLADITLVSALVYPAKLAMDKLFR  179

Query  655  KEFPHVERYF  684
              FP+V R+F
Sbjct  180  ARFPNVFRWF  189



>dbj|GAN05559.1| hypothetical protein MAM1_0095c05030 [Mucor ambiguus]
Length=275

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 113/184 (61%), Gaps = 2/184 (1%)
 Frame = +1

Query  142  ENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  321
            +N    KA I AE  GV+  + + F +   + TPEFL   P+GK+PV E+ +  +FES++
Sbjct  12   QNPRVAKAQIAAELSGVEFNV-EAFDLA-KDATPEFLAKFPLGKIPVFESSEVNLFESSS  69

Query  322  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  501
            IA Y A  K +NPL G++ +E   + QWT F   EI  N   W+YP LG+  Y+ P  +A
Sbjct  70   IAYYAAAQKENNPLLGATAVEKAEVFQWTLFGENEIVTNLGGWVYPLLGYGPYMKPNVDA  129

Query  502  AIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERY  681
            A   LKR+LTALN  L S TYLVGH VT ADI ++C L +GF  +  K+F  +F +V RY
Sbjct  130  ATDKLKRALTALNKVLESKTYLVGHQVTFADISVVCGLVLGFTTVFDKAFRSQFKNVTRY  189

Query  682  FWTL  693
            F T+
Sbjct  190  FTTI  193



>ref|XP_009519315.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
 gb|ACH68459.1| calcium-dependent protein 1 [Phytophthora sojae]
 gb|EGZ24027.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
Length=405

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 114/193 (59%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M   L++   N   FK LI AEY GV +EL + F M    K+ EF    P+GKVP+LET 
Sbjct  1    MVFKLYTYPANYRVFKVLIAAEYNGVDIELPE-FDMATDLKSEEFQSKTPVGKVPILETE  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFES AIA+YVA+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGTIFESGAIAKYVARLRNDTGLYGKTFFESGQVDSWIDFSAYELEIPLQAWLYPILGWA  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y   A   A A +K++L  L  HL   TYLVG  +TLADI +   L   FK+++ K F 
Sbjct  120  KYNAEALTKAKADVKKALQTLENHLHLRTYLVGEQITLADIFIATALVYPFKFVLDKEFR  179

Query  655  KEFPHVERYFWTL  693
            K +  V R+F TL
Sbjct  180  KPYSAVNRWFATL  192



>gb|EFA79702.1| glutathione S-transferase domain-containing protein [Polysphondylium 
pallidum PN500]
Length=432

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 119/192 (62%), Gaps = 2/192 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M+  +++  +N  A KALI A+Y GV +++   F+    NK  E L  NP GKVP   TP
Sbjct  1    MSTTIYTYPQNPRAAKALIAAKYTGVTIDVPA-FEFSPVNKPVELLNANPFGKVPAAMTP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
             GP+FESN+IARYVA+    + ++GS   E   I+QW DFA  E+++  A WLYP +GFV
Sbjct  60   QGPLFESNSIARYVARAA-GSKIYGSDAYEASVIDQWLDFATNEVESAAAAWLYPIMGFV  118

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +     + A  +LK++LT LNTHL S ++LVG  V+LADIV+ C+L   +  +   SF 
Sbjct  119  PFNAKDTQKAKENLKKTLTTLNTHLQSRSFLVGPRVSLADIVLACSLKSFYTMVFDPSFR  178

Query  655  KEFPHVERYFWT  690
              FP+V R+F T
Sbjct  179  STFPNVNRWFVT  190



>ref|XP_008891716.1| hypothetical protein PPTG_02396 [Phytophthora parasitica INRA-310]
 gb|ETN22467.1| hypothetical protein PPTG_02396 [Phytophthora parasitica INRA-310]
Length=229

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 113/189 (60%), Gaps = 1/189 (1%)
 Frame = +1

Query  127  LHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  306
            L++   N   FK LI AEY GV +EL + F      K+ EF    PIGKVP+LET +G +
Sbjct  3    LYTYPGNYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTL  61

Query  307  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  486
            FES AIARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +  
Sbjct  62   FESGAIARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNA  121

Query  487  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFP  666
             A   A A +K++L  L  HL   TYLVG  VTLADIV+   L   FK+++ K F K + 
Sbjct  122  AALTKAKADVKKALQTLENHLHLRTYLVGEQVTLADIVVASALVYPFKFVLDKEFRKPYS  181

Query  667  HVERYFWTL  693
             V R+F TL
Sbjct  182  AVNRWFSTL  190



>ref|XP_004353907.1| glutathione S-transferase domain-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG14498.1| glutathione S-transferase domain-containing protein [Dictyostelium 
fasciculatum]
Length=412

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 124/192 (65%), Gaps = 3/192 (2%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M++ ++S  +N   +KALI A+Y GV++E+   F     +K+ EFLK+ P GKVPV+ T 
Sbjct  1    MSMKIYSYPQNPRVYKALIAAKYVGVEIEVPA-FDFQKDSKSAEFLKVAPHGKVPVMVTE  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
             G IFESN+IARYVA++     ++GS   E   I+QW DFA  E++A+   WLYP +GFV
Sbjct  60   KGSIFESNSIARYVARL--GGKIYGSDAYEASVIDQWLDFATNEVEASAVAWLYPIMGFV  117

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             + P A + A  ++KR LT L+ HL ++++LVG  V+LADIV+ C+LS  +  +   SF 
Sbjct  118  KFNPEATQKAKENVKRLLTTLDNHLKTSSFLVGPRVSLADIVVACSLSTFYTMVFDPSFR  177

Query  655  KEFPHVERYFWT  690
              F +V R+F T
Sbjct  178  SPFVNVNRWFTT  189



>gb|KDO40981.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40982.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=316

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  424  EIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVM  603
            EIDAN ++W+YPRLG++ Y+PPAEE A+A+LKR+L ALN HLASNTYLVGHSVTLADIVM
Sbjct  2    EIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVM  61

Query  604  ICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            ICNL  GFK IMTKSFT EFPHVERYFWT+
Sbjct  62   ICNLYYGFKLIMTKSFTSEFPHVERYFWTV  91



>gb|KDO34814.1| hypothetical protein SPRG_00875 [Saprolegnia parasitica CBS 223.65]
Length=404

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 109/193 (56%), Gaps = 11/193 (6%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MA  L++P     AFK LI AEY GV + + + F MGV NKTPEFL +NP+GKVP     
Sbjct  1    MAYTLYAPQAGSRAFKILIAAEYNGVDLNVPEKFVMGVDNKTPEFLALNPLGKVP-----  55

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
                  SNAIARYVA+++ D  L G +  E G ++QW DF   E++   A  LYP  G+ 
Sbjct  56   ------SNAIARYVARLRADTGLTGKTFYESGQVDQWVDFVTNEMETPLAALLYPIFGYA  109

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y       AI  LK+SL  L  HL   TY VG  VTLADI +   L   FK+I  K F 
Sbjct  110  KYNHDVHTKAIEDLKKSLHILENHLLLRTYFVGEQVTLADICVFGALLYPFKFICDKDFR  169

Query  655  KEFPHVERYFWTL  693
            K F ++ R+F T+
Sbjct  170  KPFSNLSRWFSTV  182



>ref|XP_009519320.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
 gb|EGZ24032.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
Length=451

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 121/212 (57%), Gaps = 6/212 (3%)
 Frame = +1

Query  58   SQNK*LWWENCVGSF*SEAMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNK  237
            SQ K L    CV     +A    L++   N   FK LI AEY G+ +EL K F M    K
Sbjct  33   SQAKMLLTSICV-----DAAEQKLYTYPGNYRVFKVLIAAEYNGIHIELPK-FDMAKDLK  86

Query  238  TPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFA  417
            T  F    P+GKVPVLET +G IFES AIARY+A+++PD  L+G +  E G ++ W DF+
Sbjct  87   TKSFKAKTPVGKVPVLETKEGTIFESGAIARYIARLRPDTGLYGKTFFESGQVDSWIDFS  146

Query  418  ATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADI  597
            A E++     W++P LG   +   A   A A +K++L  L  HL   TYLVG  +TLADI
Sbjct  147  AYELEVPLEVWVHPILGVGKFNAAALTKAKADVKKALQTLENHLHLRTYLVGEQITLADI  206

Query  598  VMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            V+   L   FK+++ K F K +  V R+F TL
Sbjct  207  VVASALVYPFKFVLDKEFRKPYTAVNRWFATL  238



>ref|XP_009041108.1| hypothetical protein AURANDRAFT_39051 [Aureococcus anophagefferens]
 gb|EGB04257.1| hypothetical protein AURANDRAFT_39051 [Aureococcus anophagefferens]
Length=411

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 118/190 (62%), Gaps = 1/190 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M L L++   N  AFKAL+ AEY GV +++  +F M  + KTP FL M+P+GKVPVL+TP
Sbjct  1    MTLQLYTYPGNFRAFKALVAAEYVGVDIDVP-DFDMEKTAKTPSFLAMSPMGKVPVLKTP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
             G IFESNAIARYVA+++ D+ ++G +  E   I+ W DF A E++     W+YP +G++
Sbjct  60   QGAIFESNAIARYVARLRKDSEIYGRTFYESALIDSWVDFCAHELELPCTMWVYPIIGYM  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   A   A   +  +L +L  HL   TY+VG ++TLADI ++  L    K  M K F 
Sbjct  120  PFNAAAFAKAKEHVSDALDSLERHLVDKTYIVGDAITLADITLVSALVYPAKLAMDKLFR  179

Query  655  KEFPHVERYF  684
              FP+V R+F
Sbjct  180  ARFPNVFRWF  189



>gb|ETK89985.1| hypothetical protein L915_06155, partial [Phytophthora parasitica]
 gb|ETP47804.1| hypothetical protein F442_06322, partial [Phytophthora parasitica 
P10297]
Length=192

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 113/193 (59%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M L L++   N   FKALI AE+ G+ VEL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   A   A   +K++L  L  HL   TYLVG  +TLADI +   L   FK+++ K F 
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLADIFIASALVYPFKFVLDKEFR  179

Query  655  KEFPHVERYFWTL  693
            K +  V R+F TL
Sbjct  180  KPYSAVNRWFSTL  192



>emb|CBJ27519.1| eukaryotic elongation factor-1 B gamma [Ectocarpus siliculosus]
Length=420

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 115/192 (60%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL L +   N  AFK LI AEY GV++E+ + F     +K+P+FL  +P+G+VPVLETP
Sbjct  1    MALKLWTNPANFRAFKVLIAAEYNGVELEVPE-FNHPSDSKSPDFLAKSPLGRVPVLETP  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
             G IFESNAIARYVA+++ D  L+G S  E   ++ W DF A EI+     W YP +G++
Sbjct  60   QGSIFESNAIARYVARMRRDTELYGVSFFESAQVDSWIDFCAHEIELPATIWCYPVIGYM  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y   A   A   LK +L AL   L   TYLVG  +TLADI +   L    K +++  + 
Sbjct  120  PYNDAAVSKAKEDLKIALGALEKALLHRTYLVGDKITLADITVASALVYPMKLVVSPEYR  179

Query  655  KEFPHVERYFWT  690
            K FP V R+F T
Sbjct  180  KAFPCVTRWFTT  191



>emb|CCA15330.1| calciumdependent protein 1 putative [Albugo laibachii Nc14]
Length=422

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 118/194 (61%), Gaps = 2/194 (1%)
 Frame = +1

Query  112  AMALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  291
            A  + L+S   N   FK LI AEY GV +E+ + F M  + K+ EFL  NP+GKVPVLET
Sbjct  13   ASKMKLYSYPGNYRVFKILIAAEYNGVDIEVPE-FDM-TTIKSKEFLAKNPLGKVPVLET  70

Query  292  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
             +G +FESNAIARYVA+++ D+ L G +  E G ++ W DF+A E++     WLYP  G+
Sbjct  71   ENGSLFESNAIARYVARLRADSGLSGRTFFESGQVDSWMDFSAHELEVPLQMWLYPVFGY  130

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + +    +  A+  +K++L  L  HL   TYLVG  +TLADIV+   L    K +M K F
Sbjct  131  MKFNAGTKAKAMEDVKKALQVLENHLHLRTYLVGEQITLADIVIASLLVYPMKMLMDKEF  190

Query  652  TKEFPHVERYFWTL  693
             K +  V R+F TL
Sbjct  191  RKPYSAVNRWFNTL  204



>ref|XP_002901767.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57157.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=406

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 115/193 (60%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M L L++   N  AFKALI AE+ GV +EL + F      KT EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRAFKALIAAEFNGVDIELPE-FDFAKDVKTKEFKAKTPAGKVPLLETD  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFES AIA+YVA+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYVARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   A   A A +K++L  L  HL   TYLVG  +TLADI +   L   FK+++ K F 
Sbjct  120  QFNAAALTKAKADVKKALQTLENHLHLRTYLVGEQITLADIFIASALVYPFKFVLDKEFR  179

Query  655  KEFPHVERYFWTL  693
            K +  V R+F TL
Sbjct  180  KPYSAVNRWFSTL  192



>gb|KHN39680.1| Elongation factor 1-gamma [Glycine soja]
Length=331

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  388  GHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYL  567
             HI+QW DF++ EIDAN  K   PRLGF  YLPP EE A ++LKR+  ALNTHLASNTYL
Sbjct  4    AHIDQWIDFSSLEIDANIMKLYLPRLGFAPYLPPVEEGANSALKRAFEALNTHLASNTYL  63

Query  568  VGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            VGHSVTLADI+  CNL +GF  ++ KSFT EFPHVERYFWTL
Sbjct  64   VGHSVTLADIITTCNLYLGFSQLLVKSFTSEFPHVERYFWTL  105



>gb|ETL96579.1| hypothetical protein L917_05965, partial [Phytophthora parasitica]
Length=350

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 110/183 (60%), Gaps = 1/183 (1%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            N   FK LI AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  127

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYF  684
             A +K++L  L  HL   TYLVG  VTLADIV+   L   FK+++ K F K +  V R+F
Sbjct  128  KADVKKALQTLENHLHLRTYLVGEQVTLADIVVASALVYPFKFVLDKEFRKPYSAVNRWF  187

Query  685  WTL  693
             TL
Sbjct  188  STL  190



>gb|ETM49723.1| hypothetical protein L914_06088, partial [Phytophthora parasitica]
Length=215

 Score =   150 bits (378),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 113/193 (59%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M L L++   N   FKALI AE+ G+ VEL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   A   A   +K++L  L  HL   TYLVG  +TLADI +   L   FK+++ K F 
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLADIFIASALVYPFKFVLDKEFR  179

Query  655  KEFPHVERYFWTL  693
            K +  V R+F TL
Sbjct  180  KPYSAVNRWFSTL  192



>gb|ETP19871.1| hypothetical protein F441_06281 [Phytophthora parasitica CJ01A1]
Length=407

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 110/183 (60%), Gaps = 1/183 (1%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            N   FK LI AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  12   NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  70

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  71   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  130

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYF  684
             A +K++L  L  HL   TYLVG  VTLADIV+   L   FK+++ K F K +  V R+F
Sbjct  131  KADVKKALQTLENHLHLRTYLVGEQVTLADIVVASALVYPFKFVLDKEFRKPYSAVNRWF  190

Query  685  WTL  693
             TL
Sbjct  191  STL  193



>gb|ETK89994.1| hypothetical protein L915_06152 [Phytophthora parasitica]
 gb|ETL43394.1| hypothetical protein L916_06088 [Phytophthora parasitica]
Length=404

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 110/183 (60%), Gaps = 1/183 (1%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            N   FK LI AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  127

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYF  684
             A +K++L  L  HL   TYLVG  VTLADIV+   L   FK+++ K F K +  V R+F
Sbjct  128  KADVKKALQTLENHLHLRTYLVGEQVTLADIVVASALVYPFKFVLDKEFRKPYSAVNRWF  187

Query  685  WTL  693
             TL
Sbjct  188  STL  190



>emb|CBK21757.2| unnamed protein product [Blastocystis hominis]
Length=392

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 112/176 (64%), Gaps = 13/176 (7%)
 Frame = +1

Query  163  ALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAK  342
            ALI A+Y  V + + K F+MGV NK+ EFLKMNP GKVPVL+TP+G IFES AIARYVA+
Sbjct  3    ALIAAQYNNVYIHVPK-FEMGVENKSEEFLKMNPNGKVPVLKTPEGAIFESTAIARYVAR  61

Query  343  VKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKR  522
            ++ D  L G +  E G ++QW D+ AT I           +GF    P   E +  +LKR
Sbjct  62   MRNDTGLLGRTFFEEGKVDQWIDW-ATFI-----------MGFAPPNPKMVEQSKEALKR  109

Query  523  SLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWT  690
             L ALNT+LAS+T+L G  +TLADIV++C L  G K++    +   +P V R+F T
Sbjct  110  PLAALNTYLASHTFLAGERITLADIVVVCQLLYGMKFLFAPEYRAPYPSVMRWFET  165



>gb|ETL96570.1| hypothetical protein L917_05968, partial [Phytophthora parasitica]
Length=267

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 113/193 (59%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M L L++   N   FKALI AE+ G+ +EL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDIELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   A   A   +K++L  L  HL   TYLVG  +TLADI +   L   FK+++ K F 
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLADIFIASALVYPFKFVLDKEFR  179

Query  655  KEFPHVERYFWTL  693
            K +  V R+F TL
Sbjct  180  KPYSAVNRWFSTL  192



>emb|CCI44608.1| unnamed protein product [Albugo candida]
Length=407

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 112/183 (61%), Gaps = 2/183 (1%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            N   FK LI AEY G+ +E+ + F M  + K+ EFL  NP+GKVPVLET +G +FESNAI
Sbjct  9    NYRVFKILIAAEYNGIDIEVPE-FDM-TTIKSKEFLAKNPLGKVPVLETENGALFESNAI  66

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYVA+++ D  L+G +  E G ++ W DF+A E++     WLYP  G++ +    +  A
Sbjct  67   ARYVARLRADTGLYGQTFFESGQVDSWIDFSAHELEVPLQMWLYPIFGYMKFNAGTKAKA  126

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYF  684
            +  +K++L  L  HL   TYLVG  +TLADIV+   L    K ++ K   K +  V R+F
Sbjct  127  VEDVKKALQVLENHLHLRTYLVGEHITLADIVIASLLVYPMKMLLDKDLRKPYSAVNRWF  186

Query  685  WTL  693
             TL
Sbjct  187  STL  189



>ref|XP_004341586.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19500.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
Length=408

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 114/189 (60%), Gaps = 2/189 (1%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            +   PN N   +KA I   + G+++E    FQ+GV NKTPEF    P+ KVP LETP+GP
Sbjct  5    IFSYPN-NHRVWKAQIAGNFTGLQIE-APAFQIGVDNKTPEFAAKFPLQKVPALETPEGP  62

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            +FESNAIARY A+    + ++GSS  E   I+QW DF+A EI+   + WLYP    V + 
Sbjct  63   LFESNAIARYAARYGGSSKIYGSSPYEASLIDQWIDFSANEIELPASAWLYPIFEIVPFN  122

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
              A E A A +K++L  LN HL   TYLVG  V+LADIV+   L   +  ++  +F K +
Sbjct  123  AEATERAKADIKKALELLNKHLTYRTYLVGERVSLADIVVSMALYRLYTMVLDITFRKNY  182

Query  664  PHVERYFWT  690
             +V R+F T
Sbjct  183  GNVNRWFLT  191



>gb|EWM21126.1| elongation factor 1 [Nannochloropsis gaditana]
Length=435

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 116/193 (60%), Gaps = 2/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            MAL L++   N  AFK L+ A Y GV +++  +  +    +T + L  +P GKVPVLETP
Sbjct  1    MALKLYTNPGNFRAFKILVAALYNGVDIDVV-DLDLAAKKRT-DVLAKSPAGKVPVLETP  58

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
             G +FESNAIARY+A+ + D  L+G S  + G ++ W DFAA E++     W+YP  G++
Sbjct  59   QGLLFESNAIARYIARARRDTDLYGVSFFDSGLVDAWIDFAAQEVELPATLWVYPVFGYL  118

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +     E A A L  ++  L+ HLA  TYLVG  VTLADI +   L   +K +M+  + 
Sbjct  119  PHNAAVTEKAKADLGAAMEILDNHLADKTYLVGEKVTLADITVASALVYPYKIVMSPEYR  178

Query  655  KEFPHVERYFWTL  693
             ++PHV R+F T+
Sbjct  179  AQYPHVLRWFLTI  191



>dbj|GAM21220.1| hypothetical protein SAMD00019534_043950 [Acytostelium subglobosum 
LB1]
Length=416

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 2/183 (1%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTK-NFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  321
            N  A K+LI A+Y GV +E+   +     +NK  E +  NP GKVP   TP GP+FESN+
Sbjct  11   NPRACKSLIAAKYTGVNIEIPNVDLSQLATNKPVELMNANPFGKVPAAMTPQGPLFESNS  70

Query  322  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  501
            IARYVA+ +  N ++G+   E   I+QW DF++ EI++    WLYP LG+  +     + 
Sbjct  71   IARYVAR-QGGNKIYGNDAYEASVIDQWLDFSSNEIESAAVAWLYPILGYGQFNAKETQK  129

Query  502  AIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERY  681
            A  ++K++LT LNTHL S ++L G  VTLADIV+ C+L   +K +   S+   FP+V R+
Sbjct  130  AKDNIKKTLTTLNTHLQSRSFLCGARVTLADIVVTCSLLGFYKMVFDPSYRSTFPNVNRW  189

Query  682  FWT  690
            F T
Sbjct  190  FTT  192



>ref|XP_005760139.1| hypothetical protein EMIHUDRAFT_438506 [Emiliania huxleyi CCMP1516]
 gb|EOD07710.1| hypothetical protein EMIHUDRAFT_438506 [Emiliania huxleyi CCMP1516]
Length=189

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +1

Query  127  LHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  306
            L++   N +A + LIVA Y GV +E+   F+MG  NK+  FLK +P+GKVPVLET  G I
Sbjct  3    LYTFAGNTHALQTLIVARYNGVDIEVPA-FEMGKDNKSAAFLKKSPLGKVPVLETASGCI  61

Query  307  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  486
             E+ A+ARYVA+++ D  +FG++  E G ++ W +FA  E+D     W++P LGF+    
Sbjct  62   CEAAAVARYVARMRADTNMFGATFFEAGQVDMWVEFAKNELDLPVGMWVFPILGFIASNA  121

Query  487  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFP  666
               + A   + R+L  +N HL S T+LVG +VTLADIV+ C+L   FK +    F   FP
Sbjct  122  ANTKQAQEDIARALGVMNEHLQSRTFLVGDAVTLADIVVSCSLLNAFKLVFDAPFLAPFP  181

Query  667  HVERYFWT  690
             V R+F T
Sbjct  182  AVVRWFTT  189



>gb|AFW71312.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=317

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  409  DFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTL  588
            DFAATE+DA+  KWLYPR+GF  Y    EE+AIA+LKR+  +LNTHLASNT+LVGHSVTL
Sbjct  2    DFAATEVDASIGKWLYPRMGFYPYAAVTEESAIAALKRAFGSLNTHLASNTFLVGHSVTL  61

Query  589  ADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            ADIV+ CNL +GF  I+TKSFT EFPH+ERYFWT+
Sbjct  62   ADIVLTCNLYMGFSRILTKSFTSEFPHIERYFWTM  96



>gb|EPB85278.1| hypothetical protein HMPREF1544_07959 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=408

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 116/184 (63%), Gaps = 2/184 (1%)
 Frame = +1

Query  142  ENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  321
            +N    KA I AE  GV+  + + F +   + +PEFL   P+GK+PVLE+ +  +FES++
Sbjct  12   QNPRVAKAQITAELSGVEFNV-EAFDLA-KDASPEFLTKFPLGKIPVLESSEVNLFESSS  69

Query  322  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  501
            IA Y A  K +NPL G++  E   I QWT F+  EI+AN A W+YP +G++ Y+ P  +A
Sbjct  70   IAYYAAAQKENNPLLGATAAEKAEIFQWTLFSENEINANIAGWVYPLMGYMNYMKPNVDA  129

Query  502  AIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERY  681
            A   +KR+L ALN  L S TYLVGH +T ADI ++ +L + F  +  K+F  ++ +V RY
Sbjct  130  ATERVKRALAALNKILESKTYLVGHQITFADITVVSSLVLPFTTVFDKAFRSQYKNVTRY  189

Query  682  FWTL  693
            F T+
Sbjct  190  FTTI  193



>ref|XP_008891718.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETL43385.1| hypothetical protein L916_06090 [Phytophthora parasitica]
 gb|ETN22469.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETO78816.1| hypothetical protein F444_06339 [Phytophthora parasitica P1976]
 gb|ETP19873.1| hypothetical protein F441_06283 [Phytophthora parasitica CJ01A1]
Length=406

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 113/193 (59%), Gaps = 1/193 (1%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            M L L++   N   FKALI AE+ G+ +EL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDIELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  295  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             +   A   A   +K++L  L  HL   TYLVG  +TLADI +   L   FK+++ K F 
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLADIFIASALVYPFKFVLDKEFR  179

Query  655  KEFPHVERYFWTL  693
            K +  V R+F TL
Sbjct  180  KPYSAVNRWFSTL  192



>gb|ADV40141.1| elongation factor-1 gamma [Latrodectus hesperus]
Length=321

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 114/193 (59%), Gaps = 5/193 (3%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  297
            A  LH+   N  A K LI A+Y G K+ ++ +F +G +N+T EFLK  P GKVP LETPD
Sbjct  4    ACTLHTYPNNFRAQKILIAAQYSGTKINVSDDFTLGQTNQTTEFLKKFPNGKVPALETPD  63

Query  298  GP-IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
               I ESNAIA YV     ++ L G ++++   I+ W DF   EI  +   W++P LG +
Sbjct  64   NKYISESNAIAHYVG----NDQLRGENVLQQSLIKMWIDFGDHEILPSACTWVFPCLGIL  119

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y     E A   +KR+L  LN HL +NTYLVG  +T ADI + CNL   ++ ++  +F 
Sbjct  120  QYNKQNTEKAKEQIKRTLKILNDHLLTNTYLVGERITQADISLCCNLLSLYQLVLEPAFR  179

Query  655  KEFPHVERYFWTL  693
            + + +V R+F TL
Sbjct  180  QPYRNVNRWFKTL  192



>emb|CDS12960.1| hypothetical protein LRAMOSA05144 [Absidia idahoensis var. thermophila]
Length=401

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 2/190 (1%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            V+ S  EN N +KA I A Y GVKV+  ++F + +  +   F +  P GKVPV E  +  
Sbjct  5    VIKSYPENPNVYKAQIAAAYSGVKVDF-QSFDI-MKERDEAFWQRFPFGKVPVFEGKEAN  62

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            +FES+AIA Y+   + D+PL G + +E   I+QW  F+  EI  + + W+ P LG+  Y+
Sbjct  63   LFESSAIALYILAQQQDSPLLGKTPLEQAEIQQWVLFSENEISQHVSGWVAPLLGYSPYI  122

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
             P+ ++AI  L+RSL ALN  L S TYLVG  VT ADIVM+C+L   F  +  K F   +
Sbjct  123  KPSVDSAIQKLQRSLGALNKSLESKTYLVGERVTYADIVMVCSLVRPFSLLCDKEFRAPY  182

Query  664  PHVERYFWTL  693
             +V RYF T+
Sbjct  183  KNVLRYFNTV  192



>sp|P12261.3|EF1G_ARTSA RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Artemia salina]
 pir||S00162 translation elongation factor eEF-1 gamma chain - brine shrimp
 gb|AAC83401.1| elongation factor 1-gamma [Artemia sp.]
Length=430

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 118/194 (61%), Gaps = 5/194 (3%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            +A  L++  EN  AFKALI A+Y G K+E+ K+F  G +NK+  FLK  P+GKVP  E+ 
Sbjct  2    VAGKLYTYPENFRAFKALIAAQYSGAKLEIAKSFVFGETNKSDAFLKSFPLGKVPAFESA  61

Query  295  DG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            DG  I ESNAIA YVA    +  L GSS +E   I QW  FA TEI   +  W++P LG 
Sbjct  62   DGHCIAESNAIAYYVA----NETLRGSSDLEKAQIIQWMTFADTEILPASCTWVFPVLGI  117

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + +   A   A   + ++L AL+ HL + TYLVG  +TLADIV+ C L   ++ ++ ++F
Sbjct  118  MQFNKQATARAKEDIDKALQALDDHLLTRTYLVGERITLADIVVTCTLLHLYQHVLDEAF  177

Query  652  TKEFPHVERYFWTL  693
             K + +  R+F TL
Sbjct  178  RKSYVNTNRWFITL  191



>ref|NP_001083003.1| uncharacterized protein LOC100037382 [Danio rerio]
Length=430

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 117/194 (60%), Gaps = 5/194 (3%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  294
            +A  L++  EN  AFKALI A+Y G K+E+ K F  G +NK+  FLK  P+GKVP  E+ 
Sbjct  2    VAGKLYTYPENFRAFKALIAAQYSGAKLEIAKGFVFGETNKSDAFLKKFPLGKVPAFESA  61

Query  295  DG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  471
            DG  I ESNAIA YVA    +  L GSS +E   I QW  FA TEI   +  W++P LG 
Sbjct  62   DGHCIAESNAIAYYVA----NETLRGSSDLEKAQIIQWMTFADTEILPASCTWVFPVLGI  117

Query  472  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSF  651
            + +   A   A   + ++L AL+ HL + TYLVG  +TLADIV+ C L   ++ ++ ++F
Sbjct  118  MQFNKQATARAKEDIDKALQALDDHLLTRTYLVGERITLADIVVTCTLLHLYQHVLDEAF  177

Query  652  TKEFPHVERYFWTL  693
             K + +  R+F TL
Sbjct  178  RKSYVNTNRWFITL  191



>gb|ETP47818.1| hypothetical protein F442_06319, partial [Phytophthora parasitica 
P10297]
Length=170

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 101/169 (60%), Gaps = 1/169 (1%)
 Frame = +1

Query  127  LHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  306
            L++   N   FK LI AEY GV +EL + F      K+ EF    PIGKVP+LET +G +
Sbjct  3    LYTYPGNYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTL  61

Query  307  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  486
            FES AIARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +  
Sbjct  62   FESGAIARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNA  121

Query  487  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKW  633
             A   A A +K++L  L  HL   TYLVG  VTLADIV+   L   FK+
Sbjct  122  AALTKAKADVKKALQTLENHLHLRTYLVGEQVTLADIVVASALVYPFKF  170



>emb|CDH55788.1| elongation factor 1-gamma [Lichtheimia corymbifera JMRC:FSU:9682]
Length=403

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 112/190 (59%), Gaps = 2/190 (1%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
            V+ S  EN N +K  I A Y GVKV+  ++F + +  +   F +  P GKVPV E  +  
Sbjct  5    VIKSYPENPNVYKVQIAAAYSGVKVDF-QSFDI-MKERDEAFWQRFPFGKVPVFEGKEAN  62

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            +FES+AI  YV   + D+PL G + +E   I+QW  F+  EI  + + W+ P LG+  Y+
Sbjct  63   LFESSAITLYVLAQQKDSPLLGKTPLEQAEIQQWVLFSENEISQHVSGWVAPLLGYAQYI  122

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
             P  E++I  L+RSL+ALN  L S TYLVG  VT ADIVM+C+L   F  +  K F   +
Sbjct  123  KPNVESSIQKLQRSLSALNKSLESKTYLVGEDVTYADIVMVCSLVRPFNLLCDKEFRAPY  182

Query  664  PHVERYFWTL  693
             +V RYF T+
Sbjct  183  KNVVRYFNTV  192



>gb|ETI50110.1| hypothetical protein F443_06278, partial [Phytophthora parasitica 
P1569]
Length=173

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = +1

Query  145  NKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  324
            N   FK LI AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  12   NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  70

Query  325  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  504
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  71   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  130

Query  505  IASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKW  633
             A +K++L  L  HL   TYLVG  VTLADIV+   L   FK+
Sbjct  131  KADVKKALQTLENHLHLRTYLVGEQVTLADIVVASALVYPFKF  173



>dbj|BAB29238.3| unnamed protein product [Mus musculus]
Length=231

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 114/195 (58%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  E
Sbjct  3    AETLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GS+      + QW  FA ++I    + W++P L
Sbjct  63   GDDGFCVFESNAIAYYVS----NEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + +   A E A   +KR L  L+THL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



>gb|KFH74042.1| hypothetical protein MVEG_01255 [Mortierella verticillata NRRL 
6337]
Length=417

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 108/190 (57%), Gaps = 1/190 (1%)
 Frame = +1

Query  127  LHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP-  303
            ++S  +N    KAL+VA+Y G++V++ +NF MG +NKT E++      +VP  E  DG  
Sbjct  6    IYSYPQNPRVTKALVVAKYNGLEVKVAENFVMGTTNKTAEWMAKFGASQVPAFEGVDGTV  65

Query  304  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  483
            I ES AIA Y+A  K  + L G S  E  HI+QW  F    +  +   W++P LG+  Y 
Sbjct  66   IIESGAIAYYLAHYKEGSSLVGKSKAEEAHIQQWIQFVDCSVGQSLGAWVFPLLGYAPYN  125

Query  484  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEF  663
              +E +AI  LK  L  L  HL   TYLVG  VTLADI     L +G+K +   +F KEF
Sbjct  126  KMSETSAIERLKGQLATLERHLIKKTYLVGERVTLADISAASGLYMGYKLVFDATFRKEF  185

Query  664  PHVERYFWTL  693
            P V R+F T+
Sbjct  186  PAVTRWFTTI  195



>dbj|BAB27948.1| unnamed protein product [Mus musculus]
Length=247

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 114/195 (58%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  E
Sbjct  3    AGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GS+      + QW  FA ++I    + W++P L
Sbjct  63   GDDGFCVFESNAIAYYVS----NEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + +   A E A   +KR L  L+THL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



>emb|CEI89465.1| hypothetical protein RMCBS344292_03820 [Rhizopus microsporus]
Length=407

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 114/186 (61%), Gaps = 3/186 (2%)
 Frame = +1

Query  136  PNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  315
            PN N    KA I A Y G++  + + F +   ++TPEF    P+GK+PVLE+    +FES
Sbjct  11   PN-NARVAKACIAAAYNGLEFNV-EEFDLA-KDRTPEFYAKFPLGKIPVLESAQVDLFES  67

Query  316  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAE  495
            +AI  Y A +K D+PL G + +E   I QW  F  TE++ N   WLYP LGF+ YL P+ 
Sbjct  68   SAIGYYAAALKEDSPLLGKNAVEKALILQWVLFCETELNTNLGGWLYPLLGFMPYLKPSV  127

Query  496  EAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVE  675
            + A A+ KR+L ALN+ L + TYLVG+ VT ADI ++ +L   +  ++ K+   EF +V 
Sbjct  128  DTATANFKRALGALNSVLLTKTYLVGNDVTYADIAVVTSLFYAYTKLLDKAARAEFKNVT  187

Query  676  RYFWTL  693
            RYF T+
Sbjct  188  RYFNTV  193



>emb|CEI97373.1| hypothetical protein RMCBS344292_11508 [Rhizopus microsporus]
Length=407

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 115/186 (62%), Gaps = 3/186 (2%)
 Frame = +1

Query  136  PNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  315
            PN N    KA I A Y G++  + + F +   ++TPEF    P+GK+PVLE+    +FES
Sbjct  11   PN-NPRVAKACIAAAYNGLEFNVEQ-FDLA-KDRTPEFYARFPLGKIPVLESAQVNLFES  67

Query  316  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAE  495
            +AI  Y A +K D+PL G + +E   I QW  F  TE+++N   WLYP +GF+ YL P+ 
Sbjct  68   SAIGYYAAALKEDSPLLGKNAVEKALIMQWVLFCETELNSNLGGWLYPLMGFMPYLKPSV  127

Query  496  EAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVE  675
            + A A+ KR+L ALN+ L + TYLVG+ VT ADI ++ +L   +  ++ K+   EF +V 
Sbjct  128  DTATANFKRALGALNSVLLTKTYLVGNDVTYADIAVVTSLFYAYTKLLDKAARDEFKNVT  187

Query  676  RYFWTL  693
            RYF T+
Sbjct  188  RYFNTV  193



>emb|CEG74026.1| hypothetical protein RMATCC62417_09299 [Rhizopus microsporus]
Length=407

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 114/186 (61%), Gaps = 3/186 (2%)
 Frame = +1

Query  136  PNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  315
            PN N    KA I A Y G++  + + F +   ++TPEF    P+GK+PVLE+    +FES
Sbjct  11   PN-NARVAKACIAAAYNGLEFNV-EEFDLA-KDRTPEFYAKFPLGKIPVLESAQVDLFES  67

Query  316  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAE  495
            +AI  Y A +K D+PL G + +E   I QW  F  TE++ N   WLYP LGF+ YL P+ 
Sbjct  68   SAIGYYAAALKEDSPLLGKNAVEKALILQWVLFCETELNTNLGGWLYPLLGFMPYLKPSV  127

Query  496  EAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVE  675
            + A A+ KR+L ALN+ L + TYLVG+ VT ADI ++ +L   +  ++ K+   EF +V 
Sbjct  128  DTATANFKRALGALNSVLLTKTYLVGNDVTYADIAVVTSLFYAYTKLLDKAARAEFKNVT  187

Query  676  RYFWTL  693
            RYF T+
Sbjct  188  RYFNTV  193



>emb|CDH55787.1| elongation factor 1-gamma [Lichtheimia corymbifera JMRC:FSU:9682]
Length=475

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 109/184 (59%), Gaps = 2/184 (1%)
 Frame = +1

Query  142  ENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  321
            EN N +K  I A Y GVKV+  ++F + +  +   F +  P GKVPV E  +  +FES+A
Sbjct  83   ENPNVYKVQIAAAYSGVKVDF-QSFDI-MKERDEAFWQRFPFGKVPVFEGKEANLFESSA  140

Query  322  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  501
            I  YV   + D+PL G + +E   I+QW  F+  EI  + + W+ P LG+  Y+ P  E+
Sbjct  141  ITLYVLAQQKDSPLLGKTPLEQAEIQQWVLFSENEISQHVSGWVAPLLGYAQYIKPNVES  200

Query  502  AIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERY  681
            +I  L+RSL+ALN  L S TYLVG  VT ADIVM+C+L   F  +  K F   + +V RY
Sbjct  201  SIQKLQRSLSALNKSLESKTYLVGEDVTYADIVMVCSLVRPFNLLCDKEFRAPYKNVVRY  260

Query  682  FWTL  693
            F T+
Sbjct  261  FNTV  264



>ref|XP_005988901.1| PREDICTED: elongation factor 1-gamma-like [Latimeria chalumnae]
Length=436

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 117/192 (61%), Gaps = 8/192 (4%)
 Frame = +1

Query  127  LHSPNENKNAFKALIVAEYCG--VKVELTK-NFQMGVSNKTPEFLKMNPIGKVPVLETPD  297
            L++  EN  AFKALI A+Y G  VKV+ T   F  G SNKTPEFL+  P+GKVP  E  D
Sbjct  6    LYTYPENWRAFKALIAAQYSGATVKVQSTPPQFHFGQSNKTPEFLQKFPLGKVPAFEGDD  65

Query  298  G-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  474
            G  +FESNAIA YV+    ++ L GSS +    + QW  FA +EI    + W++P LG +
Sbjct  66   GFCVFESNAIAHYVS----NDELRGSSKVAAAQVIQWMSFADSEIVPPASTWVFPTLGIM  121

Query  475  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFT  654
             Y   A E A   +K+ L  L+ HL + T+LVG  VTLADI ++C+L   +K ++  SF 
Sbjct  122  QYNKQATEHAKEEVKKVLGVLDLHLQTRTFLVGERVTLADIAVVCSLLWLYKQVLEPSFR  181

Query  655  KEFPHVERYFWT  690
            + + +V R+F T
Sbjct  182  QLYVNVNRWFVT  193



>ref|XP_007056947.1| PREDICTED: elongation factor 1-gamma [Chelonia mydas]
Length=432

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  112  AMALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  282
            A A  L++  EN  AFKALI A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  283  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  459
             E  DG  +FESNAIA YV+    ++ L GS+      I QW  FA ++I    + W++P
Sbjct  62   FEGADGFCVFESNAIAHYVS----NDDLRGSTKETAAQIIQWVSFADSDIVPPASTWVFP  117

Query  460  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIM  639
             LG + Y   A E A   +KR L  L++HL + T+LVG  +TLADI ++C L   +K ++
Sbjct  118  TLGIMHYNKQATEYAKEEVKRVLGILDSHLKTQTFLVGERITLADITVVCTLLWLYKQVL  177

Query  640  TKSFTKEFPHVERYF  684
              SF + + +  R+F
Sbjct  178  EPSFRQPYSNTNRWF  192



>gb|ELK23445.1| Elongation factor 1-gamma [Myotis davidii]
Length=453

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 114/196 (58%), Gaps = 8/196 (4%)
 Frame = +1

Query  115  MALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVL  285
            +A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  
Sbjct  18   LAQTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAF  77

Query  286  ETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPR  462
            E  DG  +FESNAIA YV+    +  L GSS      + QW  FA ++I    + W++P 
Sbjct  78   EGDDGFCVFESNAIAYYVS----NEDLRGSSPEAAAQVVQWVSFADSDIVPPASTWVFPT  133

Query  463  LGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMT  642
            LG + Y   A E A   ++R L  L+ HL + T+LVG  VTLADI ++C L   +K ++ 
Sbjct  134  LGIMHYNKQATETAKEDMRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLE  193

Query  643  KSFTKEFPHVERYFWT  690
             SF + FP+  R+F T
Sbjct  194  PSFRQAFPNTNRWFLT  209



>gb|KDR22664.1| Elongation factor 1-gamma, partial [Zootermopsis nevadensis]
Length=435

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 113/191 (59%), Gaps = 5/191 (3%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
             L++  EN  A+K LI A+Y G  V++   F  G +NKT  FLK  P+GKVP  ET DG 
Sbjct  1    TLYTYPENFRAYKVLIAAQYAGGNVKVAPGFVFGETNKTEAFLKKFPLGKVPAFETADGQ  60

Query  304  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
             + ESNAIA YVA    D  L G S +E   + QW  FA +EI   +  W++P LG + Y
Sbjct  61   YLTESNAIAYYVA----DARLRGQSDLEKAQVIQWLGFADSEILPASCAWVFPCLGIMQY  116

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
               + E A   +K +L ALNTHL   TYLVG ++TLADI + C L   +++++  SF K 
Sbjct  117  NKQSTERAKEDVKSALQALNTHLLPRTYLVGETITLADIGVACTLLQLYQYVLDTSFRKP  176

Query  661  FPHVERYFWTL  693
            + +V R+F T+
Sbjct  177  YQNVNRWFTTV  187



>ref|XP_003229963.2| PREDICTED: elongation factor 1-gamma [Anolis carolinensis]
 ref|XP_003230803.2| PREDICTED: elongation factor 1-gamma [Anolis carolinensis]
Length=432

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  112  AMALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  282
            A A  L++  EN  AFK LI A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKVLIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  283  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  459
             E  DG  +FESNAIA YV+    +  L G++      + QW  FA ++I    + W++P
Sbjct  62   FEGDDGFCVFESNAIAHYVS----NEELRGATKEAAAQVLQWVSFADSDIVPPASTWVFP  117

Query  460  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIM  639
             LG + Y   A E+A   +KR L+ L++HL + T+LVG  VTLADI ++C L   +K ++
Sbjct  118  TLGIMHYNKQATESAKDEVKRILSLLDSHLKTRTFLVGERVTLADITVVCTLLWLYKQVL  177

Query  640  TKSFTKEFPHVERYF  684
              SF + + +V R+F
Sbjct  178  EPSFRQSYGNVNRWF  192



>ref|XP_007439957.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Python 
bivittatus]
Length=432

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  112  AMALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  282
            A+A  L++  EN  AFKALI A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AVAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  283  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  459
             E  DG  IFESNAIA YV+    +  L G++      + QW  FA ++I    + W++P
Sbjct  62   FEGDDGFCIFESNAIAHYVS----NEELRGATKESAAQVLQWVSFADSDIVPPASTWVFP  117

Query  460  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIM  639
             LG + Y   A E+A   +KR L+ L+ HL + T+LVG  +TLADI ++C L   +K ++
Sbjct  118  TLGIMQYNKQATESAKEEVKRILSLLDIHLKTRTFLVGERITLADITVVCTLLWLYKQVL  177

Query  640  TKSFTKEFPHVERYF  684
               F + + +V R+F
Sbjct  178  EPPFRQPYENVNRWF  192



>ref|XP_007943079.1| PREDICTED: elongation factor 1-gamma [Orycteropus afer afer]
Length=437

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G ++ +     +F  GV+N+TPEFL+  P GKVP  E
Sbjct  3    AGTLYTYPENWRAFKALIAAQYSGAQIRVLSAPPHFHFGVTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GSS      + QW  FA ++I A  + W++P L
Sbjct  63   GDDGFCVFESNAIAYYVS----NEELRGSSPETAAQVVQWVSFADSDIVAPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + +   A E A   ++R L  L+ HL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHHNKQATENAKEEVRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



>gb|AJD25298.1| elongation factor-1 gamma-like protein [Plectreurys tristis]
Length=273

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 107/179 (60%), Gaps = 5/179 (3%)
 Frame = +1

Query  160  KALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP-IFESNAIARYV  336
            K LI A++ G  V++  +F  G +NK+PEFL+  P+GKVP LET D   IFESNAIA YV
Sbjct  17   KILIAAKFSGFDVKVADDFVFGETNKSPEFLEKFPVGKVPALETSDKKYIFESNAIAYYV  76

Query  337  AKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASL  516
                 +  L G++LI+   I QW  FA  EI +    WL+P LG + Y     E A   +
Sbjct  77   G----NEQLRGNNLIDRAQILQWISFADNEILSPACTWLFPCLGIMQYNKQTTERAKEDI  132

Query  517  KRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPHVERYFWTL  693
            K++L  LN HL + T+LVG  +T ADI + CNL   ++ ++  SF K + +V R+F TL
Sbjct  133  KKALEILNHHLLTRTFLVGERITQADISLCCNLLGLYQNVLDPSFRKPYGNVNRWFITL  191



>ref|XP_006772813.1| PREDICTED: elongation factor 1-gamma [Myotis davidii]
Length=437

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 113/195 (58%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  E
Sbjct  3    AGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GSS      + QW  FA ++I    + W++P L
Sbjct  63   GDDGFCVFESNAIAYYVS----NEDLRGSSPEAAAQVVQWVSFADSDIVPPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + Y   A E A   ++R L  L+ HL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHYNKQATETAKEDMRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



>dbj|BAE88257.1| unnamed protein product [Macaca fascicularis]
Length=246

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 113/195 (58%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  E
Sbjct  3    AGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GS+      + QW  FA ++I    + W++P L
Sbjct  63   GDDGFCVFESNAIAYYVS----NEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + +   A E A   ++R L  L+ HL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHHNKQATENAKEEVRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



>ref|XP_005857534.1| PREDICTED: elongation factor 1-gamma [Myotis brandtii]
Length=437

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 113/195 (58%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  E
Sbjct  3    AGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GSS      + QW  FA ++I    + W++P L
Sbjct  63   GDDGFCVFESNAIAYYVS----NEDLRGSSPEAAAQVVQWVSFADSDIVPPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + Y   A E A   ++R L  L+ HL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHYNKQATETAKEDVRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



>ref|XP_011428586.1| PREDICTED: elongation factor 1-gamma-like, partial [Crassostrea 
gigas]
Length=323

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 120/204 (59%), Gaps = 6/204 (3%)
 Frame = +1

Query  88   CVGSF*SEAMAL-VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNP  264
            C   F S AMA   L++  +N  AFKALI A+Y G  V+++  F+ G +NK+  FL+  P
Sbjct  5    CYFLFLSSAMASGTLYTFPDNFRAFKALIAAQYSGADVKISPGFKFGETNKSKSFLEKFP  64

Query  265  IGKVPVLETPDGP-IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANT  441
            +GKVP  E+  G  +FESNAIA+YV+  +    L G++  +   ++QW +FA  E+   +
Sbjct  65   LGKVPAFESASGDCLFESNAIAQYVSNAQ----LMGANSRDAAFVQQWINFADNEVLPAS  120

Query  442  AKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSI  621
              W++P LG + +     E A   +K++L  LN HL+  T+LVG  ++ ADI + CNL +
Sbjct  121  CTWVFPCLGIMQFNKQETEKAKEQVKKALGVLNGHLSKRTFLVGERISQADISVACNLLL  180

Query  622  GFKWIMTKSFTKEFPHVERYFWTL  693
             +K ++  SF   + H  R+F TL
Sbjct  181  LYKHVLDPSFRAPYIHTNRWFTTL  204



>ref|XP_005707114.1| elongation factor EF-1 gamma subunit [Galdieria sulphuraria]
 gb|EME30594.1| elongation factor EF-1 gamma subunit [Galdieria sulphuraria]
Length=1284

 Score =   145 bits (367),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 84/187 (45%), Positives = 107/187 (57%), Gaps = 4/187 (2%)
 Frame = +1

Query  136   PNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  315
             PN N  A KALI AEY  V V++ K F+MG  NK+PEFLK+ P+GK+P LETP GP+ ES
Sbjct  895   PN-NPRAQKALIAAEYAQVSVQVPK-FEMGKDNKSPEFLKLFPLGKIPALETPQGPVSES  952

Query  316   NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL--GFVIYLPP  489
              AIA Y AK++PD  L G+SL E   ++QW  FA      +    LYP    G   +   
Sbjct  953   PAIAWYFAKLRPDKGLCGNSLYEECQVQQWISFAEDAFAKHYPVLLYPYFMPGNFSFQEQ  1012

Query  490   AEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKEFPH  669
               E A   +KR L  L  HL  NTYLVG  VTLADI  +C +   F+  + KSF   +  
Sbjct  1013  EAEKAKQQIKRYLDVLELHLLHNTYLVGERVTLADITAVCYIVPLFRIALGKSFRAAYTS  1072

Query  670   VERYFWT  690
             + R+  T
Sbjct  1073  LLRWLHT  1079



>ref|XP_006109995.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation elongation 
factor 1 gamma [Myotis lucifugus]
Length=437

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 113/195 (58%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  E
Sbjct  3    AGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GSS      + QW  FA ++I    + W++P L
Sbjct  63   GDDGFCVFESNAIAYYVS----NEDLRGSSPEAAAQVVQWVSFADSDIVPPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + Y   A E A   ++R L  L+ HL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHYNKQATETAKEDVRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



>gb|EKC22737.1| Elongation factor 1-gamma [Crassostrea gigas]
Length=245

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 114/191 (60%), Gaps = 5/191 (3%)
 Frame = +1

Query  124  VLHSPNENKNAFKALIVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  303
             L++  +N  AFKALI A+Y G  V+++  F+ G +NK+  FL+  P+GKVP  E+  G 
Sbjct  5    TLYTFPDNFRAFKALIAAQYSGADVKISPGFKFGETNKSKSFLEKFPLGKVPAFESASGD  64

Query  304  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  480
             +FESNAIA+YV+  +    L G++  +   ++QW +FA  E+   +  W++P LG + +
Sbjct  65   CLFESNAIAQYVSNAQ----LMGANSRDAAFVQQWINFADNEVLPASCTWVFPCLGIMQF  120

Query  481  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTKSFTKE  660
                 E A   +K++L  LN HL+  T+LVG  ++ ADI + CNL + +K ++  SF   
Sbjct  121  NKQETEKAKEQVKKALGVLNGHLSKRTFLVGERISQADISVACNLLLLYKHVLDPSFRAP  180

Query  661  FPHVERYFWTL  693
            + H  R+F TL
Sbjct  181  YIHTNRWFTTL  191



>ref|XP_003508788.1| PREDICTED: elongation factor 1-gamma [Cricetulus griseus]
 ref|XP_007608212.1| PREDICTED: elongation factor 1-gamma [Cricetulus griseus]
Length=437

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 114/195 (58%), Gaps = 8/195 (4%)
 Frame = +1

Query  118  ALVLHSPNENKNAFKALIVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLE  288
            A  L++  EN  AFKALI A+Y G +V +     +F  G +N+TPEFL+  P GKVP  E
Sbjct  3    AGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFE  62

Query  289  TPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL  465
              DG  +FESNAIA YV+    +  L GS+      + QW  FA ++I    + W++P L
Sbjct  63   GDDGFCVFESNAIAHYVS----NEDLRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTL  118

Query  466  GFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLADIVMICNLSIGFKWIMTK  645
            G + +   A E A   +KR L  L+THL + T+LVG  VTLADI ++C L   +K ++  
Sbjct  119  GIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEP  178

Query  646  SFTKEFPHVERYFWT  690
            SF + FP+  R+F T
Sbjct  179  SFRQAFPNTNRWFLT  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1197759904156