BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1687

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004232206.1|  PREDICTED: uncharacterized protein At5g39570       161   9e-44   Solanum lycopersicum
ref|XP_009608846.1|  PREDICTED: uncharacterized protein At5g39570...    156   9e-42   Nicotiana tomentosiformis
ref|XP_009781780.1|  PREDICTED: uncharacterized protein At5g39570       154   2e-41   Nicotiana sylvestris
ref|XP_006338424.1|  PREDICTED: uncharacterized protein At5g39570...    152   2e-40   Solanum tuberosum [potatoes]
ref|XP_002283932.1|  PREDICTED: uncharacterized protein At5g39570       148   1e-38   Vitis vinifera
ref|XP_011098657.1|  PREDICTED: uncharacterized protein At5g39570...    144   1e-37   Sesamum indicum [beniseed]
ref|XP_009772867.1|  PREDICTED: uncharacterized protein At5g39570...    146   3e-37   Nicotiana sylvestris
gb|KDO36694.1|  hypothetical protein CISIN_1g017568mg                   142   1e-36   Citrus sinensis [apfelsine]
ref|XP_010672883.1|  PREDICTED: uncharacterized protein At5g39570...    141   2e-36   
ref|XP_011014109.1|  PREDICTED: uncharacterized protein At5g39570...    142   3e-36   Populus euphratica
ref|XP_011014107.1|  PREDICTED: uncharacterized protein At5g39570...    142   3e-36   Populus euphratica
ref|XP_010672882.1|  PREDICTED: uncharacterized protein At5g39570...    139   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006603877.1|  PREDICTED: uncharacterized protein At5g39570...    138   3e-35   
ref|XP_003554616.1|  PREDICTED: uncharacterized protein At5g39570...    139   4e-35   Glycine max [soybeans]
ref|XP_006389471.1|  hypothetical protein POPTR_0023s00630g             139   4e-35   
ref|XP_011008581.1|  PREDICTED: uncharacterized protein At5g39570...    140   5e-35   Populus euphratica
ref|XP_011008580.1|  PREDICTED: uncharacterized protein At5g39570...    139   6e-35   Populus euphratica
ref|XP_011008579.1|  PREDICTED: uncharacterized protein At5g39570...    139   6e-35   Populus euphratica
ref|XP_010317110.1|  PREDICTED: uncharacterized protein At5g39570...    136   8e-35   
ref|XP_010317109.1|  PREDICTED: uncharacterized protein At5g39570...    137   1e-34   
ref|XP_012084739.1|  PREDICTED: uncharacterized protein At5g39570...    135   2e-34   Jatropha curcas
ref|XP_012084738.1|  PREDICTED: uncharacterized protein At5g39570...    135   2e-34   Jatropha curcas
ref|XP_006482634.1|  PREDICTED: uncharacterized protein At5g39570...    137   3e-34   Citrus sinensis [apfelsine]
ref|XP_006389469.1|  hypothetical protein POPTR_0023s00630g             137   3e-34   
ref|XP_009628950.1|  PREDICTED: uncharacterized protein At5g39570...    137   4e-34   Nicotiana tomentosiformis
ref|XP_006384339.1|  hypothetical protein POPTR_0004s13090g             136   4e-34   
ref|XP_006431210.1|  hypothetical protein CICLE_v10011817mg             136   6e-34   Citrus clementina [clementine]
ref|XP_009360594.1|  PREDICTED: uncharacterized protein At5g39570       135   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_006363410.1|  PREDICTED: uncharacterized protein At5g39570...    133   2e-33   Solanum tuberosum [potatoes]
gb|EYU44134.1|  hypothetical protein MIMGU_mgv1a011784mg                132   3e-33   Erythranthe guttata [common monkey flower]
gb|KDO36693.1|  hypothetical protein CISIN_1g017568mg                   134   3e-33   Citrus sinensis [apfelsine]
gb|AFK47564.1|  unknown                                                 132   8e-33   Lotus japonicus
ref|XP_008230802.1|  PREDICTED: uncharacterized protein At5g39570       133   1e-32   Prunus mume [ume]
ref|XP_008353427.1|  PREDICTED: uncharacterized protein At5g39570...    132   2e-32   
ref|XP_008379385.1|  PREDICTED: uncharacterized protein At5g39570...    131   4e-32   
gb|EPS71766.1|  hypothetical protein M569_03001                         126   4e-32   Genlisea aurea
ref|XP_008341598.1|  PREDICTED: uncharacterized protein At5g39570       130   5e-32   
ref|XP_007215367.1|  hypothetical protein PRUPE_ppa005604mg             129   2e-31   Prunus persica
ref|XP_002324073.2|  hypothetical protein POPTR_0017s12290g             128   7e-31   
ref|XP_011035800.1|  PREDICTED: uncharacterized protein At5g39570...    124   1e-29   Populus euphratica
ref|XP_011035799.1|  PREDICTED: uncharacterized protein At5g39570...    124   1e-29   Populus euphratica
ref|XP_011035798.1|  PREDICTED: uncharacterized protein At5g39570...    124   1e-29   Populus euphratica
emb|CBI22252.3|  unnamed protein product                                119   2e-29   Vitis vinifera
ref|XP_003543859.2|  PREDICTED: uncharacterized protein At5g39570...    120   4e-28   
ref|NP_568565.2|  uncharacterized protein                               116   6e-27   
ref|XP_006405619.1|  hypothetical protein EUTSA_v10027782mg             115   6e-27   
gb|AAN60241.1|  unknown                                                 116   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AFK48716.1|  unknown                                                 113   9e-27   Medicago truncatula
ref|XP_006405620.1|  hypothetical protein EUTSA_v10027782mg             115   2e-26   Eutrema salsugineum [saltwater cress]
ref|XP_007151256.1|  hypothetical protein PHAVU_004G031300g             115   3e-26   Phaseolus vulgaris [French bean]
ref|XP_003618539.1|  hypothetical protein MTR_6g012780                  114   3e-26   Medicago truncatula
gb|KEH25017.1|  pro-resilin, putative                                   114   4e-26   Medicago truncatula
ref|XP_006283826.1|  hypothetical protein CARUB_v10004926mg             112   1e-25   
emb|CDX95231.1|  BnaC09g16390D                                          111   1e-25   
ref|XP_006283824.1|  hypothetical protein CARUB_v10004926mg             112   2e-25   
ref|XP_004489417.1|  PREDICTED: uncharacterized protein At5g39570...    112   2e-25   Cicer arietinum [garbanzo]
ref|XP_006283825.1|  hypothetical protein CARUB_v10004926mg             112   2e-25   Capsella rubella
ref|XP_002870774.1|  predicted protein                                  111   3e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_010450798.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    111   5e-25   
ref|XP_004304279.1|  PREDICTED: uncharacterized protein At5g39570       110   1e-24   Fragaria vesca subsp. vesca
gb|KHN13204.1|  Hypothetical protein glysoja_016381                     109   1e-24   Glycine soja [wild soybean]
gb|KJB11100.1|  hypothetical protein B456_001G240600                    105   5e-24   Gossypium raimondii
ref|XP_009139903.1|  PREDICTED: uncharacterized protein At5g39570       105   3e-23   Brassica rapa
emb|CDX74447.1|  BnaA04g09420D                                          105   3e-23   
gb|KJB11097.1|  hypothetical protein B456_001G240600                    105   4e-23   Gossypium raimondii
gb|KJB11091.1|  hypothetical protein B456_001G240600                    105   4e-23   Gossypium raimondii
gb|KJB11085.1|  hypothetical protein B456_001G240600                    105   4e-23   Gossypium raimondii
gb|KJB11093.1|  hypothetical protein B456_001G240600                    105   4e-23   Gossypium raimondii
gb|KJB11083.1|  hypothetical protein B456_001G240600                    104   4e-23   Gossypium raimondii
emb|CDY30254.1|  BnaC04g31650D                                          104   5e-23   Brassica napus [oilseed rape]
gb|KJB11084.1|  hypothetical protein B456_001G240600                    104   6e-23   Gossypium raimondii
gb|KJB11098.1|  hypothetical protein B456_001G240600                    104   7e-23   Gossypium raimondii
ref|XP_010435878.1|  PREDICTED: uncharacterized protein At5g39570...    104   8e-23   
gb|KFK33783.1|  hypothetical protein AALP_AA5G059400                    103   1e-22   Arabis alpina [alpine rockcress]
ref|XP_010528357.1|  PREDICTED: uncharacterized protein At5g39570...    103   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010552803.1|  PREDICTED: uncharacterized protein At5g39570       103   2e-22   Tarenaya hassleriana [spider flower]
gb|KFK33197.1|  hypothetical protein AALP_AA6G342800                    103   2e-22   Arabis alpina [alpine rockcress]
ref|XP_009151796.1|  PREDICTED: uncharacterized protein At5g39570       102   2e-22   Brassica rapa
emb|CDY00101.1|  BnaC09g02000D                                          101   4e-22   
emb|CDX85244.1|  BnaC07g25550D                                          100   1e-21   
gb|AAP46157.1|  latex abundant protein 1                              96.3    2e-21   Hevea brasiliensis [jebe]
ref|XP_010441070.1|  PREDICTED: uncharacterized protein At5g39570...    100   3e-21   
emb|CDY44410.1|  BnaA02g29670D                                        97.4    2e-20   Brassica napus [oilseed rape]
ref|XP_007032610.1|  Nucleus-like protein                             97.8    2e-20   
ref|XP_009129332.1|  PREDICTED: uncharacterized protein At5g39570...  96.7    3e-20   Brassica rapa
emb|CDY04054.1|  BnaC02g37690D                                        96.3    5e-20   
ref|XP_008443383.1|  PREDICTED: uncharacterized protein At5g39570     96.3    5e-20   Cucumis melo [Oriental melon]
ref|XP_004136693.1|  PREDICTED: uncharacterized protein At5g39570     95.9    6e-20   Cucumis sativus [cucumbers]
ref|XP_010425710.1|  PREDICTED: uncharacterized protein At5g39570...  95.9    7e-20   Camelina sativa [gold-of-pleasure]
emb|CDY19997.1|  BnaA09g02540D                                        94.4    1e-19   Brassica napus [oilseed rape]
ref|XP_009111943.1|  PREDICTED: uncharacterized protein At5g39570...  92.8    1e-19   Brassica rapa
gb|AAS76703.1|  At3g29075                                             93.6    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78108.1|  AT3g29075/MXE2_1                                      93.6    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189551.1|  glycine-rich protein                                94.0    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530006.1|  hypothetical protein RCOM_0537780                94.4    3e-19   Ricinus communis
ref|XP_010502930.1|  PREDICTED: uncharacterized protein At5g39570...  92.8    7e-19   Camelina sativa [gold-of-pleasure]
emb|CDP02257.1|  unnamed protein product                              92.8    1e-18   Coffea canephora [robusta coffee]
ref|XP_002877154.1|  predicted protein                                92.0    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_010495864.1|  PREDICTED: uncharacterized protein At5g39570...  91.7    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010088125.1|  hypothetical protein L484_013569                 90.1    1e-17   Morus notabilis
gb|KJB11086.1|  hypothetical protein B456_001G240600                  89.0    2e-17   Gossypium raimondii
gb|KJB11087.1|  hypothetical protein B456_001G240600                  89.0    2e-17   Gossypium raimondii
gb|KJB11101.1|  hypothetical protein B456_001G240600                  89.0    2e-17   Gossypium raimondii
gb|KJB11095.1|  hypothetical protein B456_001G240600                  89.0    2e-17   Gossypium raimondii
gb|KJB11089.1|  hypothetical protein B456_001G240600                  89.0    3e-17   Gossypium raimondii
gb|KJB11099.1|  hypothetical protein B456_001G240600                  89.0    3e-17   Gossypium raimondii
gb|KJB11092.1|  hypothetical protein B456_001G240600                  89.0    3e-17   Gossypium raimondii
gb|KJB11088.1|  hypothetical protein B456_001G240600                  89.0    3e-17   Gossypium raimondii
gb|KJB11096.1|  hypothetical protein B456_001G240600                  88.6    4e-17   Gossypium raimondii
gb|KJB11090.1|  hypothetical protein B456_001G240600                  88.6    4e-17   Gossypium raimondii
gb|KCW56280.1|  hypothetical protein EUGRSUZ_I02023                   88.2    7e-17   Eucalyptus grandis [rose gum]
gb|KJB11094.1|  hypothetical protein B456_001G240600                  87.4    8e-17   Gossypium raimondii
ref|XP_010258398.1|  PREDICTED: uncharacterized protein At5g39570...  86.7    8e-17   
gb|KJB11082.1|  hypothetical protein B456_001G240600                  87.4    9e-17   Gossypium raimondii
ref|XP_010258396.1|  PREDICTED: uncharacterized protein At5g39570...  86.7    1e-16   Nelumbo nucifera [Indian lotus]
gb|KCW56279.1|  hypothetical protein EUGRSUZ_I02023                   87.8    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010029378.1|  PREDICTED: uncharacterized protein At5g39570...  87.8    1e-16   Eucalyptus grandis [rose gum]
ref|XP_008341599.1|  PREDICTED: uncharacterized protein At5g39570...  83.6    2e-16   
ref|XP_010029376.1|  PREDICTED: uncharacterized protein At5g39570...  87.8    2e-16   
ref|XP_009420742.1|  PREDICTED: uncharacterized protein At5g39570...  86.3    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW56277.1|  hypothetical protein EUGRSUZ_I02023                   87.8    2e-16   Eucalyptus grandis [rose gum]
gb|KCW56276.1|  hypothetical protein EUGRSUZ_I02023                   87.8    2e-16   Eucalyptus grandis [rose gum]
gb|KHG07281.1|  hypothetical protein F383_34041                       85.9    5e-16   Gossypium arboreum [tree cotton]
ref|XP_008230803.1|  PREDICTED: uncharacterized protein At5g39570     79.7    5e-15   Prunus mume [ume]
ref|XP_008800496.1|  PREDICTED: uncharacterized protein At5g39570     80.1    1e-14   Phoenix dactylifera
ref|XP_007217434.1|  hypothetical protein PRUPE_ppb013941mg           78.2    3e-14   
ref|XP_010937212.1|  PREDICTED: uncharacterized protein At5g39570...  79.0    4e-14   Elaeis guineensis
ref|XP_009419097.1|  PREDICTED: uncharacterized protein At5g39570...  77.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419095.1|  PREDICTED: uncharacterized protein At5g39570...  76.6    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008348233.1|  PREDICTED: uncharacterized protein At5g39570...  72.8    1e-12   
gb|ACF88189.1|  unknown                                               73.9    3e-12   Zea mays [maize]
ref|XP_010939838.1|  PREDICTED: uncharacterized protein At5g39570...  71.6    2e-11   Elaeis guineensis
ref|XP_010258266.1|  PREDICTED: uncharacterized protein At5g39570...  68.9    6e-11   Nelumbo nucifera [Indian lotus]
gb|KJB33498.1|  hypothetical protein B456_006G014100                  66.2    7e-10   Gossypium raimondii
ref|NP_001144466.1|  uncharacterized protein LOC100277433             64.7    1e-09   Zea mays [maize]
gb|AFW73381.1|  putative protein kinase superfamily protein           64.3    2e-09   
ref|NP_001057224.1|  Os06g0232000                                     65.1    5e-09   
dbj|BAJ92075.1|  predicted protein                                    64.3    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438115.1|  hypothetical protein SORBIDRAFT_10g008260        63.9    1e-08   Sorghum bicolor [broomcorn]
ref|XP_003564041.1|  PREDICTED: uncharacterized protein At5g39570     61.2    1e-07   Brachypodium distachyon [annual false brome]
ref|XP_002454297.1|  hypothetical protein SORBIDRAFT_04g028150        59.7    1e-07   Sorghum bicolor [broomcorn]
ref|XP_004965057.1|  PREDICTED: uncharacterized protein At5g39570...  59.3    4e-07   Setaria italica
ref|XP_006655944.1|  PREDICTED: uncharacterized protein At5g39570...  58.5    9e-07   Oryza brachyantha
ref|XP_006649041.1|  PREDICTED: uncharacterized protein At5g39570...  57.0    9e-07   Oryza brachyantha
ref|XP_003573102.1|  PREDICTED: uncharacterized protein At5g39570     56.6    2e-06   Brachypodium distachyon [annual false brome]
dbj|BAD16110.1|  glycine-rich protein-like                            54.3    6e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ24591.1|  hypothetical protein OsJ_08352                        53.9    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87501.1|  hypothetical protein OsI_08907                        54.3    8e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009597294.1|  PREDICTED: uncharacterized protein LOC104093272  53.5    4e-05   
ref|XP_007213161.1|  hypothetical protein PRUPE_ppa025399mg           53.5    4e-05   
gb|EMT26355.1|  hypothetical protein F775_25952                       52.0    8e-05   
gb|EMS64373.1|  hypothetical protein TRIUR3_17490                     52.0    8e-05   Triticum urartu
ref|XP_008224892.1|  PREDICTED: uncharacterized protein LOC103324600  52.4    1e-04   Prunus mume [ume]
ref|XP_008340806.1|  PREDICTED: uncharacterized protein At5g39570...  51.2    2e-04   
ref|XP_004232762.1|  PREDICTED: uncharacterized protein LOC101267957  51.2    3e-04   Solanum lycopersicum
ref|XP_009110724.1|  PREDICTED: uncharacterized protein LOC103836230  51.2    3e-04   
ref|XP_010476064.1|  PREDICTED: uncharacterized protein LOC104755393  50.8    4e-04   Camelina sativa [gold-of-pleasure]
emb|CDY20997.1|  BnaA08g25280D                                        50.4    4e-04   Brassica napus [oilseed rape]
gb|AAU87303.1|  hypothetical protein                                  50.4    4e-04   Pinus halepensis [Aleppo pine]
ref|NP_172611.1|  uncharacterized protein                             50.4    5e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57038.1|  BnaC08g14940D                                        50.1    5e-04   Brassica napus [oilseed rape]
ref|XP_006467940.1|  PREDICTED: uncharacterized protein LOC102616344  50.1    5e-04   Citrus sinensis [apfelsine]
gb|KDO36695.1|  hypothetical protein CISIN_1g017568mg                 50.1    5e-04   Citrus sinensis [apfelsine]
ref|XP_006449160.1|  hypothetical protein CICLE_v10016236mg           50.1    6e-04   Citrus clementina [clementine]
ref|XP_008371220.1|  PREDICTED: uncharacterized protein At5g39570     50.1    7e-04   
ref|XP_010098587.1|  hypothetical protein L484_026029                 49.3    0.001   
ref|XP_002889868.1|  hypothetical protein ARALYDRAFT_471281           49.3    0.001   Arabidopsis lyrata subsp. lyrata
ref|XP_009369233.1|  PREDICTED: uncharacterized protein LOC103958632  49.3    0.001   Pyrus x bretschneideri [bai li]
gb|KDO36696.1|  hypothetical protein CISIN_1g017568mg                 49.3    0.001   Citrus sinensis [apfelsine]



>ref|XP_004232206.1| PREDICTED: uncharacterized protein At5g39570 [Solanum lycopersicum]
Length=362

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 138/203 (68%), Gaps = 19/203 (9%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSYYPKGHH  DDD  +FDE+DPTPY GGYDI +TYGRP+ PSEETCY  SSAS +FDYD
Sbjct  1    MSYYPKGHH--DDDGTEFDEYDPTPYGGGYDIALTYGRPLPPSEETCYQPSSASDEFDYD  58

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggyg-----  390
            RPQYTS+AEPSAY DEALDNEY+SY++PKPRP PSY  S E     +P    G+      
Sbjct  59   RPQYTSYAEPSAYGDEALDNEYQSYSRPKPRPTPSYRPSEETHTYEQPQADYGFQPGVNR  118

Query  391  -geseygseggygrrpeQQRPSSEYGSGY------ERPDSEYGSGHGRK-----PSSEYG  534
             G       G   +   ++ P+SEYGSGY      E P  +YGSG+GRK     PSSEYG
Sbjct  119  PGGESEYGSGYGRKSEYEEEPTSEYGSGYGRKSEYEEPKPQYGSGYGRKSEYEEPSSEYG  178

Query  535  SGYGRRNEDERPDSEYGSGNRRK  603
            SGYGR++E E P  +YGSG  RK
Sbjct  179  SGYGRKSEYEEPTPQYGSGYGRK  201


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 63/99 (64%), Gaps = 24/99 (24%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRK-----PSSEYGSGYGR-------------  549
            + PSSEYGSGY      E P  +YGSG+GRK     PSSEYGSGYGR             
Sbjct  171  EEPSSEYGSGYGRKSEYEEPTPQYGSGYGRKSEYQEPSSEYGSGYGRKSEYEEPTPQYGR  230

Query  550  RNEDERPDSEYGSGNRRKPsyeeggseygsgygRRNESE  666
            R+E E P SEYGSG R+K  YEE  SEYGSGYGRRNESE
Sbjct  231  RSEYEEPASEYGSGYRKKSEYEEPSSEYGSGYGRRNESE  269



>ref|XP_009608846.1| PREDICTED: uncharacterized protein At5g39570-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   156 bits (394),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 140/204 (69%), Gaps = 18/204 (9%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSYYPKG+H  DD+  +FDE+DPTPY GGYDI +TYGRP+ PS+ETCY  +SAS +FDYD
Sbjct  1    MSYYPKGYHGEDDEGAEFDEYDPTPYGGGYDIALTYGRPLPPSDETCYQPTSASDEFDYD  60

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSY-------GGSSEAgynrrpggggg  384
            RPQY+S+AEPSAY DEAL+ EY+SY++PKPRP PSY       G + E          G 
Sbjct  61   RPQYSSYAEPSAYGDEALETEYQSYSRPKPRPTPSYHRPSEEEGEAYEQPQPNYGFQPGM  120

Query  385  yggeseygseggygrrpeQQRPSSEYGSGYER------PDSEYGSGHGRK-----PSSEY  531
                  YG E  YGR+ E + P+SEYGSGY R      P SEYGSG+GRK     P+ +Y
Sbjct  121  NRPGGGYGGESEYGRKSEYEEPASEYGSGYGRKSEYVEPVSEYGSGYGRKSEYEEPTPQY  180

Query  532  GSGYGRRNEDERPDSEYGSGNRRK  603
            GSGYGR++E E P SEYGSG  RK
Sbjct  181  GSGYGRKSEYEEPKSEYGSGYGRK  204


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 60/86 (70%), Gaps = 11/86 (13%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRK-----PSSEYGSGYGRRNEDERPDSEYGS  588
            + P+ +YGSGY      E P SEYGSG+GRK     P+SEYGSGYGR++E E P  EYGS
Sbjct  174  EEPTPQYGSGYGRKSEYEEPKSEYGSGYGRKSEYEEPTSEYGSGYGRKSEYEEPAPEYGS  233

Query  589  GNRRKPsyeeggseygsgygRRNESE  666
            G RRK  YEE  SEY SGY RRNESE
Sbjct  234  GYRRKSEYEEPSSEYESGYERRNESE  259



>ref|XP_009781780.1| PREDICTED: uncharacterized protein At5g39570 [Nicotiana sylvestris]
Length=332

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 148/236 (63%), Gaps = 29/236 (12%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSYYPKG+H  DDD  +FDE+DPTPY GGYDI +TYGRP+ PS+ETCY  SSAS +FDYD
Sbjct  1    MSYYPKGYHGEDDDGAEFDEYDPTPYGGGYDIALTYGRPLPPSDETCYQTSSASDEFDYD  60

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpggggg-------  384
            RPQY+S+AEPSAY +EAL+ EY+SY++PKPRP PSY   SE                   
Sbjct  61   RPQYSSYAEPSAYGEEALETEYQSYSRPKPRPTPSYHRPSEEEGEAYEQPQADYGFQPGM  120

Query  385  -----------yggeseygseggygrrpeQQRPSSEYGSG------YERPDSEYGSGHGR  513
                         G            +PE   P+SEYGSG      YE P  EYGSG+GR
Sbjct  121  NRPGGGYGGESEYGSGYGRKTEYEEPKPEYVEPASEYGSGYGRKSEYEEPKPEYGSGYGR  180

Query  514  K-----PSSEYGSGYGRRNEDERPDSEYGSGNRRKPsyeeggseygsgygRRNESE  666
            K     P+SEYGSGYGR++E E P  EYGSG RRK  YEE  SEYGSGY RR ESE
Sbjct  181  KSEYEEPTSEYGSGYGRKSEYEEPAPEYGSGYRRKSEYEEPRSEYGSGYERRTESE  236



>ref|XP_006338424.1| PREDICTED: uncharacterized protein At5g39570-like [Solanum tuberosum]
Length=355

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 131/199 (66%), Gaps = 15/199 (8%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSYYPKGHH  DDD  +FDE+DPTPY GGYDI +TYGRP+ PSEETCY  SSAS +FDYD
Sbjct  1    MSYYPKGHH--DDDGAEFDEYDPTPYGGGYDIALTYGRPLPPSEETCYQPSSASDEFDYD  58

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggyg-----  390
            RPQYTS+AEPSAY DEALDNEY+SY++PKPRP PSY  S E+    +P    G+      
Sbjct  59   RPQYTSYAEPSAYGDEALDNEYQSYSRPKPRPTPSYRPSEESHTYEQPQADYGFQPGVNR  118

Query  391  -geseygseggygrrpeQQRPSSEYG--SGYERPDSEYGSGHGRK-----PSSEYGSGYG  546
             G                    S YG  S YE P  +YGSG+GRK     PSSEYGSGYG
Sbjct  119  PGGESEYGRKSEYEEEPTPEYGSGYGRKSEYEEPKPQYGSGYGRKSEYEEPSSEYGSGYG  178

Query  547  RRNEDERPDSEYGSGNRRK  603
            R++E E P  +YGSG  RK
Sbjct  179  RKSEYEEPTPQYGSGYGRK  197


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 62/95 (65%), Gaps = 20/95 (21%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRK-----PSSEYG---------SGYGRRNED  561
            + PSSEYGSGY      E P  +YGSG+GRK     PSSEYG         + YGR++E 
Sbjct  167  EEPSSEYGSGYGRKSEYEEPTPQYGSGYGRKSEYQEPSSEYGRKTEYEEPTAQYGRKSEY  226

Query  562  ERPDSEYGSGNRRKPsyeeggseygsgygRRNESE  666
            E P SEYGSG R+K  YEE  SEYGSGYGR+NESE
Sbjct  227  EEPASEYGSGYRKKSEYEEPSSEYGSGYGRKNESE  261



>ref|XP_002283932.1| PREDICTED: uncharacterized protein At5g39570 [Vitis vinifera]
Length=383

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 116/205 (57%), Gaps = 60/205 (29%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDITV YGRP+ PSEETCYPISS SGD DYDRP YTS +EPSAY DEAL+NEY
Sbjct  18   PTPYGGGYDITVIYGRPLEPSEETCYPISSKSGDIDYDRPSYTSCSEPSAYGDEALENEY  77

Query  292  KSYAKPK-----------------------------PRPGPSYGGSSEAgynrrpggggg  384
            KSYA+PK                             P+P  S+GG  E G          
Sbjct  78   KSYARPKPRPVLGYAGPPPGQGGFGGSGDGGEYGYQPKPPSSFGGEGEYGSGHGRKPDY-  136

Query  385  yggeseygseggygrrpeQQRPSSEYGSGY------ERPDSEYGSGHGRKP-----SSEY  531
                               + PSSEYGSGY      E+P SEYGSG+GRKP     SSEY
Sbjct  137  -------------------EEPSSEYGSGYGRKPECEQPSSEYGSGYGRKPEYEQPSSEY  177

Query  532  GSGYGRRNEDERPDSEYGSGNRRKP  606
            GSGYGR+ E E+P SEYGSG  RKP
Sbjct  178  GSGYGRKPEYEQPSSEYGSGYGRKP  202


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 11/66 (17%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRKP-----SSEYGSGYGRRNEDERPDSEYGS  588
            ++PS+EYGSGY      E+P SEYGSG+GR+P     SSEYGSGYGRR E E P SEYGS
Sbjct  205  EQPSTEYGSGYGRKPEYEQPSSEYGSGYGRRPEFEQPSSEYGSGYGRRPEYEAPSSEYGS  264

Query  589  GNRRKP  606
            G  RKP
Sbjct  265  GYGRKP  270


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 11/66 (17%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRKP-----SSEYGSGYGRRNEDERPDSEYGS  588
            ++PSSEYGSGY      E+P SEYGSG+GRKP     S+EYGSGYGR+ E E+P SEYGS
Sbjct  171  EQPSSEYGSGYGRKPEYEQPSSEYGSGYGRKPEYEQPSTEYGSGYGRKPEYEQPSSEYGS  230

Query  589  GNRRKP  606
            G  R+P
Sbjct  231  GYGRRP  236



>ref|XP_011098657.1| PREDICTED: uncharacterized protein At5g39570-like [Sesamum indicum]
Length=335

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 141/213 (66%), Gaps = 33/213 (15%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDFDY  222
            MSY+PKGHH   D+VDDFDE+DPTPY GGYDI +TYGRP+  SEETCYP  SSAS DFDY
Sbjct  1    MSYFPKGHHDTGDEVDDFDEYDPTPYGGGYDIALTYGRPLPHSEETCYPNTSSASDDFDY  60

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggese  402
            DRPQYTS+AEPSAYAD+ALDNEYKSYA+P+PR        S+       GG   YG    
Sbjct  61   DRPQYTSYAEPSAYADDALDNEYKSYARPRPR-------PSQPRPGGGYGGESEYGSGGG  113

Query  403  ygseggygrrpeQQRPSSEYGS--------------------GYERPDSEYGSGHGRK--  516
                 GYGR+PE +RP SEYGS                     YERPDSEYGS +GRK  
Sbjct  114  SEYGSGYGRKPEYERPDSEYGSEYGRKPEYEQSYGSGYGRKPEYERPDSEYGSEYGRKPE  173

Query  517  ---PSSEYGSGYGRRNEDERPDSEYGSGNRRKP  606
               PSSEYGSGYGR++E + P SEY SG  RKP
Sbjct  174  YERPSSEYGSGYGRKSEYQEPTSEYSSGYGRKP  206



>ref|XP_009772867.1| PREDICTED: uncharacterized protein At5g39570-like [Nicotiana 
sylvestris]
Length=508

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 137/213 (64%), Gaps = 28/213 (13%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDFDY  222
            MSYYPKGH    DDV +FDE+D TPY GGYDI++TYGRPI PSEETCYP  SSAS DFDY
Sbjct  1    MSYYPKGHRD-SDDVPEFDEYDHTPYGGGYDISLTYGRPIPPSEETCYPPTSSASDDFDY  59

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSE----------------Ag  354
            DRP Y+S AEPSAYADEALDNEY+SY+KPK +P PS  G  E                  
Sbjct  60   DRPHYSSSAEPSAYADEALDNEYQSYSKPKTKPRPSKDGDDENEKPRRNPGMNRPSDGGS  119

Query  355  ynrrpgggggyggeseygseggygrrpeQQRPSSEYGSGYER---PDSEYGSGHGR----  513
                   G G   E E   +G   +  E + P SEYGSGY R   PDSEYGSG+GR    
Sbjct  120  GIESDETGYGSRTEYEKPKKGYGRKSDEDEEPKSEYGSGYGRKSEPDSEYGSGYGRKSEY  179

Query  514  -KPSSEYGS-GYGRRNE-DERPDSEYGSGNRRK  603
             KPSS+YGS GYGR+++ DE P SEYGS   RK
Sbjct  180  EKPSSDYGSAGYGRKSKYDEEPTSEYGSSYGRK  212



>gb|KDO36694.1| hypothetical protein CISIN_1g017568mg [Citrus sinensis]
Length=349

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 117/170 (69%), Gaps = 14/170 (8%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPYDGGYDIT+TYGRP+ PS+ETCYP SSAS GDFDY RP+++SH+EPSAYADEAL+NE
Sbjct  19   PTPYDGGYDITLTYGRPLPPSDETCYPSSSASDGDFDYARPKFSSHSEPSAYADEALNNE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA+PKPRP    G    +G     GG         +    G        RP SEY S
Sbjct  79   YSSYARPKPRP----GFVPGSGGGSGYGGRPQPQPAYGFQPGMGRPEPYGSGRPESEYAS  134

Query  469  GY-ERPDS-EYGSGHGRKPSSE-YGSGYGRRNEDERPDSE-YGSGNRRKP  606
            GY +RPDS EYGSG+G++P SE YGSGYGR     +PDSE +GSG  R+P
Sbjct  135  GYAKRPDSQEYGSGYGKRPESEEYGSGYGR-----KPDSEVHGSGYGRRP  179



>ref|XP_010672883.1| PREDICTED: uncharacterized protein At5g39570 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=343

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 128/201 (64%), Gaps = 25/201 (12%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYP-ISSASGD--F  216
            MSYYP+G    DD+ DDFDE+DPTPY GGYD ++TYGRPISP  ETCYP  SS SGD   
Sbjct  1    MSYYPRGRGGDDDNADDFDEYDPTPYGGGYDQSLTYGRPISPCHETCYPPSSSGSGDTEL  60

Query  217  DYDRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggygge  396
            DYDRPQYTS+A+PSAY +EA +NEYKSY +P  RP  SYGG+ +       G G      
Sbjct  61   DYDRPQYTSYAQPSAYGEEAQENEYKSYTRPNYRPPVSYGGTPQPAPGYGSGSGFQPHLP  120

Query  397  seygseggygrrpeQQRPSSEYGSG------YERPDSEYGSGHGRK-----PSSEYGSGY  543
                           + P+SEYGSG      YE P SEYGSG+G +     PSSEYGSGY
Sbjct  121  QPEY-----------EEPTSEYGSGYGRKPQYEAPSSEYGSGYGGRPQYEAPSSEYGSGY  169

Query  544  GRRNEDERPDSEYGSGNRRKP  606
            GR+ E E P SEYGSG  RKP
Sbjct  170  GRKPEHEAPSSEYGSGYGRKP  190


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 11/64 (17%)
 Frame = +1

Query  442  QRPSSEYGSG------YERPDSEYGSGHGRK-----PSSEYGSGYGRRNEDERPDSEYGS  588
            + PSSEYGSG      YE P  EYGSG+GRK     PS+EYGSGYGR+NE E P +EYGS
Sbjct  210  EAPSSEYGSGHGGRPQYEAPSPEYGSGYGRKSEYEAPSAEYGSGYGRKNEYEAPSAEYGS  269

Query  589  GNRR  600
            G  R
Sbjct  270  GYGR  273


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 44/65 (68%), Gaps = 11/65 (17%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRKP-----SSEYGSGYGRRNEDERPDSEYGS  588
            + PSSEYGSGY      E P SEYGSGHG +P     S EYGSGYGR++E E P +EYGS
Sbjct  193  EAPSSEYGSGYGGRPQYEAPSSEYGSGHGGRPQYEAPSPEYGSGYGRKSEYEAPSAEYGS  252

Query  589  GNRRK  603
            G  RK
Sbjct  253  GYGRK  257



>ref|XP_011014109.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Populus euphratica]
Length=413

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 116/185 (63%), Gaps = 23/185 (12%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG   E         G    G  E             +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYG---EPQPAYGFQPGMNRPGLDESDGYVKPASEEYGRRPESEYGSG  136

Query  469  GYERPDS-EYGSGHGRKPS-----------SEYGSGYGRRNE------DERPDS-EYGSG  591
            GY  P S EYGSG+GRKP            SEYGS YGRR E      +ERP S EYGSG
Sbjct  137  GYGNPQSEEYGSGYGRKPESEYESGGHVRPSEYGSVYGRRQESEYGSGNERPQSEEYGSG  196

Query  592  NRRKP  606
              R+P
Sbjct  197  YGRRP  201



>ref|XP_011014107.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Populus euphratica]
Length=430

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 116/185 (63%), Gaps = 23/185 (12%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG   E         G    G  E             +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYG---EPQPAYGFQPGMNRPGLDESDGYVKPASEEYGRRPESEYGSG  136

Query  469  GYERPDS-EYGSGHGRKPS-----------SEYGSGYGRRNE------DERPDS-EYGSG  591
            GY  P S EYGSG+GRKP            SEYGS YGRR E      +ERP S EYGSG
Sbjct  137  GYGNPQSEEYGSGYGRKPESEYESGGHVRPSEYGSVYGRRQESEYGSGNERPQSEEYGSG  196

Query  592  NRRKP  606
              R+P
Sbjct  197  YGRRP  201



>ref|XP_010672882.1| PREDICTED: uncharacterized protein At5g39570 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=361

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 129/208 (62%), Gaps = 21/208 (10%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYP-ISSASGD--F  216
            MSYYP+G    DD+ DDFDE+DPTPY GGYD ++TYGRPISP  ETCYP  SS SGD   
Sbjct  1    MSYYPRGRGGDDDNADDFDEYDPTPYGGGYDQSLTYGRPISPCHETCYPPSSSGSGDTEL  60

Query  217  DYDRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggygge  396
            DYDRPQYTS+A+PSAY +EA +NEYKSY +P  RP  SYGG+ +       G G      
Sbjct  61   DYDRPQYTSYAQPSAYGEEAQENEYKSYTRPNYRPPVSYGGTPQPAPGYGSGSGFQPHLP  120

Query  397  seygseggygrrpeQQR------PSSEYGSG-------YERPDSEYGSGHGRK-----PS  522
                 E          R      PSSEYGSG       YE P SEYGSG+G +     PS
Sbjct  121  QPEYEEPTSEYGSGYGRKPQYEAPSSEYGSGYGGRKPDYEAPSSEYGSGYGGRPQYEAPS  180

Query  523  SEYGSGYGRRNEDERPDSEYGSGNRRKP  606
            SEYGSGYGR+ E E P SEYGSG  RKP
Sbjct  181  SEYGSGYGRKPEHEAPSSEYGSGYGRKP  208


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 11/64 (17%)
 Frame = +1

Query  442  QRPSSEYGSG------YERPDSEYGSGHGRK-----PSSEYGSGYGRRNEDERPDSEYGS  588
            + PSSEYGSG      YE P  EYGSG+GRK     PS+EYGSGYGR+NE E P +EYGS
Sbjct  228  EAPSSEYGSGHGGRPQYEAPSPEYGSGYGRKSEYEAPSAEYGSGYGRKNEYEAPSAEYGS  287

Query  589  GNRR  600
            G  R
Sbjct  288  GYGR  291


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 44/65 (68%), Gaps = 11/65 (17%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRKP-----SSEYGSGYGRRNEDERPDSEYGS  588
            + PSSEYGSGY      E P SEYGSGHG +P     S EYGSGYGR++E E P +EYGS
Sbjct  211  EAPSSEYGSGYGGRPQYEAPSSEYGSGHGGRPQYEAPSPEYGSGYGRKSEYEAPSAEYGS  270

Query  589  GNRRK  603
            G  RK
Sbjct  271  GYGRK  275


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 45/66 (68%), Gaps = 11/66 (17%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRKP-----SSEYGSGYGRRNEDERPDSEYGS  588
            + PSSEYGSGY      E P SEYGSG+GRKP     SSEYGSGYG R + E P SEYGS
Sbjct  177  EAPSSEYGSGYGRKPEHEAPSSEYGSGYGRKPEYEAPSSEYGSGYGGRPQYEAPSSEYGS  236

Query  589  GNRRKP  606
            G+  +P
Sbjct  237  GHGGRP  242



>ref|XP_006603877.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Glycine max]
Length=350

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 127/197 (64%), Gaps = 20/197 (10%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDY  222
            MSY+ +G    DD VDD+DE+DPTPY GGYDI +TYGRP+SPSEETCYP+ ++S  +FDY
Sbjct  1    MSYFSRGRRDDDDTVDDYDEYDPTPYGGGYDIHLTYGRPVSPSEETCYPLGASSDENFDY  60

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggese  402
            DRPQYTS+AEPSAY DEAL  EY SY++PKPRP P+ G +  AG          YG    
Sbjct  61   DRPQYTSYAEPSAYGDEALATEYSSYSRPKPRPAPA-GFNPAAGSGYGRKQESEYGSGYG  119

Query  403  ygseggygrrpeQQRPSSEYGSGYERP--------------DSEYGSGHGRKPSSEYGSG  540
               EG YG     ++  SEYGSGY R               DSEYGSG+GRK   E+GSG
Sbjct  120  RKEEGEYGSGYGGRKEESEYGSGYGRKEEGEYGSGYGGRKEDSEYGSGYGRKQEDEFGSG  179

Query  541  YGRRNEDERPDSEYGSG  591
            YG R E    +SEYGSG
Sbjct  180  YGGRKE----ESEYGSG  192



>ref|XP_003554616.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Glycine max]
Length=363

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 127/197 (64%), Gaps = 20/197 (10%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDY  222
            MSY+ +G    DD VDD+DE+DPTPY GGYDI +TYGRP+SPSEETCYP+ ++S  +FDY
Sbjct  1    MSYFSRGRRDDDDTVDDYDEYDPTPYGGGYDIHLTYGRPVSPSEETCYPLGASSDENFDY  60

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggese  402
            DRPQYTS+AEPSAY DEAL  EY SY++PKPRP P+ G +  AG          YG    
Sbjct  61   DRPQYTSYAEPSAYGDEALATEYSSYSRPKPRPAPA-GFNPAAGSGYGRKQESEYGSGYG  119

Query  403  ygseggygrrpeQQRPSSEYGSGYERP--------------DSEYGSGHGRKPSSEYGSG  540
               EG YG     ++  SEYGSGY R               DSEYGSG+GRK   E+GSG
Sbjct  120  RKEEGEYGSGYGGRKEESEYGSGYGRKEEGEYGSGYGGRKEDSEYGSGYGRKQEDEFGSG  179

Query  541  YGRRNEDERPDSEYGSG  591
            YG R E    +SEYGSG
Sbjct  180  YGGRKE----ESEYGSG  192



>ref|XP_006389471.1| hypothetical protein POPTR_0023s00630g [Populus trichocarpa]
 gb|ERP48385.1| hypothetical protein POPTR_0023s00630g [Populus trichocarpa]
Length=418

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 118/185 (64%), Gaps = 22/185 (12%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG    A   +      G   ES+   +         +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYGEPQPAYGFQPGMNRPGLEYESDGYVKPANEEYG--RRPESEYGSG  137

Query  469  GYERPDS-EYGSGHGRKPS-----------SEYGSGYGRRNEDE------RPDS-EYGSG  591
            GY +P S EY SG+GR+P            SEYGSG GRR E E      RP S EYGSG
Sbjct  138  GYGKPQSEEYRSGYGRRPESEYESGGHVRPSEYGSGDGRRQESEYGSGNARPQSEEYGSG  197

Query  592  NRRKP  606
              R+P
Sbjct  198  YGRRP  202


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRRKP  606
            +RP SEYGSGYE+P +EYGSG+GRK  +EYGSGY + +E      EYGSG  R+P
Sbjct  247  RRPDSEYGSGYEKP-TEYGSGYGRKSETEYGSGYEKPSEYGGGTVEYGSGYGRRP  300


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 8/55 (15%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDS-EYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRRK  603
            +R  SEYGSGYE+P S EYGSG+GR+P SEYGSGY      E+P +EYGSG  RK
Sbjct  223  RRKESEYGSGYEKPQSDEYGSGYGRRPDSEYGSGY------EKP-TEYGSGYGRK  270



>ref|XP_011008581.1| PREDICTED: uncharacterized protein At5g39570-like isoform X3 
[Populus euphratica]
Length=480

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 115/188 (61%), Gaps = 26/188 (14%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG   E         G    G  E             +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYG---EPQPAYGFQPGMNRPGLDESDGYVKPASEEYGRRPESEYGSG  136

Query  469  GYERPDS-EYGSGHGRKP-------------SSEYGSGYGRRNEDE-------RPDS-EY  582
            GY  P S EYGSG+GRKP             S EYGSGYGR+ E E        P S EY
Sbjct  137  GYGNPQSEEYGSGYGRKPESEYESGGYGNPQSEEYGSGYGRKPESEYESGGYGNPQSEEY  196

Query  583  GSGNRRKP  606
            GSG  RKP
Sbjct  197  GSGYGRKP  204



>ref|XP_011008580.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Populus euphratica]
Length=488

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 115/188 (61%), Gaps = 26/188 (14%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG   E         G    G  E             +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYG---EPQPAYGFQPGMNRPGLDESDGYVKPASEEYGRRPESEYGSG  136

Query  469  GYERPDS-EYGSGHGRKP-------------SSEYGSGYGRRNEDE-------RPDS-EY  582
            GY  P S EYGSG+GRKP             S EYGSGYGR+ E E        P S EY
Sbjct  137  GYGNPQSEEYGSGYGRKPESEYESGGYGNPQSEEYGSGYGRKPESEYESGGYGNPQSEEY  196

Query  583  GSGNRRKP  606
            GSG  RKP
Sbjct  197  GSGYGRKP  204



>ref|XP_011008579.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Populus euphratica]
Length=505

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 115/188 (61%), Gaps = 26/188 (14%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG   E         G    G  E             +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYG---EPQPAYGFQPGMNRPGLDESDGYVKPASEEYGRRPESEYGSG  136

Query  469  GYERPDS-EYGSGHGRKP-------------SSEYGSGYGRRNEDE-------RPDS-EY  582
            GY  P S EYGSG+GRKP             S EYGSGYGR+ E E        P S EY
Sbjct  137  GYGNPQSEEYGSGYGRKPESEYESGGYGNPQSEEYGSGYGRKPESEYESGGYGNPQSEEY  196

Query  583  GSGNRRKP  606
            GSG  RKP
Sbjct  197  GSGYGRKP  204



>ref|XP_010317110.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Solanum lycopersicum]
Length=304

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 121/190 (64%), Gaps = 13/190 (7%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSYYPKGHH   DDV +FDE+D TPY GGYDI VTYG PI PSEETCYP+SS S DFD+D
Sbjct  1    MSYYPKGHHH-SDDVPEFDEYDETPYGGGYDIKVTYGNPIPPSEETCYPLSSESDDFDHD  59

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPS-YGGSSEAgynrrpgggggyggese  402
            RP Y S AEPSAY+DEALDNEY++Y+KPK RP  S +    E    RR  G     G   
Sbjct  60   RPHYASSAEPSAYSDEALDNEYQNYSKPKTRPSRSRHEDGDEDENPRRKPGMNRPSGGGY  119

Query  403  ygseggygrrpeQQRPSSEYGSGYERP--DSEYGSGHGRKPSSE-----YGSGYGRRNED  561
             G      +  E   PSS+YGSGY R   D EYGS   RK   E     YGSGYGRR   
Sbjct  120  GGESEYNEQSSEYNEPSSDYGSGYGRKNDDDEYGSRQRRKSEDEEENADYGSGYGRR---  176

Query  562  ERPDSEYGSG  591
             + DS+YGSG
Sbjct  177  -QTDSQYGSG  185



>ref|XP_010317109.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Solanum lycopersicum]
Length=329

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 121/190 (64%), Gaps = 13/190 (7%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSYYPKGHH   DDV +FDE+D TPY GGYDI VTYG PI PSEETCYP+SS S DFD+D
Sbjct  1    MSYYPKGHHH-SDDVPEFDEYDETPYGGGYDIKVTYGNPIPPSEETCYPLSSESDDFDHD  59

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPS-YGGSSEAgynrrpgggggyggese  402
            RP Y S AEPSAY+DEALDNEY++Y+KPK RP  S +    E    RR  G     G   
Sbjct  60   RPHYASSAEPSAYSDEALDNEYQNYSKPKTRPSRSRHEDGDEDENPRRKPGMNRPSGGGY  119

Query  403  ygseggygrrpeQQRPSSEYGSGYERP--DSEYGSGHGRKPSSE-----YGSGYGRRNED  561
             G      +  E   PSS+YGSGY R   D EYGS   RK   E     YGSGYGRR   
Sbjct  120  GGESEYNEQSSEYNEPSSDYGSGYGRKNDDDEYGSRQRRKSEDEEENADYGSGYGRR---  176

Query  562  ERPDSEYGSG  591
             + DS+YGSG
Sbjct  177  -QTDSQYGSG  185



>ref|XP_012084739.1| PREDICTED: uncharacterized protein At5g39570 isoform X2 [Jatropha 
curcas]
Length=318

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 110/183 (60%), Gaps = 18/183 (10%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PSEETCYP SS++ + DYDRP YTS+AEPSAYAD+ L  EY
Sbjct  19   PTPYGGGYDIVLTYGRPIPPSEETCYPHSSSADEIDYDRPSYTSYAEPSAYADDHLQEEY  78

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQ----------  441
             SY +PKPRPGP++G +              YG +      G                  
Sbjct  79   SSYGRPKPRPGPAHGYTPGGEVFVDAKPEPAYGFQPGVTMPGSDYGSGGYGGRPSGEEYG  138

Query  442  ----QRPSSEYGSG--YERPDSEYGSGHGRKPSSEYGSGYGRRNED--ERPDSEYGSGNR  597
                QRP SEYGSG    RP+SEYG+G+ R P  EYGSGYGRR E   ERP SEYGSG  
Sbjct  139  SGYGQRPDSEYGSGGYGRRPESEYGTGYERPPGGEYGSGYGRRPEPGYERPSSEYGSGYG  198

Query  598  RKP  606
             +P
Sbjct  199  GRP  201



>ref|XP_012084738.1| PREDICTED: uncharacterized protein At5g39570 isoform X1 [Jatropha 
curcas]
 gb|KDP27176.1| hypothetical protein JCGZ_19875 [Jatropha curcas]
Length=319

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 110/183 (60%), Gaps = 18/183 (10%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PSEETCYP SS++ + DYDRP YTS+AEPSAYAD+ L  EY
Sbjct  19   PTPYGGGYDIVLTYGRPIPPSEETCYPHSSSADEIDYDRPSYTSYAEPSAYADDHLQEEY  78

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQ----------  441
             SY +PKPRPGP++G +              YG +      G                  
Sbjct  79   SSYGRPKPRPGPAHGYTPGGEVFVDAKPEPAYGFQPGVTMPGSDYGSGGYGGRPSGEEYG  138

Query  442  ----QRPSSEYGSG--YERPDSEYGSGHGRKPSSEYGSGYGRRNED--ERPDSEYGSGNR  597
                QRP SEYGSG    RP+SEYG+G+ R P  EYGSGYGRR E   ERP SEYGSG  
Sbjct  139  SGYGQRPDSEYGSGGYGRRPESEYGTGYERPPGGEYGSGYGRRPEPGYERPSSEYGSGYG  198

Query  598  RKP  606
             +P
Sbjct  199  GRP  201



>ref|XP_006482634.1| PREDICTED: uncharacterized protein At5g39570-like [Citrus sinensis]
Length=422

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 116/170 (68%), Gaps = 14/170 (8%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPYDGGYDIT+TYGRP+ PS+ETCYP SSAS GDFDY RP+++SH+EPSAYADEAL+NE
Sbjct  19   PTPYDGGYDITLTYGRPLPPSDETCYPSSSASDGDFDYARPKFSSHSEPSAYADEALNNE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA+PKPRPG        +G     GG              G        R  SEYGS
Sbjct  79   YSSYARPKPRPGFV----PGSGGGSGYGGRPQPQPAYGIQPGMGRPEPYGSGRSESEYGS  134

Query  469  GY-ERPDS-EYGSGHGRKPSSE-YGSGYGRRNEDERPDSE-YGSGNRRKP  606
            GY +RPDS EYGSG+G++P SE YGSGYGR     +PDSE YGSG  R+P
Sbjct  135  GYAKRPDSQEYGSGYGKRPESEEYGSGYGR-----KPDSEVYGSGYGRRP  179



>ref|XP_006389469.1| hypothetical protein POPTR_0023s00630g [Populus trichocarpa]
 gb|ERP48383.1| hypothetical protein POPTR_0023s00630g [Populus trichocarpa]
Length=402

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 114/176 (65%), Gaps = 20/176 (11%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG    A   +      G   ES+   +         +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYGEPQPAYGFQPGMNRPGLEYESDGYVKPANEEYG--RRPESEYGSG  137

Query  469  GYERPDS-EYGSGHGRKPS-----------SEYGSGYGRRNEDERPDSEYGSGNRR  600
            GY +P S EY SG+GR+P            SEYGSG GRR E     SEYGSGN R
Sbjct  138  GYGKPQSEEYRSGYGRRPESEYESGGHVRPSEYGSGDGRRQE-----SEYGSGNAR  188


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRRKP  606
            +RP SEYGSGYE+P +EYGSG+GRK  +EYGSGY + +E      EYGSG  R+P
Sbjct  247  RRPDSEYGSGYEKP-TEYGSGYGRKSETEYGSGYEKPSEYGGGTVEYGSGYGRRP  300



>ref|XP_009628950.1| PREDICTED: uncharacterized protein At5g39570-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 133/222 (60%), Gaps = 41/222 (18%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDFDY  222
            MSYYPKGH   DD  +  +    TPY GGYDI++TYGRPI PSEETCYP  SSAS DFDY
Sbjct  1    MSYYPKGHRDNDDVPEFDEYDH-TPYGGGYDISLTYGRPIPPSEETCYPPTSSASADFDY  59

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPK--PRPG-----------------------P  327
            DRP Y+S AEPSAYADEALDNEY+SY+KPK  PRP                        P
Sbjct  60   DRPHYSSSAEPSAYADEALDNEYQSYSKPKTKPRPSRSRPSKEEDDEDEKPQRKPGMNRP  119

Query  328  SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGSGYER---PDSEYG  498
            S GGS           G G   E E   +G   +  E +   SEYGSGY R   PDSEYG
Sbjct  120  SDGGSG----IESDETGYGSRTEYEKPKKGYGRKSDEDEELKSEYGSGYGRKSEPDSEYG  175

Query  499  SGHGRK-----PSSEYGS-GYGRRNE-DERPDSEYGSGNRRK  603
            SG+GRK     PSS+YGS G GR+++ DE P SEYGSG  RK
Sbjct  176  SGYGRKSEYEKPSSDYGSAGNGRKSKYDEEPTSEYGSGYGRK  217


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 7/58 (12%)
 Frame = +1

Query  451  SSEYGSGYERPD------SEYGSGHGRKPSS-EYGSGYGRRNEDERPDSEYGSGNRRK  603
            S+EYGSGY R        SEYGSG+GRK  S EYGSGYG++NE E   SEYGSG  RK
Sbjct  267  SNEYGSGYTRKSEYEEKSSEYGSGYGRKTDSDEYGSGYGKKNEYEEKSSEYGSGYERK  324



>ref|XP_006384339.1| hypothetical protein POPTR_0004s13090g [Populus trichocarpa]
 ref|XP_006389470.1| latex abundant protein 1 [Populus trichocarpa]
 gb|ERP48384.1| latex abundant protein 1 [Populus trichocarpa]
 gb|ERP62136.1| hypothetical protein POPTR_0004s13090g [Populus trichocarpa]
Length=415

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 114/176 (65%), Gaps = 20/176 (11%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPISSASG+ DYDRP Y+S++EPSAYADEAL+ EY
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDETCYPISSASGEIDYDRPNYSSYSEPSAYADEALETEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS-  468
             SYA+PKPRPG +YG    A   +      G   ES+   +         +RP SEYGS 
Sbjct  80   SSYARPKPRPGSTYGEPQPAYGFQPGMNRPGLEYESDGYVKPANEEYG--RRPESEYGSG  137

Query  469  GYERPDS-EYGSGHGRKPS-----------SEYGSGYGRRNEDERPDSEYGSGNRR  600
            GY +P S EY SG+GR+P            SEYGSG GRR E     SEYGSGN R
Sbjct  138  GYGKPQSEEYRSGYGRRPESEYESGGHVRPSEYGSGDGRRQE-----SEYGSGNAR  188


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRRKP  606
            +RP SEYGSGYE+P +EYGSG+GRK  +EYGSGY + +E      EYGSG  R+P
Sbjct  247  RRPDSEYGSGYEKP-TEYGSGYGRKSETEYGSGYEKPSEYGGGTVEYGSGYGRRP  300



>ref|XP_006431210.1| hypothetical protein CICLE_v10011817mg [Citrus clementina]
 gb|ESR44450.1| hypothetical protein CICLE_v10011817mg [Citrus clementina]
Length=422

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 117/170 (69%), Gaps = 14/170 (8%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPYDGGYDIT+TYGRP+ PS+ETCYP SSAS GDFDY RP+++SH+EPSAYADEAL+NE
Sbjct  19   PTPYDGGYDITLTYGRPLPPSDETCYPSSSASDGDFDYARPKFSSHSEPSAYADEALNNE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA+PKPRPG        +G     GG         +    G        RP SEY S
Sbjct  79   YSSYARPKPRPGFV----PGSGGGSGYGGRPQPQPAYGFQPGMGRPEPYGSGRPESEYAS  134

Query  469  GY-ERPDS-EYGSGHGRKPSSE-YGSGYGRRNEDERPDSE-YGSGNRRKP  606
            GY +RPDS EYGSG+G++P SE YGSGYGR     +PDSE +GSG  R+P
Sbjct  135  GYAKRPDSQEYGSGYGKRPESEEYGSGYGR-----KPDSEVHGSGYGRRP  179



>ref|XP_009360594.1| PREDICTED: uncharacterized protein At5g39570 [Pyrus x bretschneideri]
Length=411

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 123/181 (68%), Gaps = 16/181 (9%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRP+ PS+E+C+P SS S DFDYDRPQ++S +EP+AYADEAL++EY
Sbjct  19   PTPYGGGYDIYLTYGRPLDPSDESCHPNSSPSDDFDYDRPQFSSSSEPAAYADEALEDEY  78

Query  292  KSYAKPKPRPGPSY-----GGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSS  456
              YA+P  RPGP+      GG  E  Y  RP    G+    E   E GYGR+PE  +  S
Sbjct  79   THYARPTHRPGPAIGFNPGGGHPEGEYEGRPQPAYGFQPGGEERPESGYGRKPEYGQSGS  138

Query  457  EYGSGYER------PDSEYGSGHGRK-----PSSEYGSGYGRRNEDERPDSEYGSGNRRK  603
            EYGSGY+R      P SEYGSG+GRK     P SEYGSGYGR+ E + P+ EYGSG  RK
Sbjct  139  EYGSGYQRRPESDEPGSEYGSGYGRKPVYEAPESEYGSGYGRKPEYKAPEPEYGSGYGRK  198

Query  604  P  606
            P
Sbjct  199  P  199


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 11/64 (17%)
 Frame = +1

Query  448  PSSEYGSGYER------PDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYGSGN  594
            P SEYGSGY R      P+ EYGSG+GRKP      SEYGSGYGR+ E + P+ EYGSG 
Sbjct  170  PESEYGSGYGRKPEYKAPEPEYGSGYGRKPEYEAPESEYGSGYGRKPEYKAPEPEYGSGY  229

Query  595  RRKP  606
            RRKP
Sbjct  230  RRKP  233


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 11/64 (17%)
 Frame = +1

Query  448  PSSEYGSGYER------PDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYGSGN  594
            P SEYGSGY R      P+ EYGSG+ RKP      SEYGSGYGR+ E E P +E+GSG 
Sbjct  204  PESEYGSGYGRKPEYKAPEPEYGSGYRRKPEYEAPESEYGSGYGRKPEFEAPPAEFGSGY  263

Query  595  RRKP  606
             RKP
Sbjct  264  DRKP  267



>ref|XP_006363410.1| PREDICTED: uncharacterized protein At5g39570-like [Solanum tuberosum]
Length=341

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 123/207 (59%), Gaps = 26/207 (13%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDFDY  222
            MSYYPKGHH   DDV +FDE+D TPY GGYDI +TYGRPI PSEETCYP +SS S DFDY
Sbjct  1    MSYYPKGHHH-SDDVPEFDEYDQTPYGGGYDIELTYGRPIPPSEETCYPPMSSESDDFDY  59

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPG---PSYGGSSEAg----------ynr  363
            DRP YTS AEPSAY DEALDNEY+SY+KPK RP    PS  G  +               
Sbjct  60   DRPHYTSSAEPSAYGDEALDNEYQSYSKPKTRPSRSRPSRDGDEDENPSRKPGMNRPSGG  119

Query  364  rpgggggyggeseygseggygrrpeQQRPSSEYGSGYERP--DSEYGSGHGRK-----PS  522
              GG   Y                E   PSS+YGSGY R   D EYGS   RK      +
Sbjct  120  GYGGESEYDESGYGRKGKYNDESSEYNEPSSDYGSGYGRKNDDDEYGSRQRRKSEDEEEN  179

Query  523  SEYGSGYGRRNEDERPDSEYGSGNRRK  603
            +EYGSGYGRR    + DSEY SG  RK
Sbjct  180  TEYGSGYGRR----KTDSEYESGYGRK  202



>gb|EYU44134.1| hypothetical protein MIMGU_mgv1a011784mg [Erythranthe guttata]
Length=271

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 116/196 (59%), Gaps = 23/196 (12%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPI-SSASGDFDY  222
            MSY+PKGHH GD   D  +    TPY GGYDI +TYGRP+ PSEETCYPI SS S  FDY
Sbjct  1    MSYFPKGHHDGDAVDDFDEFDS-TPYGGGYDIVLTYGRPLPPSEETCYPITSSGSESFDY  59

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPG-PSYGGSSEAgynrrpgggggygges  399
            DRPQYTS+AEPSAY DEALDNEYKSYA+PKPRP  PSYGG   +      G         
Sbjct  60   DRPQYTSYAEPSAYGDEALDNEYKSYARPKPRPARPSYGGPPPS--EPGYGYDRPKPSYG  117

Query  400  eygseggygrrpeQQRPSSEYGSG-------YERPDSEYGSGHGRKPSSEY-GSGYGRRN  555
                 G  G      RP  EYGSG       YE P  EY    GRK   EY GSGYGRR 
Sbjct  118  GESEYGSGGGSEFGGRP--EYGSGGYGRKSEYEEPAPEY----GRKSEPEYGGSGYGRRP  171

Query  556  EDERPDSEYGSGNRRK  603
            E E    EYGSG   K
Sbjct  172  EAE----EYGSGGYVK  183



>gb|KDO36693.1| hypothetical protein CISIN_1g017568mg [Citrus sinensis]
Length=369

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 112/182 (62%), Gaps = 25/182 (14%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPYDGGYDIT+TYGRP+ PS+ETCYP SSAS GDFDY RP+++SH+EPSAYADEAL+NE
Sbjct  19   PTPYDGGYDITLTYGRPLPPSDETCYPSSSASDGDFDYARPKFSSHSEPSAYADEALNNE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA+PKPRP    G    +G     GG         +    G        RP SEY S
Sbjct  79   YSSYARPKPRP----GFVPGSGGGSGYGGRPQPQPAYGFQPGMGRPEPYGSGRPESEYAS  134

Query  469  GY-ERPDS--------------EYGSGHGRKPSSEYG-SGYGRRNEDERPDSEYGSGNRR  600
            GY +RPDS              EYGSG+GRKP SE G SG+G R E E   S YG    R
Sbjct  135  GYAKRPDSQEYGSGYGKRPESEEYGSGYGRKPDSESGESGFGGRTESEYGGSAYG----R  190

Query  601  KP  606
            KP
Sbjct  191  KP  192



>gb|AFK47564.1| unknown [Lotus japonicus]
Length=331

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 106/189 (56%), Gaps = 59/189 (31%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRPI PS+ETCYPI  +   FDYDRPQY+SHAEPSAYA+EALD EY
Sbjct  22   PTPYGGGYDINLTYGRPIPPSDETCYPIGGSDESFDYDRPQYSSHAEPSAYANEALDVEY  81

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGSG  471
             SY++PKPRP P+                                  P   RPSSEY SG
Sbjct  82   SSYSRPKPRPAPA-------------------------------SFNPGYDRPSSEYESG  110

Query  472  YER-PDS-----EYGSGHGRKP-------------------SSEYGSGYGRRNEDERPDS  576
            Y R P+S     EYGSG+GRK                    SSEYGSGYGR+ E E   S
Sbjct  111  YGRKPESEYSGLEYGSGYGRKQEHQVTGSEYGSGYGGRKQESSEYGSGYGRKQESE---S  167

Query  577  EYGSGNRRK  603
            EYGSG  +K
Sbjct  168  EYGSGYEQK  176



>ref|XP_008230802.1| PREDICTED: uncharacterized protein At5g39570 [Prunus mume]
Length=468

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 115/176 (65%), Gaps = 12/176 (7%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTP+ GGYD+ +TYGR + PS+ETCYP SS S DFDY+RPQ++S++EPSAY +EALDNEY
Sbjct  20   PTPFGGGYDLFLTYGRALEPSDETCYPNSSPSDDFDYERPQFSSYSEPSAYDEEALDNEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGSG  471
             SYA+P  RPGP+ G  +  G +     GG       +   G        +RP S +GSG
Sbjct  80   SSYARPTHRPGPAIG-FTPGGGDPEGEHGGRPQPAYGFQPGGEDRPEYGSERPDSGHGSG  138

Query  472  Y------ERPDSEYGSGHGRKP-----SSEYGSGYGRRNEDERPDSEYGSGNRRKP  606
            Y      E+P SEYGSG+ R+P     SSEYGSGYGR+ E E P+ EYGSG  RKP
Sbjct  139  YGRKPGYEQPGSEYGSGYRRRPESDEPSSEYGSGYGRKPEYETPEPEYGSGYGRKP  194


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 43/66 (65%), Gaps = 11/66 (17%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYGS  588
            + P  EYGSGY      E P+ EYGSG+GRKP       EYGSGYGR+ E E P+SE+GS
Sbjct  180  ETPEPEYGSGYGRKPEYETPEPEYGSGYGRKPEYETPEPEYGSGYGRKPEYEAPESEHGS  239

Query  589  GNRRKP  606
            G  RKP
Sbjct  240  GYGRKP  245



>ref|XP_008353427.1| PREDICTED: uncharacterized protein At5g39570-like [Malus domestica]
Length=415

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 125/198 (63%), Gaps = 33/198 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRP+ PS+E+C+P SS S DFDYDRPQ++S++EP+AYADEAL++EY
Sbjct  19   PTPYGGGYDIYLTYGRPLDPSDESCHPNSSPSDDFDYDRPQFSSYSEPAAYADEALEDEY  78

Query  292  KSYAKPKPRPGPSY-----GGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSS  456
              YA+P  RPGP+      GG  E  Y  RP    G+    E   E GYGR+PE  +  S
Sbjct  79   THYARPTHRPGPAVGFNPGGGHPEGEYEGRPQPAYGFQPGGEVRPESGYGRKPEYGQSGS  138

Query  457  EYGSGYER-----------------------PDSEYGSGHGRKPS-----SEYGSGYGRR  552
            EYGSGY+R                       P+SEYGSG+GRKP       EYGSGYGR+
Sbjct  139  EYGSGYQRRPESDEPGSEYGSGYGRKPEYEAPESEYGSGYGRKPEYKAPEPEYGSGYGRK  198

Query  553  NEDERPDSEYGSGNRRKP  606
             E E P+SEYGSG  RKP
Sbjct  199  PEYEAPESEYGSGYGRKP  216


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 11/64 (17%)
 Frame = +1

Query  448  PSSEYGSGYER------PDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYGSGN  594
            P SEYGSGY R      P+ EYGSG+GRKP      SEYGSGYGR+ E + P+ EY SG 
Sbjct  170  PESEYGSGYGRKPEYKAPEPEYGSGYGRKPEYEAPESEYGSGYGRKPEYKAPEPEYESGY  229

Query  595  RRKP  606
             RKP
Sbjct  230  GRKP  233



>ref|XP_008379385.1| PREDICTED: uncharacterized protein At5g39570-like [Malus domestica]
Length=443

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 117/205 (57%), Gaps = 41/205 (20%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +T+GRP+ PS+ETCYP SS S DFDY+RPQ++S++EPSAYADEAL++EY
Sbjct  19   PTPYGGGYDIYLTFGRPLXPSDETCYPNSSPSDDFDYERPQFSSYSEPSAYADEALEDEY  78

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSS-----  456
              YA+P  RPGP+ G  +  G +      G       +   G        +RP S     
Sbjct  79   THYARPAHRPGPAVG-FNPGGGHPEGEYEGRPQPAYGFQXGGEERPEFGSERPESGYGRK  137

Query  457  --------EYGSGYER----------------------PDSEYGSGHGRKPS-----SEY  531
                    EYGSGY+R                      P+SEYGSGHGRKP       EY
Sbjct  138  PEYGQSGSEYGSGYQRRPEADEPSSEYTGYGRKPEHEEPESEYGSGHGRKPEYKAPEPEY  197

Query  532  GSGYGRRNEDERPDSEYGSGNRRKP  606
            GSGYGR+ E E P+SEYGSG  RKP
Sbjct  198  GSGYGRKPEYEAPESEYGSGYGRKP  222


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 44/67 (66%), Gaps = 11/67 (16%)
 Frame = +1

Query  439  QQRPSSEYGSG------YERPDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYG  585
             + P SEYGSG      Y+ P+ EYGSG+GRKP      SEYGSGYGR+ E E P +E+G
Sbjct  173  HEEPESEYGSGHGRKPEYKAPEPEYGSGYGRKPEYEAPESEYGSGYGRKPEFEAPPAEFG  232

Query  586  SGNRRKP  606
            SG  RKP
Sbjct  233  SGYGRKP  239



>gb|EPS71766.1| hypothetical protein M569_03001, partial [Genlisea aurea]
Length=190

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 107/180 (59%), Gaps = 44/180 (24%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDI++TYGRP+ PSEETCYP  SSASGDFDYDRPQ+ + + PSAYA EALD+E
Sbjct  12   PTPYGGGYDISLTYGRPLPPSEETCYPNTSSASGDFDYDRPQFNTGSHPSAYAGEALDDE  71

Query  289  YKSYAKPKPRPGP--SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SYA+PKPRP P  SYGGS                                  +P  +Y
Sbjct  72   YNSYARPKPRPNPPSSYGGSDYGRRPDYG-------------------------QPEPDY  106

Query  463  GSGYERPDSEYGSGHGRKPS---------SEYGSGYGRRNEDER---PDSEYGSGNRRKP  606
            G    +P+ +YGS +GR+P          S++GSGYGR+ E ER   P SEYGSG  R P
Sbjct  107  G----QPEPDYGSEYGRRPQYVDPSSEYGSDFGSGYGRKPEYERPPPPSSEYGSGYGRNP  162



>ref|XP_008341598.1| PREDICTED: uncharacterized protein At5g39570 [Malus domestica]
Length=415

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 124/198 (63%), Gaps = 33/198 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI +TYGRP+ PS+E+C+P SS S DFDYDRPQ++S++EP+AYADEAL++EY
Sbjct  19   PTPYGGGYDIYLTYGRPLDPSDESCHPNSSPSDDFDYDRPQFSSYSEPAAYADEALEDEY  78

Query  292  KSYAKPKPRPGPSY-----GGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSS  456
              YA+P  RPGP+      GG  E  Y  RP    G+    E   E GYGR+PE  +  S
Sbjct  79   THYARPTHRPGPAVGFNPGGGHPEGEYEGRPQPAYGFQPGGEVRPESGYGRKPEYGQSGS  138

Query  457  EYGSGYER------PDSEYGSGHGRKPS----------------------SEYGSGYGRR  552
            EYGSGY+R      P SEYGSG+GRKP                        EYGSGYGR+
Sbjct  139  EYGSGYQRRPESDEPGSEYGSGYGRKPEYEAPESEYGSGYGRXPEYKAPEPEYGSGYGRK  198

Query  553  NEDERPDSEYGSGNRRKP  606
             E E P+SEYGSG  RKP
Sbjct  199  PEYEAPESEYGSGYGRKP  216


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 11/64 (17%)
 Frame = +1

Query  448  PSSEYGSGYER------PDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYGSGN  594
            P SEYGSGY R      P+ EYGSG+GRKP      SEYGSGYGR+ E + P+ EY SG 
Sbjct  170  PESEYGSGYGRXPEYKAPEPEYGSGYGRKPEYEAPESEYGSGYGRKPEYKAPEPEYESGY  229

Query  595  RRKP  606
             RKP
Sbjct  230  GRKP  233



>ref|XP_007215367.1| hypothetical protein PRUPE_ppa005604mg [Prunus persica]
 gb|EMJ16566.1| hypothetical protein PRUPE_ppa005604mg [Prunus persica]
Length=452

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 111/192 (58%), Gaps = 27/192 (14%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYD+ +TYGR + PS+ETCYP SS S DFDY+RPQ++S++EPSAY +EALDNEY
Sbjct  20   PTPYGGGYDLFLTYGRALEPSDETCYPNSSPSDDFDYERPQFSSYSEPSAYDEEALDNEY  79

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQ----------  441
             SYA+P   PGP+ G +   G      GG                    +          
Sbjct  80   SSYARPTHLPGPAIGFTPGGGDPEGEHGGRPQPAYGFQPGGEDRPEYGSERPDLGHGSGY  139

Query  442  ------QRPSSEYGSGYER------PDSEYGSGHGRKP-----SSEYGSGYGRRNEDERP  570
                  ++P SEYGSGY R      P SEYGSG+GRKP       EYGSGYGR+ E E P
Sbjct  140  GRKPGYEQPGSEYGSGYRRRPESDEPSSEYGSGYGRKPVYETPEPEYGSGYGRKPEYETP  199

Query  571  DSEYGSGNRRKP  606
            + EYGSG  RKP
Sbjct  200  EPEYGSGYGRKP  211


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 43/66 (65%), Gaps = 11/66 (17%)
 Frame = +1

Query  442  QRPSSEYGSGY------ERPDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYGS  588
            + P  EYGSGY      E P+ EYGSG+GRKP       EYGSGYGR+ E E P+SE+GS
Sbjct  180  ETPEPEYGSGYGRKPEYETPEPEYGSGYGRKPEYETPEPEYGSGYGRKPEYEAPESEHGS  239

Query  589  GNRRKP  606
            G  RKP
Sbjct  240  GYGRKP  245



>ref|XP_002324073.2| hypothetical protein POPTR_0017s12290g [Populus trichocarpa]
 gb|EEF04206.2| hypothetical protein POPTR_0017s12290g [Populus trichocarpa]
Length=478

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 133/209 (64%), Gaps = 26/209 (12%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSAS--GDFD  219
            MSYY +G    DD VDD+DE+DPTPY GGYDI +TYGRPI PS++TC+PISS+S   + D
Sbjct  1    MSYYSRGQ---DDQVDDYDEYDPTPYGGGYDIALTYGRPIPPSDDTCHPISSSSPSDEID  57

Query  220  YDRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgynr-rpgggggygge  396
            YDRP Y+SH+EPS YADEAL+ EY SY++PKPRPG SYGG   A   +     G     +
Sbjct  58   YDRPNYSSHSEPSPYADEALETEYSSYSRPKPRPGSSYGGPQPAYGLQPGSEYGSAGYEK  117

Query  397  seygseggygrrpeQQRP-SSEYGS-GYERPDSEYGSGHGRKPS----------SEYGSG  540
                  G         +P S EYGS GYE+P SEYGSG+GR+P           S++GSG
Sbjct  118  PASEEHGSSYESAGYGKPHSEEYGSGGYEKP-SEYGSGYGRRPEYEDGSGYEKPSKHGSG  176

Query  541  YGRRNED------ERPDS-EYGSGNRRKP  606
            YGR+ E       ERP S EYGSG  R+P
Sbjct  177  YGRKQESDYGSGYERPQSEEYGSGYSRRP  205


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNE-DERPDSEYGSGNRRKP  606
            +RP +EYGSGYE+P SEY SG+GR P SEYGSGY + +E +ER ++ YGSG+ R+P
Sbjct  203  RRPEAEYGSGYEKP-SEYSSGYGRNPESEYGSGYEKSSEHEERTETGYGSGHGRRP  257



>ref|XP_011035800.1| PREDICTED: uncharacterized protein At5g39570 isoform X3 [Populus 
euphratica]
Length=364

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 114/187 (61%), Gaps = 23/187 (12%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS--GDFDYDRPQYTSHAEPSAYADEALDN  285
            PTPY GGYDI +TYGRPI PS++TC+PISS+S   + DYDRP Y+SH+EPS YADEAL+ 
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDDTCHPISSSSPSDEIDYDRPNYSSHSEPSPYADEALET  79

Query  286  EYKSYAKPKPRPGPSYGGSSEAgynr-rpgggggyggeseygseggygrrpeQQRP-SSE  459
            EY SY++PKPRPG SYGG   A         G     +      G         +P S E
Sbjct  80   EYSSYSRPKPRPGSSYGGPQPAYGLHPGSEYGSAGYEKPANEEYGSSYESAGYGKPHSEE  139

Query  460  YGS-GYERPDSEYGSGHGRKPSSEYGSG----------YGRRNED------ERPDS-EYG  585
            YGS GYE+P SEYGSG+GR+P  E GSG          YGR+ E       ERP S EYG
Sbjct  140  YGSGGYEKP-SEYGSGYGRRPEYEDGSGYEKPSKHGSDYGRKQESDYGSGYERPQSQEYG  198

Query  586  SGNRRKP  606
            SG  R+P
Sbjct  199  SGYSRRP  205


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNE-DERPDSEYGSGNRRKP  606
            +RP SEYGSGYE+P SEY SG+GR P SEYGSGY + +E +ER ++ YGSG+ R+P
Sbjct  203  RRPESEYGSGYEKP-SEYSSGYGRNPESEYGSGYEKSSEQEERTETGYGSGHGRRP  257



>ref|XP_011035799.1| PREDICTED: uncharacterized protein At5g39570 isoform X2 [Populus 
euphratica]
Length=416

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 114/187 (61%), Gaps = 23/187 (12%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS--GDFDYDRPQYTSHAEPSAYADEALDN  285
            PTPY GGYDI +TYGRPI PS++TC+PISS+S   + DYDRP Y+SH+EPS YADEAL+ 
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDDTCHPISSSSPSDEIDYDRPNYSSHSEPSPYADEALET  79

Query  286  EYKSYAKPKPRPGPSYGGSSEAgynr-rpgggggyggeseygseggygrrpeQQRP-SSE  459
            EY SY++PKPRPG SYGG   A         G     +      G         +P S E
Sbjct  80   EYSSYSRPKPRPGSSYGGPQPAYGLHPGSEYGSAGYEKPANEEYGSSYESAGYGKPHSEE  139

Query  460  YGS-GYERPDSEYGSGHGRKPSSEYGSG----------YGRRNED------ERPDS-EYG  585
            YGS GYE+P SEYGSG+GR+P  E GSG          YGR+ E       ERP S EYG
Sbjct  140  YGSGGYEKP-SEYGSGYGRRPEYEDGSGYEKPSKHGSDYGRKQESDYGSGYERPQSQEYG  198

Query  586  SGNRRKP  606
            SG  R+P
Sbjct  199  SGYSRRP  205


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNE-DERPDSEYGSGNRRKP  606
            +RP SEYGSGYE+P SEY SG+GR P SEYGSGY + +E +ER ++ YGSG+ R+P
Sbjct  203  RRPESEYGSGYEKP-SEYSSGYGRNPESEYGSGYEKSSEQEERTETGYGSGHGRRP  257



>ref|XP_011035798.1| PREDICTED: uncharacterized protein At5g39570 isoform X1 [Populus 
euphratica]
Length=421

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 114/187 (61%), Gaps = 23/187 (12%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS--GDFDYDRPQYTSHAEPSAYADEALDN  285
            PTPY GGYDI +TYGRPI PS++TC+PISS+S   + DYDRP Y+SH+EPS YADEAL+ 
Sbjct  20   PTPYGGGYDIALTYGRPIPPSDDTCHPISSSSPSDEIDYDRPNYSSHSEPSPYADEALET  79

Query  286  EYKSYAKPKPRPGPSYGGSSEAgynr-rpgggggyggeseygseggygrrpeQQRP-SSE  459
            EY SY++PKPRPG SYGG   A         G     +      G         +P S E
Sbjct  80   EYSSYSRPKPRPGSSYGGPQPAYGLHPGSEYGSAGYEKPANEEYGSSYESAGYGKPHSEE  139

Query  460  YGS-GYERPDSEYGSGHGRKPSSEYGSG----------YGRRNED------ERPDS-EYG  585
            YGS GYE+P SEYGSG+GR+P  E GSG          YGR+ E       ERP S EYG
Sbjct  140  YGSGGYEKP-SEYGSGYGRRPEYEDGSGYEKPSKHGSDYGRKQESDYGSGYERPQSQEYG  198

Query  586  SGNRRKP  606
            SG  R+P
Sbjct  199  SGYSRRP  205


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNE-DERPDSEYGSGNRRKP  606
            +RP SEYGSGYE+P SEY SG+GR P SEYGSGY + +E +ER ++ YGSG+ R+P
Sbjct  203  RRPESEYGSGYEKP-SEYSSGYGRNPESEYGSGYEKSSEQEERTETGYGSGHGRRP  257



>emb|CBI22252.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDITV YGRP+ PSEETCYPISS SGD DYDRP YTS +EPSAY DEAL+NEY
Sbjct  18   PTPYGGGYDITVIYGRPLEPSEETCYPISSKSGDIDYDRPSYTSCSEPSAYGDEALENEY  77

Query  292  KSYAKPKP  315
            KSYA+PKP
Sbjct  78   KSYARPKP  85



>ref|XP_003543859.2| PREDICTED: uncharacterized protein At5g39570-like [Glycine max]
Length=419

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 130/234 (56%), Gaps = 34/234 (15%)
 Frame = +1

Query  7    YPKQAAPEEPKSTMSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETC  186
            +P  A P+  +STMS++ +G    DD VDD+DE+DPTPY GGYDI +TYGRPI PS+ETC
Sbjct  19   FPNFAIPKPQQSTMSFFSRGRRD-DDTVDDYDEYDPTPYGGGYDIALTYGRPIPPSDETC  77

Query  187  YPISSASGD--FDYDRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPSYGGSSEAgyn  360
            YP+ ++S D  FDYDRPQYTS+AEPSAY DEAL  EY SY++PKPRP P+          
Sbjct  78   YPLGASSSDDNFDYDRPQYTSNAEPSAYGDEALATEYSSYSRPKPRPAPA----------  127

Query  361  rrpgggggyggeseygseggygrrpeQQRPSSEYGSGY---ERPDSEYGSGHGRKPSSEY  531
                     G     GS  G       ++  SEYGSGY   +          GRK   EY
Sbjct  128  ---------GFNPAAGSGYGGSGSGYGRKQESEYGSGYGGRKEEGEYGSGYGGRKEEPEY  178

Query  532  GSGYGRRN---------EDERPDSEYGSGNRRKPsyeeggseygsgygRRNESE  666
            GSGYGRR             + + EYGSG  RK   E G        GR+ ESE
Sbjct  179  GSGYGRRKEEGEYGSGYGGRKEEPEYGSGYGRKEEGEYGSGYGSGYGGRKEESE  232



>ref|NP_568565.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FKA5.1|Y5957_ARATH RecName: Full=Uncharacterized protein At5g39570 [Arabidopsis 
thaliana]
 dbj|BAB08888.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24188.1| AT5g39570/MIJ24_40 [Arabidopsis thaliana]
 gb|AAN18065.1| At5g39570/MIJ24_40 [Arabidopsis thaliana]
 gb|AED94448.1| uncharacterized protein AT5G39570 [Arabidopsis thaliana]
Length=381

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 93/166 (56%), Gaps = 43/166 (26%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG                                  +RP+  Y
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHVQG----------------------------ERPNPGY  110

Query  463  GSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDE---RPDSEYGSG  591
            GS          SG+GRKP SEYGSGYG + E E   RP+  YGSG
Sbjct  111  GS---------ESGYGRKPESEYGSGYGGQTEVEYGRRPEQSYGSG  147



>ref|XP_006405619.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
 gb|ESQ47072.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
Length=312

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 103/178 (58%), Gaps = 33/178 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++TS  +PSAYA+EAL  E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTSIHDPSAYAEEALQTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P   G       R   G G   G                ++P SEY
Sbjct  79   YSSYSRPKPRPAFRPDSAGGGHVQGERPNPGYGSESGYG--------------RKPESEY  124

Query  463  GSGY---------ERPDSEYG----SGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNR  597
            GSGY          RP+S YG    + +GR+P   YGSGYG R E E   SEYGSG R
Sbjct  125  GSGYGGQTETEYGRRPESGYGGETETEYGRRPEQGYGSGYGGRTEAE---SEYGSGGR  179



>gb|AAN60241.1| unknown [Arabidopsis thaliana]
Length=381

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 93/166 (56%), Gaps = 43/166 (26%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTXIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG                                  +RP+  Y
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHVQG----------------------------ERPNPGY  110

Query  463  GSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDE---RPDSEYGSG  591
            GS          SG+GRKP SEYGSGYG + E E   RP+  YGSG
Sbjct  111  GS---------ESGYGRKPESEYGSGYGGQTEVEYGRRPEQSYGSG  147



>gb|AFK48716.1| unknown [Medicago truncatula]
Length=233

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSY+ +G + GD+ VDDFDE+DPTPY GGYDI +TYGRPI PS+ETCYP  S++ DFDYD
Sbjct  1    MSYFTRGGN-GDESVDDFDEYDPTPYGGGYDIHLTYGRPIPPSDETCYPSGSSNNDFDYD  59

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPS  330
            RPQ+ S+A+PSAY DEAL  EY SY +PKPRP PS
Sbjct  60   RPQFESYAQPSAYGDEALATEYSSYVRPKPRPAPS  94



>ref|XP_006405620.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
 gb|ESQ47073.1| hypothetical protein EUTSA_v10027782mg [Eutrema salsugineum]
Length=418

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 103/178 (58%), Gaps = 33/178 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++TS  +PSAYA+EAL  E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTSIHDPSAYAEEALQTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P   G       R   G G   G                ++P SEY
Sbjct  79   YSSYSRPKPRPAFRPDSAGGGHVQGERPNPGYGSESGYG--------------RKPESEY  124

Query  463  GSGY---------ERPDSEYG----SGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNR  597
            GSGY          RP+S YG    + +GR+P   YGSGYG R E E   SEYGSG R
Sbjct  125  GSGYGGQTETEYGRRPESGYGGETETEYGRRPEQGYGSGYGGRTEAE---SEYGSGGR  179



>ref|XP_007151256.1| hypothetical protein PHAVU_004G031300g [Phaseolus vulgaris]
 gb|ESW23250.1| hypothetical protein PHAVU_004G031300g [Phaseolus vulgaris]
Length=488

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 99/158 (63%), Gaps = 9/158 (6%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPI--SSASGD-FDYDRPQYTSHAEPSAYADEALD  282
            PTPY GGY I++TYGRPI PSEETCY I  SS++GD FDYDRPQYTS+AEPSAY DEAL 
Sbjct  26   PTPYGGGYIISLTYGRPIPPSEETCYAIGASSSTGDSFDYDRPQYTSNAEPSAYGDEALV  85

Query  283  NEYKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
             EY SY++PKPRP P+ G +  AG      G     G                ++  +EY
Sbjct  86   TEYSSYSRPKPRPAPA-GFNPAAGSGYGGSGSEYGSGGGRKQESEYGSSGYGGRKEEAEY  144

Query  463  GS---GYERPDSEYGSGH--GRKPSSEYGSGYGRRNED  561
            GS   G  + ++EYGS    GRK  +EYGSGYG R E+
Sbjct  145  GSSGYGGRKEEAEYGSSGYGGRKEEAEYGSGYGGRKEE  182



>ref|XP_003618539.1| hypothetical protein MTR_6g012780 [Medicago truncatula]
 gb|AES74757.1| pro-resilin, putative [Medicago truncatula]
Length=411

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSY+ +G + GD+ VDDFDE+DPTPY GGYDI +TYGRPI PS+ETCYP  S++ DFDYD
Sbjct  1    MSYFTRGGN-GDESVDDFDEYDPTPYGGGYDIHLTYGRPIPPSDETCYPSGSSNNDFDYD  59

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPS  330
            RPQ+ S+A+PSAY DEAL  EY SY +PKPRP PS
Sbjct  60   RPQFESYAQPSAYGDEALATEYSSYVRPKPRPAPS  94



>gb|KEH25017.1| pro-resilin, putative [Medicago truncatula]
Length=390

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            MSY+ +G + GD+ VDDFDE+DPTPY GGYDI +TYGRPI PS+ETCYP  S++ DFDYD
Sbjct  1    MSYFTRGGN-GDESVDDFDEYDPTPYGGGYDIHLTYGRPIPPSDETCYPSGSSNNDFDYD  59

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPS  330
            RPQ+ S+A+PSAY DEAL  EY SY +PKPRP PS
Sbjct  60   RPQFESYAQPSAYGDEALATEYSSYVRPKPRPAPS  94



>ref|XP_006283826.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
 gb|EOA16724.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
Length=380

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 98/170 (58%), Gaps = 27/170 (16%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG       R   G G   G                 +  SEY
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHVQGERPNPGYGSGSGY--------------GGQTESEY  124

Query  463  GSGYERPDSEYG----SGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRR  600
            G    RP+S YG    + +GR+P   YGSGYG R E E   SEYGSG  R
Sbjct  125  GR---RPESGYGGETETEYGRRPEQSYGSGYGGRTETE---SEYGSGGGR  168



>emb|CDX95231.1| BnaC09g16390D [Brassica napus]
Length=287

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 99/173 (57%), Gaps = 51/173 (29%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI P ++TCYP+SSA+  DF+Y+RP++TS+ +PSAYA+EAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPCDDTCYPLSSAADEDFEYERPEFTSYHDPSAYAEEALNTE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SY++PKPRPG                                        RP S  G 
Sbjct  79   YSSYSRPKPRPG---------------------------------------FRPGSA-GG  98

Query  469  GY---ERPDSEYGSGHGRKPSSEYG----SGYGRRNEDERPDSEYGSGNRRKP  606
            G+   ERPD  YGSG+G    +EYG    SGYG R+E E   + YGSG  +KP
Sbjct  99   GHVQGERPDPSYGSGYGGATEAEYGRRPESGYGGRSETE---TGYGSGYEKKP  148



>ref|XP_006283824.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
 gb|EOA16722.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
Length=384

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 98/170 (58%), Gaps = 27/170 (16%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG       R   G G   G                 +  SEY
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHVQGERPNPGYGSGSGY--------------GGQTESEY  124

Query  463  GSGYERPDSEYG----SGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRR  600
            G    RP+S YG    + +GR+P   YGSGYG R E E   SEYGSG  R
Sbjct  125  GR---RPESGYGGETETEYGRRPEQSYGSGYGGRTETE---SEYGSGGGR  168



>ref|XP_004489417.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Cicer arietinum]
Length=367

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 78/96 (81%), Gaps = 1/96 (1%)
 Frame = +1

Query  46   MSYYPKG-HHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDY  222
            MSYY +G  +  D+ VDDFDE+DPTPY GGYDI +TYGRPI PS+ETCYP +S+   FDY
Sbjct  1    MSYYSRGGRNNDDESVDDFDEYDPTPYGGGYDIHLTYGRPIPPSDETCYPSASSDDHFDY  60

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYAKPKPRPGPS  330
            DRPQ++SH+EPSAY DEAL  EY SY++PKPRP PS
Sbjct  61   DRPQFSSHSEPSAYGDEALATEYSSYSRPKPRPAPS  96



>ref|XP_006283825.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
 gb|EOA16723.1| hypothetical protein CARUB_v10004926mg [Capsella rubella]
Length=415

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 98/170 (58%), Gaps = 27/170 (16%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG       R   G G   G                 +  SEY
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHVQGERPNPGYGSGSGY--------------GGQTESEY  124

Query  463  GSGYERPDSEYG----SGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRR  600
            G    RP+S YG    + +GR+P   YGSGYG R E E   SEYGSG  R
Sbjct  125  GR---RPESGYGGETETEYGRRPEQSYGSGYGGRTETE---SEYGSGGGR  168



>ref|XP_002870774.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47033.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 95/161 (59%), Gaps = 24/161 (15%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS    DF+Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDFEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG                  + E  + G        ++P SEY
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHV--------------QGERPNPGYGSGSGYGRKPESEY  124

Query  463  GSGY-ERPDSEYGSG------HGRKPSSEYGSGYGRRNEDE  564
            GSGY  + ++E G G      +GR+P   YGSGYG R E E
Sbjct  125  GSGYGGQTETESGYGGQTEVEYGRRPEQSYGSGYGGRTETE  165



>ref|XP_010450798.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At5g39570-like 
[Camelina sativa]
Length=407

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 96/170 (56%), Gaps = 27/170 (16%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFD-YDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS   D D Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDDEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG       R   G G   G                 +  SEY
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHVQGERPSPGYGSGSGY--------------GGQTESEY  124

Query  463  GSGYERPDSEYGSG----HGRKPSSEYGSGYGRRNEDERPDSEYGSGNRR  600
            G    RP+S YG      +GRKP   YGSGYG R E E   SEYGSG  R
Sbjct  125  GR---RPESGYGGETEIEYGRKPEQSYGSGYGGRTETE---SEYGSGGGR  168



>ref|XP_004304279.1| PREDICTED: uncharacterized protein At5g39570 [Fragaria vesca 
subsp. vesca]
Length=390

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 108/200 (54%), Gaps = 50/200 (25%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDF-DYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYD  +TYGRP++PSEETCYP SSA  D  DY+RP  +S+ EPSAYADEAL+NE
Sbjct  20   PTPYGGGYDQALTYGRPLAPSEETCYPSSSAPDDQDDYERPDLSSYREPSAYADEALNNE  79

Query  289  YKSYAKPKP-----------------------RPGPSYGGSSEAgynrrpgggggygges  399
            Y SY + KP                       RPG    GS+E         G    G  
Sbjct  80   YSSYERRKPRPGFGGGGRPDHDGGEGGGEYGSRPGRPQYGSAEPQSEYGSRPGRPQYGS-  138

Query  400  eygseggygrrpeQQRPSSEYGSGYER------PDSEYGSGHGRK-----PSSEYGSGYG  546
                          + P SE+GSGY R      P+S++GSG GRK     P SE+GSGYG
Sbjct  139  --------------EEPQSEFGSGYGRKPEYQAPESDFGSGFGRKPEYQAPESEFGSGYG  184

Query  547  RRNEDERPDSEYGSGNRRKP  606
            R+ E E P+ E+GSG  RKP
Sbjct  185  RKPEYEAPEPEFGSGYGRKP  204



>gb|KHN13204.1| Hypothetical protein glysoja_016381 [Glycine soja]
Length=379

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 113/203 (56%), Gaps = 45/203 (22%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD--FDYDRPQYTSHAEPSAYADEALDN  285
            PTPY GGYDI +TYGRPI PS+ETCYP+ ++S D  FDYDRPQYTS+AEPSAY DEAL  
Sbjct  22   PTPYGGGYDIALTYGRPIPPSDETCYPLGASSSDDNFDYDRPQYTSNAEPSAYGDEALAT  81

Query  286  EYKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYG  465
            EY SY++PKPRP P+ GG+      ++    G   G  +   E G G    ++ P  EYG
Sbjct  82   EYSSYSRPKPRPAPAAGGAGSGYGRKQESKYGSGYGGRKEEGEYGSGYGGRKEEP--EYG  139

Query  466  SGYER---------------PDSEYGSGHGRKPS-----------------SEYGSGYGR  549
            SGY R                + EYGSG+GRK                   SEYGSGYG 
Sbjct  140  SGYGRRKEEGEYGSGYGGRKEEPEYGSGYGRKEEGEYGSGYGSGYGGRKEESEYGSGYGG  199

Query  550  RNED---------ERPDSEYGSG  591
            R E+          + +SEYGSG
Sbjct  200  RKEEPEYGSGYGGRKEESEYGSG  222



>gb|KJB11100.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=225

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSG------YERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S       +E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>ref|XP_009139903.1| PREDICTED: uncharacterized protein At5g39570 [Brassica rapa]
Length=365

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 90/159 (57%), Gaps = 48/159 (30%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI P ++TCYP+SSA+  DF+Y+RP++TS+ +PSAYA+EAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPCDDTCYPLSSAADEDFEYERPEFTSYHDPSAYAEEALNTE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SY++PKPRPG                                        RP S  G 
Sbjct  79   YSSYSRPKPRPG---------------------------------------FRPGSA-GG  98

Query  469  GY---ERPDSEYGSGHGRKPSSEYG----SGYGRRNEDE  564
            G+   ERPD  YGSG+G +  +EYG    SGYG   E E
Sbjct  99   GHVQGERPDQSYGSGYGGQTEAEYGRRPESGYGGATETE  137



>emb|CDX74447.1| BnaA04g09420D [Brassica napus]
Length=335

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 90/159 (57%), Gaps = 48/159 (30%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI P ++TCYP+SSA+  DF+Y+RP++TS+ +PSAYA+EAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPCDDTCYPLSSAADEDFEYERPEFTSYHDPSAYAEEALNTE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SY++PKPRPG                                        RP S  G 
Sbjct  79   YSSYSRPKPRPG---------------------------------------FRPGSA-GG  98

Query  469  GY---ERPDSEYGSGHGRKPSSEYG----SGYGRRNEDE  564
            G+   ERPD  YGSG+G +  +EYG    SGYG   E E
Sbjct  99   GHVQGERPDQSYGSGYGGQTEAEYGRRPESGYGGATETE  137



>gb|KJB11097.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=312

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSGY------ERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S +      E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>gb|KJB11091.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=340

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSGY------ERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S +      E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>gb|KJB11085.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=327

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSGY------ERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S +      E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>gb|KJB11093.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=320

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSGY------ERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S +      E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>gb|KJB11083.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=312

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSGY------ERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S +      E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>emb|CDY30254.1| BnaC04g31650D [Brassica napus]
Length=314

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI P ++TCYP+SSA+  DF+Y+RP++TS+ +PSAYA+EAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPCDDTCYPLSSAADEDFEYERPEFTSYHDPSAYAEEALNTE  78

Query  289  YKSYAKPKPRPG  324
            Y SY++PKPRPG
Sbjct  79   YSSYSRPKPRPG  90



>gb|KJB11084.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=321

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSGY------ERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S +      E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>gb|KJB11098.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=340

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 31/181 (17%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPG-----PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPS  453
            Y SY KPKPRPG     P++G         +   G G   E                RP 
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFG--------------RPG  125

Query  454  SEYGSGY------ERPDSEYGSGHGRKPSSEYGS----GYGRRNEDER-PDSEYGSGNRR  600
            SE+ S +      E+P  E+GSGHGR+P+ E+      G GRR+E E+ P  E+G+G RR
Sbjct  126  SEFESDFGRRPEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRR  185

Query  601  K  603
            +
Sbjct  186  R  186



>ref|XP_010435878.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
Length=364

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 89/156 (57%), Gaps = 24/156 (15%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFD-YDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS   D D Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDDEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRPG--PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEY  462
            Y SY++PKPRP   P  GG                  + E  + G         +  SEY
Sbjct  79   YSSYSRPKPRPAFRPDSGGGGHV--------------QGERPNPGYGSGSGYGGQTESEY  124

Query  463  GSGYERPDSEYG----SGHGRKPSSEYGSGYGRRNE  558
            G    RP+S YG    + +GRKP   YGSGYG R E
Sbjct  125  GR---RPESGYGGETETEYGRKPEQSYGSGYGGRTE  157



>gb|KFK33783.1| hypothetical protein AALP_AA5G059400 [Arabis alpina]
Length=324

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 93/166 (56%), Gaps = 45/166 (27%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            P PY GGYDITVTYGR I PS+ETCYP+SS SG+ F+Y RP ++++ +PSAYAD+A+  E
Sbjct  20   PMPYSGGYDITVTYGRAIPPSDETCYPLSSRSGEAFEYQRPNFSTNHDPSAYADQAIKTE  79

Query  289  YKSYAKP--KPRP-----GPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQR  447
            Y SY+KP  K RP      P YGGS                                 + 
Sbjct  80   YSSYSKPKHKSRPVDAGRKPDYGGSG----------------------------SDFGKN  111

Query  448  PSSEYGSGYE-----RPDSEYG----SGHGRKPSSEYGSGYGRRNE  558
            P+S YG   E     +P+SEYG      +GRKP SE+GSGYG RNE
Sbjct  112  PNSGYGGRTEVEYGRKPESEYGGRTEVEYGRKPESEHGSGYGGRNE  157



>ref|XP_010528357.1| PREDICTED: uncharacterized protein At5g39570-like [Tarenaya hassleriana]
Length=418

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 104/185 (56%), Gaps = 29/185 (16%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPYDGGY     YGRPI PS+ETCY +SS   D F+Y+RP++TS+ EPSAYAD+AL  E
Sbjct  19   PTPYDGGYKQHEIYGRPIPPSDETCYALSSPLDDSFEYERPEFTSYHEPSAYADDALQTE  78

Query  289  YKSYAKPKPRPGPSYGGS------------SEAgynrrpgggggyggeseygseggygrr  432
            Y SY++PKPRPG   GG             +        G GG    E     E  YG  
Sbjct  79   YSSYSRPKPRPGFQPGGGLVEGEYGGRPQPAYESEYGSGGYGGETETEYGRRPESEYGSG  138

Query  433  peQQRPSSEYGSGYERPDSEYGSG---------HGRKPSSEYGS-GYGRRNEDE---RPD  573
                R   EYG    RP+SEYGSG         +GR+P SEYGS GYG R + E   RP+
Sbjct  139  GYGGRTEIEYGR---RPESEYGSGEYGGRTETEYGRRPESEYGSEGYGGRTDTEYGRRPE  195

Query  574  SEYGS  588
            SEYGS
Sbjct  196  SEYGS  200



>ref|XP_010552803.1| PREDICTED: uncharacterized protein At5g39570 [Tarenaya hassleriana]
Length=415

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 90/146 (62%), Gaps = 29/146 (20%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPYDGGY     YGRPI PS+ETC+P+SS S + F+Y+RP++TS+ EPSAYADEAL  E
Sbjct  19   PTPYDGGYKQHEVYGRPIPPSDETCHPLSSPSDESFEYERPEFTSYHEPSAYADEALQTE  78

Query  289  YKSYAKPKP----RPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSS  456
            Y SYA+PKP    RPG S GG  E  Y  RP    G G                   P S
Sbjct  79   YSSYARPKPRPGFRPGSSGGGHVEGEYGGRPQPAYGSG-------------------PGS  119

Query  457  EYGSGYERPD-----SEYGSGHGRKP  519
            ++GSGY +PD     SE+GSG+GRKP
Sbjct  120  DFGSGYGKPDYEGSGSEFGSGYGRKP  145


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 8/58 (14%)
 Frame = +1

Query  442  QRPSSEYGSGY-ERPDSEYGSGHGRKPSSEYGSGYGRRNEDE-------RPDSEYGSG  591
            ++P SEYGSGY +R +SEYGSG+G+KP SEYGSGYG R E E       +P+SEYGSG
Sbjct  231  KKPESEYGSGYGQRTESEYGSGYGKKPESEYGSGYGGRTESEYGSGYGKKPESEYGSG  288


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 6/56 (11%)
 Frame = +1

Query  442  QRPSSEYGSGYE-RPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRRKP  606
            ++P SEYGSGY  R +SEYGSG+G+KP SEYGSGYG R E     SEYGSG  RKP
Sbjct  255  KKPESEYGSGYGGRTESEYGSGYGKKPESEYGSGYGGRTE-----SEYGSGYERKP  305



>gb|KFK33197.1| hypothetical protein AALP_AA6G342800 [Arabis alpina]
Length=374

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYPISS    DF+Y+RP++TS  +PSAY +EAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPISSGVDDDFEYERPEFTSIHDPSAYGEEALNTE  78

Query  289  YKSYAKPKPRP  321
            Y SY++PKPRP
Sbjct  79   YSSYSRPKPRP  89



>ref|XP_009151796.1| PREDICTED: uncharacterized protein At5g39570 [Brassica rapa]
 ref|XP_009151797.1| PREDICTED: uncharacterized protein At5g39570 [Brassica rapa]
 emb|CDX86390.1| BnaA06g31070D [Brassica napus]
Length=301

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 90/152 (59%), Gaps = 21/152 (14%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR + PS+ETCYP+SS SG+ F+Y RP ++S  EP+AY D+AL+ E
Sbjct  19   PTPYSGGYDITVTYGRSVPPSDETCYPLSSRSGEAFEYQRPVFSSSKEPAAYGDQALNTE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA+PK RPG   G   E G     GG G   G                 R   EYG 
Sbjct  79   YSSYARPKTRPGGHGGAHVEGGKKPEHGGSGSDFGRKPDSG-----------RTEVEYG-  126

Query  469  GYERPDSE-YGSG-----HGRKPSSEYGSGYG  546
               RP+S  YG G     +GRKP SE+GSGYG
Sbjct  127  --RRPESGGYGGGRTEVEYGRKPESEHGSGYG  156



>emb|CDY00101.1| BnaC09g02000D [Brassica napus]
Length=241

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR + PSEE CYP+SS SGD F+Y RP ++S  EPSAY ++AL+ E
Sbjct  19   PTPYSGGYDITVTYGRSLPPSEENCYPLSSLSGDAFEYQRPVFSSSHEPSAYDNQALNTE  78

Query  289  YKSYAKPKPRPGPSYGGSSE  348
            Y SYA+PK + G  YGG  E
Sbjct  79   YSSYARPKTKHGSGYGGRKE  98



>emb|CDX85244.1| BnaC07g25550D [Brassica napus]
Length=263

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 79/123 (64%), Gaps = 2/123 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGRP+ PS+ETCYP+SS SGD F+Y RP ++S  EP+AY D+AL+ E
Sbjct  19   PTPYSGGYDITVTYGRPVPPSDETCYPLSSRSGDAFEYQRPVFSSSKEPAAYGDQALNTE  78

Query  289  YKSYAKPKPRPGPSYG-GSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYG  465
            Y SYA+PK RPG   G GS              YG   E G  GG       ++P SE+G
Sbjct  79   YSSYARPKTRPGGQGGSGSDFGRKPDSGRTEVEYGRRPESGGYGGRTEVEYGRKPESEHG  138

Query  466  SGY  474
            SGY
Sbjct  139  SGY  141



>gb|AAP46157.1| latex abundant protein 1 [Hevea brasiliensis]
Length=122

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            P PY GGYD+ +TYGRPIS  EETCYP SS++ + DYD P +T + EPSAY D+ L  EY
Sbjct  19   PRPYIGGYDMALTYGRPISACEETCYPRSSSANEIDYDYPDFTWYVEPSAYNDDHLQEEY  78

Query  292  KSYAKPKPRPGPSYGGSS  345
             SYA+PKPRP P+  GS 
Sbjct  79   TSYARPKPRPAPNSLGSC  96



>ref|XP_010441070.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
Length=395

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFD-YDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITV YGRPI PS+ETCYP+SS   D D Y+RP++T   EPSAY DEAL+ E
Sbjct  19   PTPYSGGYDITVIYGRPIPPSDETCYPLSSGVDDDDEYERPEFTQIHEPSAYGDEALNTE  78

Query  289  YKSYAKPKPRP  321
            Y SY++PKPRP
Sbjct  79   YSSYSRPKPRP  89



>emb|CDY44410.1| BnaA02g29670D [Brassica napus]
Length=323

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR + PS+ETCYP+SS SGD F+Y RP ++S  EP+AY D+AL+ E
Sbjct  19   PTPYSGGYDITVTYGRSVPPSDETCYPLSSRSGDAFEYQRPVFSSSHEPAAYGDQALNTE  78

Query  289  YKSYAKPKPRP  321
            Y SYA+PK RP
Sbjct  79   YSSYARPKTRP  89



>ref|XP_007032610.1| Nucleus-like protein [Theobroma cacao]
 gb|EOY03536.1| Nucleus-like protein [Theobroma cacao]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 104/200 (52%), Gaps = 35/200 (18%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYD+ +TYGRP+ PS+ETCYP S+ S GDFDY  P ++S  EP AYADEAL NE
Sbjct  20   PTPYGGGYDLALTYGRPLEPSDETCYPSSTPSDGDFDYACPHFSSSCEPCAYADEALQNE  79

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQ----QRPSS  456
            Y SYA+ KPRPGP        G            G               +    +RP S
Sbjct  80   YSSYARAKPRPGPGPAYGGGPGGYGAQHEPDYGSGHGRKPDYQQSESGYGRRPEFERPGS  139

Query  457  EYGSGYER------PDSEYGSGHGRK------PSSEYGSGYGRRNED-------------  561
            E+ SGY R      P  E+GSG+G++      P  E+GSGYGRR E              
Sbjct  140  EFESGYGRRPEFKQPPPEFGSGYGQRPEYEQPPPPEFGSGYGRRPEFEQPPPPEFESGYG  199

Query  562  ERPD-----SEYGSGNRRKP  606
             RP+     SEYG+G  RKP
Sbjct  200  RRPEYGEHGSEYGTGYGRKP  219



>ref|XP_009129332.1| PREDICTED: uncharacterized protein At5g39570-like [Brassica rapa]
Length=305

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR + PS+ETCYP+SS SGD F+Y RP ++S  EP+AY D+AL+ E
Sbjct  19   PTPYSGGYDITVTYGRSVPPSDETCYPLSSRSGDAFEYQRPVFSSSHEPAAYGDQALNTE  78

Query  289  YKSYAKPKPRP  321
            Y SYA+PK RP
Sbjct  79   YSSYARPKTRP  89



>emb|CDY04054.1| BnaC02g37690D [Brassica napus]
Length=301

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYG  + PS+ETCYP+SS SGD F+Y RP ++S  EP+AY D+AL  E
Sbjct  19   PTPYSGGYDITVTYGCSVPPSDETCYPLSSRSGDAFEYQRPVFSSSHEPAAYGDQALKTE  78

Query  289  YKSYAKPKPRPGPS  330
            Y SYA+PK RPG S
Sbjct  79   YSSYARPKTRPGGS  92



>ref|XP_008443383.1| PREDICTED: uncharacterized protein At5g39570 [Cucumis melo]
Length=320

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GG+D+ +TYGRP+SPSEETCYP S+ + D  DY+RPQ+ S+AEPSAY D+AL  E
Sbjct  19   PTPYGGGFDLFLTYGRPLSPSEETCYPHSAGNDDNIDYERPQFESYAEPSAYGDDALQAE  78

Query  289  YKSYAKPKP  315
            Y SY++PKP
Sbjct  79   YSSYSRPKP  87



>ref|XP_004136693.1| PREDICTED: uncharacterized protein At5g39570 [Cucumis sativus]
 gb|KGN59544.1| hypothetical protein Csa_3G824890 [Cucumis sativus]
Length=323

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GG+D+ +TYGRP+SPSEETCYP S+ +  D DY+RPQ+ S+AEPSAY D+AL  E
Sbjct  19   PTPYGGGFDLFLTYGRPLSPSEETCYPHSAGNDDDIDYERPQFESYAEPSAYGDDALQAE  78

Query  289  YKSYAKPKP  315
            Y SY++PKP
Sbjct  79   YSSYSRPKP  87



>ref|XP_010425710.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
Length=309

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 85/157 (54%), Gaps = 42/157 (27%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR I PS+ETCYP+SS +GD F+Y RP ++ + +P AY D+AL  E
Sbjct  19   PTPYSGGYDITVTYGRSIPPSDETCYPLSSRAGDAFEYQRPNFSLNHDPPAYEDQALKTE  78

Query  289  YKSYAKPKP-------RPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQR  447
            Y SY++P P       +P   YGG +E  Y                            ++
Sbjct  79   YSSYSRPGPGGSDFGRKPNSGYGGRTEVEYG---------------------------RK  111

Query  448  PSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNE  558
            P S YG    R + EY    GRK  SE+GSGYG R E
Sbjct  112  PDSGYGG---RTEVEY----GRKTESEHGSGYGGRIE  141



>emb|CDY19997.1| BnaA09g02540D [Brassica napus]
Length=231

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR + PS+E CYP+ S SGD F+Y RP ++S  EPSAY D+AL+ E
Sbjct  19   PTPYSGGYDITVTYGRSLPPSDENCYPLLSLSGDAFEYQRPVFSSSHEPSAYDDQALNTE  78

Query  289  YKSYAKPKPRPG  324
            Y SYA+PK + G
Sbjct  79   YSSYARPKTKHG  90



>ref|XP_009111943.1| PREDICTED: uncharacterized protein At5g39570-like [Brassica rapa]
Length=176

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR + PS+E CYP+ S SGD F+Y RP ++S  EPSAY D+AL+ E
Sbjct  19   PTPYSGGYDITVTYGRSLPPSDENCYPLLSLSGDAFEYQRPVFSSSHEPSAYDDQALNTE  78

Query  289  YKSYAKPKPRPG  324
            Y SYA+PK + G
Sbjct  79   YSSYARPKTKHG  90



>gb|AAS76703.1| At3g29075 [Arabidopsis thaliana]
 gb|AAS92325.1| At3g29075 [Arabidopsis thaliana]
Length=236

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 81/150 (54%), Gaps = 42/150 (28%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            P PY GGYDITVTYGR I PS+ETCYP+SS SGD F+Y RP ++S+ + SAY D+AL  E
Sbjct  19   PMPYSGGYDITVTYGRSIPPSDETCYPLSSLSGDAFEYQRPNFSSNHDSSAYDDQALKTE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA    RPGP   GS                                 ++P+S YG 
Sbjct  79   YSSYA----RPGPVGSGSDFG------------------------------RKPNSGYGG  104

Query  469  GYERPDSEYGSGHGRKPSSEYGSGYGRRNE  558
               R + EY    GRK  SE+GSGYG R E
Sbjct  105  ---RTEVEY----GRKTESEHGSGYGGRIE  127



>gb|AAM78108.1| AT3g29075/MXE2_1 [Arabidopsis thaliana]
Length=242

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 81/150 (54%), Gaps = 42/150 (28%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            P PY GGYDITVTYGR I PS+ETCYP+SS SGD F+Y RP ++S+ + SAY D+AL  E
Sbjct  19   PMPYSGGYDITVTYGRSIPPSDETCYPLSSLSGDAFEYQRPNFSSNHDSSAYDDQALKTE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA    RPGP   GS                                 ++P+S YG 
Sbjct  79   YSSYA----RPGPVGSGSDFG------------------------------RKPNSGYGG  104

Query  469  GYERPDSEYGSGHGRKPSSEYGSGYGRRNE  558
               R + EY    GRK  SE+GSGYG R E
Sbjct  105  ---RTEVEY----GRKTESEHGSGYGGRIE  127



>ref|NP_189551.1| glycine-rich protein [Arabidopsis thaliana]
 dbj|BAB02950.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77532.1| glycine-rich protein [Arabidopsis thaliana]
Length=294

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 81/150 (54%), Gaps = 42/150 (28%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            P PY GGYDITVTYGR I PS+ETCYP+SS SGD F+Y RP ++S+ + SAY D+AL  E
Sbjct  19   PMPYSGGYDITVTYGRSIPPSDETCYPLSSLSGDAFEYQRPNFSSNHDSSAYDDQALKTE  78

Query  289  YKSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGS  468
            Y SYA    RPGP   GS                                 ++P+S YG 
Sbjct  79   YSSYA----RPGPVGSGSDFG------------------------------RKPNSGYGG  104

Query  469  GYERPDSEYGSGHGRKPSSEYGSGYGRRNE  558
               R + EY    GRK  SE+GSGYG R E
Sbjct  105  ---RTEVEY----GRKTESEHGSGYGGRIE  127



>ref|XP_002530006.1| hypothetical protein RCOM_0537780 [Ricinus communis]
 gb|EEF32368.1| hypothetical protein RCOM_0537780 [Ricinus communis]
Length=374

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 106/206 (51%), Gaps = 46/206 (22%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS-ASGDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYD+ +TYGRP+ PS+ETCY  S+ A  D DYDRP +TS+AEPSAY D+ L  E
Sbjct  19   PTPYGGGYDLALTYGRPLPPSDETCYQNSAIADDDVDYDRPNFTSYAEPSAYNDDILQEE  78

Query  289  YKS--------------------YAKPKPRPG-----PSYGGSSEAgy--------nrrp  369
            Y S                    Y++P   PG       YGG SE           +   
Sbjct  79   YNSYSRPKPRPGFIPGGGIGGDPYSRPHAAPGFQPGSGGYGGVSEYEKPSGYGRRPDSEY  138

Query  370  gggggyggeseygseggygrrpeQQRPSSEYGSGY--ERPDSEYGSGHG--RKPSSEYGS  537
            G GG  GG       G        ++  SEYGSG    RP+SEYGSG G  R  S EYGS
Sbjct  139  GSGGYGGGTEYERPSGEDYGSGHGRKQDSEYGSGGYGRRPESEYGSGGGYERPSSEEYGS  198

Query  538  GYGRRNEDE--------RPDSEYGSG  591
            GYGR+ E E        RP++EYGSG
Sbjct  199  GYGRKQESEYGSGGYGRRPEAEYGSG  224



>ref|XP_010502930.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Camelina sativa]
 ref|XP_010502931.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Camelina sativa]
 ref|XP_010502932.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
 ref|XP_010502933.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
Length=304

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 84/157 (54%), Gaps = 42/157 (27%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR I PS+ETCYP+SS +GD F+Y RP ++ + +P AY D+AL  E
Sbjct  19   PTPYSGGYDITVTYGRSIPPSDETCYPLSSRAGDAFEYQRPNFSLNHDPPAYEDQALKTE  78

Query  289  YKSYAKP-------KPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQR  447
            Y SY++P         +P   YGG +E  Y                            ++
Sbjct  79   YSSYSRPGHGGSDFSRKPNSGYGGRTEVEYG---------------------------RK  111

Query  448  PSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNE  558
            P S YG    R + EY    GRK  SE+GSGYG R E
Sbjct  112  PDSGYGG---RTEVEY----GRKTESEHGSGYGGRIE  141



>emb|CDP02257.1| unnamed protein product [Coffea canephora]
Length=379

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 4/87 (5%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCY-PISSASGDFDY  222
            MSY+ K H    DDV+DFDE+DPTPY GGYD+++TYGRP+ PSEETCY   SS S  FDY
Sbjct  1    MSYFRKDH---SDDVEDFDEYDPTPYSGGYDMSLTYGRPLPPSEETCYRSSSSTSESFDY  57

Query  223  DRPQYTSHAEPSAYADEALDNEYKSYA  303
            DRPQY+S+AEPSAY DEAL+NEYKSY 
Sbjct  58   DRPQYSSYAEPSAYGDEALENEYKSYV  84


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +1

Query  442  QRPSSEYGSG-YERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSGNRRK  603
            QRP+SEYGSG YERP S  GSG   KP+SEYGSGYGR++  E P SEYGSG  RK
Sbjct  212  QRPTSEYGSGGYERPTSGLGSGGYEKPTSEYGSGYGRKSGYEEPTSEYGSGYARK  266



>ref|XP_002877154.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53413.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=302

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 61/93 (66%), Gaps = 13/93 (14%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            P PY GGYDITVTYGR I PS+ETCYP+SS SGD F+Y RP ++S+ E SAY D+AL  E
Sbjct  19   PLPYSGGYDITVTYGRSIPPSDETCYPLSSRSGDAFEYQRPNFSSNHESSAYDDQALKTE  78

Query  289  YKSYAKPKP------------RPGPSYGGSSEA  351
            Y SYA+P P            +P   YGG +E 
Sbjct  79   YSSYARPGPIGSGSGGSDFGRKPNSGYGGRTEV  111



>ref|XP_010495864.1| PREDICTED: uncharacterized protein At5g39570-like [Camelina sativa]
Length=304

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 8/88 (9%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGD-FDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDITVTYGR I PS+ETCYP+SS +GD F+Y RP+++ + +P AY D+AL  E
Sbjct  19   PTPYSGGYDITVTYGRSIPPSDETCYPLSSRAGDAFEYQRPKFSLNHDPPAYEDQALKTE  78

Query  289  YKSYAKPKP-------RPGPSYGGSSEA  351
            Y SY++P P       +P   YGG +E 
Sbjct  79   YSSYSRPGPGGSDFGRKPNSGYGGRTEV  106



>ref|XP_010088125.1| hypothetical protein L484_013569 [Morus notabilis]
 gb|EXB31937.1| hypothetical protein L484_013569 [Morus notabilis]
Length=395

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 101/193 (52%), Gaps = 30/193 (16%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPYDGG+D+ +TYGR +  S+ETCY + S   DFDYDR Q +S AEP+AY+D  LD EY
Sbjct  19   PTPYDGGFDLYLTYGRHLPHSDETCYTLRSD--DFDYDRSQLSSSAEPNAYSDSVLDVEY  76

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGSG  471
             SY++PKPRPGP    +          G             G  GRRP+   P SEYGSG
Sbjct  77   SSYSRPKPRPGPGPAPAYGGSQYGSGYGRTSEYERPSEDGSGYGGRRPDSDEPGSEYGSG  136

Query  472  Y-----------------------ERPDSEYGSGHGRK-----PSSEYGSGYGRRNEDER  567
            Y                       E    EYGSG+GRK        E+GSGYGRR E E 
Sbjct  137  YGRTTEYESSQGEHGSGYGKKNEYESSQGEYGSGYGRKNEYESSQGEHGSGYGRRTEYES  196

Query  568  PDSEYGSGNRRKP  606
               EYGSG  R+P
Sbjct  197  SQGEYGSGYGRRP  209



>gb|KJB11086.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=387

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11087.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=387

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11101.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=387

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11095.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=389

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11089.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=389

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11099.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=387

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11092.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=389

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11088.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=387

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11096.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=387

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KJB11090.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=388

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>gb|KCW56280.1| hypothetical protein EUGRSUZ_I02023 [Eucalyptus grandis]
Length=419

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDF--DYDRPQY-TSHAEPSAYADEAL  279
            PTP+ GGYDI+VTYGRP+ PSEE CYP  SS++G    DYD P + +SH EP+AYA++AL
Sbjct  19   PTPFGGGYDISVTYGRPLEPSEEICYPSTSSSTGGLEDDYDCPHFASSHDEPAAYAEDAL  78

Query  280  DNEYKSYAKPKPR  318
              EY SYA+PKPR
Sbjct  79   QAEYSSYARPKPR  91


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSG  591
            +RP +EYGSGYE+P +EYGSGHGR P SEYGSG+G R E E+P SEYGSG
Sbjct  175  RRPEAEYGSGYEKPSTEYGSGHGR-PGSEYGSGHGGRTEYEKPSSEYGSG  223


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            ++PS+EYGSG+ RP SEYGSGHG      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  186  EKPSTEYGSGHGRPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  240


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 11/60 (18%)
 Frame = +1

Query  445  RPSSEYGSG------YERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            RP SEYGSG      YE+P SEYGSG+G      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  198  RPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  257



>gb|KJB11094.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=370

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>ref|XP_010258398.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Nelumbo nucifera]
Length=312

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 5/97 (5%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            M YY +G  A DD  +      PTPY GGYDI +TYGR + PS+E CYPISS+S D DY+
Sbjct  1    MPYYSRGDDAADDFDEYD----PTPYGGGYDIGLTYGRSLDPSDEICYPISSSSSDIDYE  56

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKP-KPRPGPSY  333
            RPQY+S+AEPSAY D+AL  EY SYA+P +P P P+Y
Sbjct  57   RPQYSSYAEPSAYGDDALATEYSSYARPNRPNPQPAY  93



>gb|KJB11082.1| hypothetical protein B456_001G240600 [Gossypium raimondii]
Length=384

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 106/203 (52%), Gaps = 38/203 (19%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+ PS+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  20   PTPYGGGYNLELTYGRPLEPSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  79

Query  289  YKSYAKPKPRPGP--------SYGGSSEAgynrrpgggggyggeseygseggygrrpeQQ  444
            Y SY KPKPRPG          YG   E        G     G      E  +GRRPE +
Sbjct  80   YSSYLKPKPRPGRFEPAPAFGDYGRKPEYEQFESGHGRKPEFGRPGSEFESDFGRRPEFE  139

Query  445  RPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSSEYGS  537
            +P  E+GSG+ R                       P  E+G+G+ R+      P  E+ S
Sbjct  140  QPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGTGYRRRPEFEQPPPPEFES  199

Query  538  GYGRRNEDERPDSEYGSGNRRKP  606
            G+GRR E    +SE+GS   RKP
Sbjct  200  GHGRRPEYGEQESEFGSEYGRKP  222



>ref|XP_010258396.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Nelumbo nucifera]
Length=365

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 5/97 (5%)
 Frame = +1

Query  46   MSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYD  225
            M YY +G  A DD  +      PTPY GGYDI +TYGR + PS+E CYPISS+S D DY+
Sbjct  1    MPYYSRGDDAADDFDEYD----PTPYGGGYDIGLTYGRSLDPSDEICYPISSSSSDIDYE  56

Query  226  RPQYTSHAEPSAYADEALDNEYKSYAKP-KPRPGPSY  333
            RPQY+S+AEPSAY D+AL  EY SYA+P +P P P+Y
Sbjct  57   RPQYSSYAEPSAYGDDALATEYSSYARPNRPNPQPAY  93



>gb|KCW56279.1| hypothetical protein EUGRSUZ_I02023 [Eucalyptus grandis]
Length=463

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDF--DYDRPQY-TSHAEPSAYADEAL  279
            PTP+ GGYDI+VTYGRP+ PSEE CYP  SS++G    DYD P + +SH EP+AYA++AL
Sbjct  19   PTPFGGGYDISVTYGRPLEPSEEICYPSTSSSTGGLEDDYDCPHFASSHDEPAAYAEDAL  78

Query  280  DNEYKSYAKPKPR  318
              EY SYA+PKPR
Sbjct  79   QAEYSSYARPKPR  91


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSG  591
            +RP +EYGSGYE+P +EYGSGHGR P SEYGSG+G R E E+P SEYGSG
Sbjct  175  RRPEAEYGSGYEKPSTEYGSGHGR-PGSEYGSGHGGRTEYEKPSSEYGSG  223


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            ++PS+EYGSG+ RP SEYGSGHG      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  186  EKPSTEYGSGHGRPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  240


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 11/60 (18%)
 Frame = +1

Query  445  RPSSEYGSG------YERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            RP SEYGSG      YE+P SEYGSG+G      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  198  RPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  257



>ref|XP_010029378.1| PREDICTED: uncharacterized protein At5g39570-like isoform X3 
[Eucalyptus grandis]
Length=474

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDF--DYDRPQY-TSHAEPSAYADEAL  279
            PTP+ GGYDI+VTYGRP+ PSEE CYP  SS++G    DYD P + +SH EP+AYA++AL
Sbjct  19   PTPFGGGYDISVTYGRPLEPSEEICYPSTSSSTGGLEDDYDCPHFASSHDEPAAYAEDAL  78

Query  280  DNEYKSYAKPKPR  318
              EY SYA+PKPR
Sbjct  79   QAEYSSYARPKPR  91


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSG  591
            +RP +EYGSGYE+P +EYGSGHGR P SEYGSG+G R E E+P SEYGSG
Sbjct  175  RRPEAEYGSGYEKPSTEYGSGHGR-PGSEYGSGHGGRTEYEKPSSEYGSG  223


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            ++PS+EYGSG+ RP SEYGSGHG      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  186  EKPSTEYGSGHGRPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  240


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 11/60 (18%)
 Frame = +1

Query  445  RPSSEYGSG------YERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            RP SEYGSG      YE+P SEYGSG+G      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  198  RPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  257



>ref|XP_008341599.1| PREDICTED: uncharacterized protein At5g39570-like [Malus domestica]
Length=141

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +1

Query  115  TPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEYK  294
            TPY+GGYD+ +TYGRP+ PSEETCY  SSAS   DYD P++ S+ EPSAY DEAL+ EY 
Sbjct  26   TPYEGGYDMGLTYGRPLQPSEETCYRHSSASD--DYDEPEFPSYNEPSAYDDEALEEEYS  83

Query  295  SYAKP  309
            SYA+P
Sbjct  84   SYARP  88



>ref|XP_010029376.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029377.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Eucalyptus grandis]
 gb|KCW56278.1| hypothetical protein EUGRSUZ_I02023 [Eucalyptus grandis]
Length=489

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDF--DYDRPQY-TSHAEPSAYADEAL  279
            PTP+ GGYDI+VTYGRP+ PSEE CYP  SS++G    DYD P + +SH EP+AYA++AL
Sbjct  19   PTPFGGGYDISVTYGRPLEPSEEICYPSTSSSTGGLEDDYDCPHFASSHDEPAAYAEDAL  78

Query  280  DNEYKSYAKPKPR  318
              EY SYA+PKPR
Sbjct  79   QAEYSSYARPKPR  91


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSG  591
            +RP +EYGSGYE+P +EYGSGHGR P SEYGSG+G R E E+P SEYGSG
Sbjct  175  RRPEAEYGSGYEKPSTEYGSGHGR-PGSEYGSGHGGRTEYEKPSSEYGSG  223


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            ++PS+EYGSG+ RP SEYGSGHG      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  186  EKPSTEYGSGHGRPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  240


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 11/60 (18%)
 Frame = +1

Query  445  RPSSEYGSG------YERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            RP SEYGSG      YE+P SEYGSG+G      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  198  RPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  257



>ref|XP_009420742.1| PREDICTED: uncharacterized protein At5g39570-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 88/160 (55%), Gaps = 20/160 (13%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYD+++T+GRP+ PSEETCYPISSA  + DY RPQY+S + PSAY         
Sbjct  20   PTPYGGGYDLSLTFGRPLPPSEETCYPISSAGSNVDYARPQYSSGSVPSAYGASDYG---  76

Query  292  KSYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGSG  471
            + Y +PKP+P P+YG   +             GG       G  G R  Q RP      G
Sbjct  77   EPYGRPKPKPEPAYGFRPQ---------QEVEGGGGVGDFGGYGGGRRPQPRP------G  121

Query  472  YERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSG  591
            ++   SE GSG+G   S EYGSGYGR       DS YG G
Sbjct  122  FQDHGSEPGSGYGG--SEEYGSGYGRGLPKRDEDSSYGYG  159



>gb|KCW56277.1| hypothetical protein EUGRSUZ_I02023 [Eucalyptus grandis]
Length=486

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDF--DYDRPQY-TSHAEPSAYADEAL  279
            PTP+ GGYDI+VTYGRP+ PSEE CYP  SS++G    DYD P + +SH EP+AYA++AL
Sbjct  19   PTPFGGGYDISVTYGRPLEPSEEICYPSTSSSTGGLEDDYDCPHFASSHDEPAAYAEDAL  78

Query  280  DNEYKSYAKPKPR  318
              EY SYA+PKPR
Sbjct  79   QAEYSSYARPKPR  91


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSG  591
            +RP +EYGSGYE+P +EYGSGHGR P SEYGSG+G R E E+P SEYGSG
Sbjct  175  RRPEAEYGSGYEKPSTEYGSGHGR-PGSEYGSGHGGRTEYEKPSSEYGSG  223


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            ++PS+EYGSG+ RP SEYGSGHG      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  186  EKPSTEYGSGHGRPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  240


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 11/60 (18%)
 Frame = +1

Query  445  RPSSEYGSG------YERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            RP SEYGSG      YE+P SEYGSG+G      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  198  RPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  257



>gb|KCW56276.1| hypothetical protein EUGRSUZ_I02023 [Eucalyptus grandis]
Length=501

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYP-ISSASGDF--DYDRPQY-TSHAEPSAYADEAL  279
            PTP+ GGYDI+VTYGRP+ PSEE CYP  SS++G    DYD P + +SH EP+AYA++AL
Sbjct  19   PTPFGGGYDISVTYGRPLEPSEEICYPSTSSSTGGLEDDYDCPHFASSHDEPAAYAEDAL  78

Query  280  DNEYKSYAKPKPR  318
              EY SYA+PKPR
Sbjct  79   QAEYSSYARPKPR  91


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHGRKPSSEYGSGYGRRNEDERPDSEYGSG  591
            +RP +EYGSGYE+P +EYGSGHGR P SEYGSG+G R E E+P SEYGSG
Sbjct  175  RRPEAEYGSGYEKPSTEYGSGHGR-PGSEYGSGHGGRTEYEKPSSEYGSG  223


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = +1

Query  442  QRPSSEYGSGYERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            ++PS+EYGSG+ RP SEYGSGHG      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  186  EKPSTEYGSGHGRPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  240


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 11/60 (18%)
 Frame = +1

Query  445  RPSSEYGSG------YERPDSEYGSGHG-----RKPSSEYGSGYGRRNEDERPDSEYGSG  591
            RP SEYGSG      YE+P SEYGSG+G      KPSSEYGSGYG R E E+P SEYGSG
Sbjct  198  RPGSEYGSGHGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSGYGGRTEYEKPSSEYGSG  257



>gb|KHG07281.1| hypothetical protein F383_34041 [Gossypium arboreum]
Length=420

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 107/207 (52%), Gaps = 42/207 (20%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGY++ +TYGRP+  S+ETCYP ++ S GDFDY RP ++S     AYADEAL+ E
Sbjct  67   PTPYGGGYNLELTYGRPLESSDETCYPSATPSDGDFDYARPDFSSGYAHLAYADEALETE  126

Query  289  YKSYAKPKPRPG-----PSYGGSS-------EAgynrrpgggggyggeseygseggygrr  432
            Y SY KPKPRPG     P++G  S       E        G     G      +  YGRR
Sbjct  127  YSSYLKPKPRPGRFEPAPAFGAGSGDYGRKPEYEQFESGHGRKPDFGRPGSEFDSDYGRR  186

Query  433  peQQRPSSEYGSGYER-----------------------PDSEYGSGHGRK------PSS  525
            PE ++P  E+GSG+ R                       P  E+GSG+ R+      P  
Sbjct  187  PEFEQPPEEFGSGHGRRPAYEHSHQPDFGSGRRSEFEQPPPPEFGSGYRRRPEFEQPPPP  246

Query  526  EYGSGYGRRNEDERPDSEYGSGNRRKP  606
            E+ SGYGRR E    +SEY S   RKP
Sbjct  247  EFESGYGRRPEYGEQESEYRSEYSRKP  273



>ref|XP_008230803.1| PREDICTED: uncharacterized protein At5g39570 [Prunus mume]
Length=156

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +1

Query  55   YPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRP  231
            Y  G+ A +D  D F+E+DPTPY+GGYD+ +TYGRP++PSE TCY  SS    + DYD+P
Sbjct  7    YYTGNDANEDSADVFEEYDPTPYEGGYDMALTYGRPVAPSERTCYRHSSGEDPEEDYDQP  66

Query  232  QYTSHAEPSAYADEALDNEYKSYAKP  309
            +++S+ EPSAY +EA+  EY SYA+P
Sbjct  67   EFSSYQEPSAYDEEAVKEEYSSYARP  92



>ref|XP_008800496.1| PREDICTED: uncharacterized protein At5g39570 [Phoenix dactylifera]
Length=305

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 3/76 (4%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYD+ +T+GRP+ PS+E C+P+SSA G D DY+RP YTS +  SAY  EA   +
Sbjct  20   PTPYGGGYDLALTFGRPLPPSDEICHPLSSAGGDDVDYNRPHYTSGSTTSAYGTEADLGD  79

Query  289  YKSYAKPKPRPGPSYG  336
               Y +P+P+P P+YG
Sbjct  80   --RYGRPRPKPQPAYG  93



>ref|XP_007217434.1| hypothetical protein PRUPE_ppb013941mg, partial [Prunus persica]
 gb|EMJ18633.1| hypothetical protein PRUPE_ppb013941mg, partial [Prunus persica]
Length=203

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +1

Query  55   YPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRP  231
            Y  G+ A +D  D F+E+DPTPY+GGYD+ +TYGRP++PSE TCY  SS    + DYD+P
Sbjct  7    YYTGNDANEDSADVFEEYDPTPYEGGYDMALTYGRPVAPSERTCYRHSSGEDPEEDYDQP  66

Query  232  QYTSHAEPSAYADEALDNEYKSYAKP  309
            +++S+ EPSAY +EA+  EY SYA+P
Sbjct  67   EFSSYQEPSAYDEEAVKEEYSSYARP  92



>ref|XP_010937212.1| PREDICTED: uncharacterized protein At5g39570-like [Elaeis guineensis]
Length=280

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 3/76 (4%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTSHAEPSAYADEALDNE  288
            PTPY GGYDI +TYGRP+SP++E C+PIS+A  GD DYDRP Y+S +  SAY  E   + 
Sbjct  21   PTPYGGGYDIALTYGRPLSPTDEICHPISNADGGDVDYDRPHYSSGSTTSAY--ETYADF  78

Query  289  YKSYAKPKPRPGPSYG  336
               Y  P+P+P P+YG
Sbjct  79   GDRYGPPRPKPQPAYG  94



>ref|XP_009419097.1| PREDICTED: uncharacterized protein At5g39570-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=216

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYD+++T+GRP+ PSEE CYP+SS +   DY+RP Y+S + PSAY  +  D   
Sbjct  20   PTPYGGGYDLSLTFGRPLPPSEEICYPLSSGASGVDYERPHYSSGSVPSAYEADYGD---  76

Query  292  KSYAKPKPRPGPSYG  336
              Y + +P+P P+YG
Sbjct  77   -PYGRSRPKPQPAYG  90



>ref|XP_009419095.1| PREDICTED: uncharacterized protein At5g39570-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=217

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYD+++T+GRP+ PSEE CYP+SS +   DY+RP Y+S + PSAY  +  D   
Sbjct  20   PTPYGGGYDLSLTFGRPLPPSEEICYPLSSGASGVDYERPHYSSGSVPSAYEADYGD---  76

Query  292  KSYAKPKPRPGPSYG  336
              Y + +P+P P+YG
Sbjct  77   -PYGRSRPKPQPAYG  90



>ref|XP_008348233.1| PREDICTED: uncharacterized protein At5g39570-like [Malus domestica]
Length=143

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY+GGYD+ +TYGRP+ P+E+TCY  SS S   D + P++ S  E SAY +EA+  EY
Sbjct  25   PTPYEGGYDMGLTYGRPLQPTEKTCYRHSSGSASDDSNEPEFPSCKESSAYDEEAVKEEY  84

Query  292  KSYAKP  309
             SYA+P
Sbjct  85   SSYARP  90



>gb|ACF88189.1| unknown [Zea mays]
 gb|AFW76799.1| hypothetical protein ZEAMMB73_357615 [Zea mays]
 gb|AFW76800.1| hypothetical protein ZEAMMB73_357615 [Zea mays]
Length=329

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 87/182 (48%), Gaps = 39/182 (21%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYD+ VT+GRP+ PSEETCYP S+ S    YD P Y + +EPS Y         
Sbjct  25   PTPYGGGYDLAVTFGRPLPPSEETCYPCSAPS--TSYDAPHYAA-SEPSPYGH-------  74

Query  292  KSYAKPKPRPG--------PSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQR  447
              +AKPKP  G        PSYG       +           E      G       +++
Sbjct  75   --HAKPKPNYGFRPQQEQQPSYG-------SGYGSRPEPAAEEGGGYGSGFGSGYGRKKQ  125

Query  448  PSSEYGSGYERP-------DSEYGSGHGRKPSSE--YGSGYGRRNEDERPDSEYGSGNRR  600
                YGSGY R         SEYGSG GRKP  E  YGSGYGR  + E     YGSG  R
Sbjct  126  EEESYGSGYGRKPQVEESYGSEYGSGFGRKPQIEESYGSGYGRTPQVEE---SYGSGYGR  182

Query  601  KP  606
            KP
Sbjct  183  KP  184



>ref|XP_010939838.1| PREDICTED: uncharacterized protein At5g39570-like [Elaeis guineensis]
Length=291

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASG-DFDYDRPQYTSHAEPSAYADEA  276
            PTPY GGYD+ +T+GRP+ PS+E CYP+SSA G D DY+RP Y+S +  SAY  EA
Sbjct  20   PTPYGGGYDLALTFGRPLPPSDEICYPLSSAGGDDVDYNRPHYSSGSTTSAYETEA  75



>ref|XP_010258266.1| PREDICTED: uncharacterized protein At5g39570-like [Nelumbo nucifera]
Length=232

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYDI VTYG+ + PS+E CYPISS+S D D +RPQY S++E SAY DEAL  EY
Sbjct  19   PTPYGGGYDIVVTYGQSLEPSDEICYPISSSSSDIDCERPQY-SYSEASAYGDEALQAEY  77

Query  292  KSY  300
             SY
Sbjct  78   SSY  80



>gb|KJB33498.1| hypothetical protein B456_006G014100 [Gossypium raimondii]
Length=245

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS-GDFDYDRPQYTS  243
            PTPY GG+D+ VTYG P+ PSEETCYP S+ S G+FDY+RP ++S
Sbjct  20   PTPYRGGFDLFVTYGHPLEPSEETCYPSSTQSDGNFDYERPHFSS  64



>ref|NP_001144466.1| uncharacterized protein LOC100277433 [Zea mays]
 gb|ACG40740.1| hypothetical protein [Zea mays]
Length=203

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSA  261
            PTPY GGYDI +T+GRP+ PSEETCYPIS+AS    YDRPQ      P A
Sbjct  22   PTPYGGGYDIALTFGRPLPPSEETCYPISTAS---SYDRPQQHGGRRPGA  68



>gb|AFW73381.1| putative protein kinase superfamily protein [Zea mays]
Length=203

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSA  261
            PTPY GGYDI +T+GRP+ PSEETCYPIS+AS    YDRPQ      P A
Sbjct  22   PTPYGGGYDIALTFGRPLPPSEETCYPISTAS---SYDRPQQHGGRRPGA  68



>ref|NP_001057224.1| Os06g0232000 [Oryza sativa Japonica Group]
 dbj|BAC78584.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD38152.1| putative RNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF19138.1| Os06g0232000 [Oryza sativa Japonica Group]
 gb|EAZ00259.1| hypothetical protein OsI_22270 [Oryza sativa Indica Group]
 gb|EAZ36373.1| hypothetical protein OsJ_20701 [Oryza sativa Japonica Group]
 dbj|BAG92688.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97533.1| unnamed protein product [Oryza sativa Japonica Group]
Length=381

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 96/208 (46%), Gaps = 46/208 (22%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEAL----  279
            PTPY GGYD+ +T+GRP+ PS+ETCYP S+ S    YD P Y++  EPS YA  +     
Sbjct  27   PTPYGGGYDLFITFGRPLPPSDETCYPCSAPS--TSYDAPHYSA-DEPSPYAHHSKPQPA  83

Query  280  --------DNEYKSYA----KPKPRPGPSYGGS---SEAgynrrpgggggyggeseygse  414
                      +  SYA    +P+     SYG S   S+                   G  
Sbjct  84   YGFRPQHEQQQQPSYASSGYRPQHEQQQSYGSSGYGSKPQPAYGFRPQAEEENTYGSGYG  143

Query  415  ggygrrpeQQRPSSEYGSGYER-PDSE--YGSGHGRKPSSE-------------------  528
             GYG    +Q+    YGSGY R P  E  YGSG+G KP  E                   
Sbjct  144  SGYGGGGRKQQEEESYGSGYGRKPQVEESYGSGYGTKPQQEESYGSGYGSGYGTKPQQEE  203

Query  529  -YGSGYGRR-NEDERPDSEYGSGNRRKP  606
             YGSGYGR+  ++E   SEYGSG  RKP
Sbjct  204  SYGSGYGRKPQQEESYGSEYGSGYGRKP  231



>dbj|BAJ92075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 89/208 (43%), Gaps = 50/208 (24%)
 Frame = +1

Query  115  TPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEAL-----  279
            TPY GGYD+ VT+GRP+ PS+ETCYP S+ S    YD P Y +  EPS YA         
Sbjct  22   TPYGGGYDLFVTFGRPLPPSDETCYPCSAPS--TSYDAPHYAAE-EPSPYAHHQKPQPAY  78

Query  280  ------------------DNEYKSYAKPKPRPG-----------PSYGGSSEAgynrrpg  372
                              D+ Y S  KP+P  G           PSYGG  E   +    
Sbjct  79   GFRPQNEQQQQQQQPSYGDSGYGSKPKPQPAYGFRPQGEEEQQRPSYGGGGEVDDSGYGS  138

Query  373  ggggyggeseygseggygrrpeQQRPS----SEYGSGYERP----DSEYGSGHGRKPSSE  528
                  G      E          +P       YGSGY R     ++ YGSG+GRKP +E
Sbjct  139  KPQPAYGFRPQQEEQPSYGSGYGSKPQRSEEDTYGSGYGRKPQQEEAAYGSGYGRKPQAE  198

Query  529  --YGSGYGRRNEDERPDSEYGSGNRRKP  606
              YGSGYG   + E     YGSG   KP
Sbjct  199  ESYGSGYGNTTQQE---EGYGSGYGSKP  223



>ref|XP_002438115.1| hypothetical protein SORBIDRAFT_10g008260 [Sorghum bicolor]
 gb|EER89482.1| hypothetical protein SORBIDRAFT_10g008260 [Sorghum bicolor]
Length=382

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 90/196 (46%), Gaps = 44/196 (22%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEY  291
            PTPY GGYD+ VT+GRP+ PSEETCYP S+ S    YD P Y++ +EPS Y         
Sbjct  27   PTPYGGGYDLAVTFGRPLPPSEETCYPCSAPS--TSYDAPHYSA-SEPSPYGH-------  76

Query  292  KSYAKPKP----RPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSE  459
              +AKPKP    RP          G                YGS  G G   +QQ   S 
Sbjct  77   --HAKPKPNYGFRPQQEQQPPYGGGGGYGSTPEPPAEEGGGYGSGYGSGYGRKQQAEES-  133

Query  460  YGSGYER-----------------------PDSEYGS---GHGRKPSSEYGSGYGRRNE-  558
            YGSGY R                       P+  YGS   G    P+  YGSGYGR+ + 
Sbjct  134  YGSGYGRKPPQAEESYGSGGYGSGYGGQTRPEESYGSAGYGSANPPAESYGSGYGRKPQV  193

Query  559  DERPDSEYGSGNRRKP  606
            DE   SEYGSG  RKP
Sbjct  194  DESYGSEYGSGYGRKP  209



>ref|XP_003564041.1| PREDICTED: uncharacterized protein At5g39570 [Brachypodium distachyon]
Length=384

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 80/181 (44%), Gaps = 36/181 (20%)
 Frame = +1

Query  115  TPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEALDNEYK  294
            TPY GGYD+ VT+GRP+ PS+ETCYP S+ S    YD P Y S  +PS YA         
Sbjct  28   TPYGGGYDLFVTFGRPLPPSDETCYPCSAPS--TSYDAPHYASE-DPSPYAHHQ------  78

Query  295  SYAKPKPRPGPSYGGSSEAgynrrpgggggyggeseygseggygrrpeQQRPSSEYGSGY  474
                   +P P+YG   +    ++                        Q+     YGSGY
Sbjct  79   -------KPQPAYGFRPQQEQKQQHQQPSYGDDSGYGSKPQAAYGFRPQEEEQQSYGSGY  131

Query  475  ---------ERPDSE----YGSGHGRKPS----SEYGSGYGRRNEDERPDSEYGSGNRRK  603
                      RP  E    YGSG+G KP       YGSGYGR+ ++E     YGSG   K
Sbjct  132  GSKPQPAYGFRPQQEEEQSYGSGYGSKPQRTEEDTYGSGYGRKPQEE---VSYGSGYGSK  188

Query  604  P  606
            P
Sbjct  189  P  189



>ref|XP_002454297.1| hypothetical protein SORBIDRAFT_04g028150 [Sorghum bicolor]
 gb|EES07273.1| hypothetical protein SORBIDRAFT_04g028150 [Sorghum bicolor]
Length=214

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPI-SSASGDFDYDRPQYTSHA  249
            PTPY GGYDI +T+GRP+ PSEETCYPI ++ S    YDRPQ   H 
Sbjct  24   PTPYGGGYDIALTFGRPLPPSEETCYPISTATSSASSYDRPQQAQHG  70



>ref|XP_004965057.1| PREDICTED: uncharacterized protein At5g39570-like [Setaria italica]
Length=348

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYA  267
            PTPY GGYD+ VT+GRP+ PSEETCYP S  S    YD P Y++ +EPS Y 
Sbjct  25   PTPYGGGYDLFVTFGRPLPPSEETCYPCSEPS--TSYDAPHYSA-SEPSPYG  73



>ref|XP_006655944.1| PREDICTED: uncharacterized protein At5g39570-like [Oryza brachyantha]
Length=425

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQYTSHAEPSAYADEA  276
            PTPY GGYD+ VT+GRP+ PS+ETC+P S+ S    YD P Y++  EPS YA  A
Sbjct  24   PTPYGGGYDLFVTFGRPLPPSDETCHPCSAPS--TSYDAPHYSAD-EPSPYARHA  75



>ref|XP_006649041.1| PREDICTED: uncharacterized protein At5g39570-like [Oryza brachyantha]
Length=199

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSASGDFDYDRPQY  237
            PTPY GGYD+ +T+GR + PS+E C+PIS+AS     DRPQY
Sbjct  23   PTPYGGGYDLALTFGRALPPSDEICHPISTASSSSSCDRPQY  64



>ref|XP_003573102.1| PREDICTED: uncharacterized protein At5g39570 [Brachypodium distachyon]
Length=235

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPY GGYDIT+T+GR + PS+ETCYP+S+A
Sbjct  22   PTPYGGGYDITLTFGRALPPSDETCYPVSTA  52



>dbj|BAD16110.1| glycine-rich protein-like [Oryza sativa Japonica Group]
Length=181

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA-SGDFDYDRPQ  234
            PTPY GGYDI +T+GR + PS+E C+PIS+A S    YDRPQ
Sbjct  23   PTPYGGGYDIALTFGRALPPSDEICHPISTASSSSSSYDRPQ  64



>gb|EAZ24591.1| hypothetical protein OsJ_08352 [Oryza sativa Japonica Group]
Length=155

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA-SGDFDYDRPQ  234
            PTPY GGYDI +T+GR + PS+E C+PIS+A S    YDRPQ
Sbjct  23   PTPYGGGYDIALTFGRALPPSDEICHPISTASSSSSSYDRPQ  64



>gb|EAY87501.1| hypothetical protein OsI_08907 [Oryza sativa Indica Group]
Length=199

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA-SGDFDYDRPQ  234
            PTPY GGYDI +T+GR + PS+E C+PIS+A S    YDRPQ
Sbjct  23   PTPYGGGYDIALTFGRALPPSDEICHPISTASSSSSSYDRPQ  64



>ref|XP_009597294.1| PREDICTED: uncharacterized protein LOC104093272 [Nicotiana tomentosiformis]
Length=319

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = +1

Query  1    IAYPKQAAPEEPKSTMSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEE  180
            I Y K A   E +  +SY  K H     D   F+E+DPTPY GGYD+  TYG+PISPS E
Sbjct  78   IQYEKAANSLETRYVISYSTKQH-----DDTVFEEYDPTPYGGGYDMAQTYGKPISPSNE  132

Query  181  TCYP--ISSASGDFDYDRPQYTSHAEPSAYADEALD  282
             CYP  +  ++G   +D   Y S   P    D+ L+
Sbjct  133  ICYPRSVPKSNGLNGFDSFDYGSIPSPYVKHDDLLE  168



>ref|XP_007213161.1| hypothetical protein PRUPE_ppa025399mg [Prunus persica]
 gb|EMJ14360.1| hypothetical protein PRUPE_ppa025399mg [Prunus persica]
Length=319

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS  207
            PTPYDGG+DI   YG+P+SPS+ETCYP++  S
Sbjct  110  PTPYDGGFDIAQVYGKPLSPSDETCYPLNGGS  141



>gb|EMT26355.1| hypothetical protein F775_25952 [Aegilops tauschii]
Length=239

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPI  195
            PTPY GGYDIT+T+GR + PS+E CYPI
Sbjct  22   PTPYGGGYDITLTFGRALPPSDEICYPI  49



>gb|EMS64373.1| hypothetical protein TRIUR3_17490 [Triticum urartu]
Length=224

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPI  195
            PTPY GGYDIT+T+GR + PS+E CYPI
Sbjct  22   PTPYGGGYDITLTFGRALPPSDEICYPI  49



>ref|XP_008224892.1| PREDICTED: uncharacterized protein LOC103324600 [Prunus mume]
Length=320

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSAS  207
            PTPYDGG+D+   YG+P+SPS+ETCYP++  S
Sbjct  111  PTPYDGGFDLAQVYGKPLSPSDETCYPMNGGS  142



>ref|XP_008340806.1| PREDICTED: uncharacterized protein At5g39570-like [Malus domestica]
 ref|XP_008361963.1| PREDICTED: uncharacterized protein At5g39570-like [Malus domestica]
Length=234

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 11/61 (18%)
 Frame = +1

Query  454  SEYGSGYER------PDSEYGSGHGRKPS-----SEYGSGYGRRNEDERPDSEYGSGNRR  600
            +EYGSGY R      P+ EYG G+GRKP      SEYGSGYGR+ + E P +E+GSGN R
Sbjct  51   TEYGSGYSRKPEYKAPEPEYGYGYGRKPEYEAPESEYGSGYGRKPKFEAPPTEFGSGNGR  110

Query  601  K  603
            K
Sbjct  111  K  111



>ref|XP_004232762.1| PREDICTED: uncharacterized protein LOC101267957 [Solanum lycopersicum]
Length=325

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 17/106 (16%)
 Frame = +1

Query  1    IAYPKQAAPEEPKSTMSYYPKGHHAGdddvddfdefdPTPYDGGYDITVTYGRPISPSEE  180
            I Y K A   E ++ +S Y K     + D   FDE+DPTPYDGG+D+  TYG+P+ PS E
Sbjct  67   IQYEKGADSLETRTVISCYTK-----ELDDTQFDEYDPTPYDGGFDMAQTYGKPLPPSNE  121

Query  181  TCYPISSASGD------FDY--DRPQYTSHAEPSAYADEALDNEYK  294
             CYP S+   +      FDY  +   Y +HA       E L N+ K
Sbjct  122  ICYPRSTLKSNGLPLDGFDYGSNNLPYVNHANQL----EQLQNQKK  163



>ref|XP_009110724.1| PREDICTED: uncharacterized protein LOC103836230 [Brassica rapa]
Length=314

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPY GGYDI  TYG+P+ PSE+TCYP SSA
Sbjct  112  PTPYGGGYDIVATYGKPLPPSEKTCYPSSSA  142



>ref|XP_010476064.1| PREDICTED: uncharacterized protein LOC104755393 [Camelina sativa]
Length=391

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPY GGYD+  TYG+P+ PS ETCYP S+A
Sbjct  162  PTPYGGGYDVVATYGKPLPPSVETCYPCSTA  192



>emb|CDY20997.1| BnaA08g25280D [Brassica napus]
Length=315

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPY GGYDI  TYG+P+ PSE+TCYP S+A
Sbjct  112  PTPYGGGYDIVATYGKPLPPSEKTCYPSSTA  142



>gb|AAU87303.1| hypothetical protein [Pinus halepensis]
Length=323

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 47/99 (47%), Gaps = 24/99 (24%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA---------------------SGDFDYDR  228
            PTP+ GGYD  VTYG+   PSEETCYP S A                     + D D  R
Sbjct  17   PTPFGGGYDQGVTYGKSRPPSEETCYPPSQAGDESSHDFSYGSESCPYEGGGAHDIDEQR  76

Query  229  PQYTSHAEPSAYADEAL---DNEYKSYAKPKPRPGPSYG  336
            P Y S + PS  A+E+          Y +PKP+  P+YG
Sbjct  77   PTYGSGSTPSYEAEESTYVGGGGGSDYGRPKPQSQPAYG  115



>ref|NP_172611.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF16629.1|AC011661_7 T23J18.11 [Arabidopsis thaliana]
 dbj|BAC42466.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAP12897.1| At1g11440 [Arabidopsis thaliana]
 gb|AEE28736.1| uncharacterized protein AT1G11440 [Arabidopsis thaliana]
Length=363

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPY GGYD+  TYG+P+ PS ETCYP S+A
Sbjct  136  PTPYGGGYDVVATYGKPLPPSVETCYPCSTA  166



>emb|CDY57038.1| BnaC08g14940D [Brassica napus]
Length=320

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPY GGYDI  TYG+P+ PSE+TCYP S+A
Sbjct  113  PTPYGGGYDIVATYGKPLPPSEKTCYPSSTA  143



>ref|XP_006467940.1| PREDICTED: uncharacterized protein LOC102616344 [Citrus sinensis]
 gb|KDO75638.1| hypothetical protein CISIN_1g024029mg [Citrus sinensis]
Length=273

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS  201
            PTPY GGYD+ +TYG P+SPSE TCYP SS
Sbjct  111  PTPYAGGYDLALTYGEPLSPSEATCYPRSS  140



>gb|KDO36695.1| hypothetical protein CISIN_1g017568mg [Citrus sinensis]
Length=332

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 9/58 (16%)
 Frame = +1

Query  445  RPSSEYGSGY-ERPDS-EYGSGHGRKPSSE-YGSGYGRRNEDERPDSE-YGSGNRRKP  606
            RP SEY SGY +RPDS EYGSG+G++P SE YGSGYGR     +PDSE +GSG  R+P
Sbjct  79   RPESEYASGYAKRPDSQEYGSGYGKRPESEEYGSGYGR-----KPDSEVHGSGYGRRP  131



>ref|XP_006449160.1| hypothetical protein CICLE_v10016236mg [Citrus clementina]
 gb|ESR62400.1| hypothetical protein CICLE_v10016236mg [Citrus clementina]
Length=273

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS  201
            PTPY GGYD+ +TYG P+SPSE TCYP SS
Sbjct  111  PTPYAGGYDLALTYGEPLSPSEATCYPRSS  140



>ref|XP_008371220.1| PREDICTED: uncharacterized protein At5g39570 [Malus domestica]
Length=320

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS  201
            PTPY GG+DI  TYG+P+SPS ETCYP SS
Sbjct  126  PTPYGGGFDIVQTYGKPLSPSLETCYPRSS  155



>ref|XP_010098587.1| hypothetical protein L484_026029 [Morus notabilis]
 gb|EXB75247.1| hypothetical protein L484_026029 [Morus notabilis]
Length=359

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPYDGGYDI  TYG+P+ P+++ CYP S+A
Sbjct  129  PTPYDGGYDIAQTYGKPLPPTDQICYPRSTA  159



>ref|XP_002889868.1| hypothetical protein ARALYDRAFT_471281 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66127.1| hypothetical protein ARALYDRAFT_471281 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISSA  204
            PTPY GGYD+  TYG+P+ PS ETCYP S+A
Sbjct  136  PTPYGGGYDVVATYGKPLPPSVETCYPSSTA  166



>ref|XP_009369233.1| PREDICTED: uncharacterized protein LOC103958632 [Pyrus x bretschneideri]
Length=313

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  112  PTPYDGGYDITVTYGRPISPSEETCYPISS  201
            PTPY GG+DI  TYG+P+SPS ETCYP SS
Sbjct  126  PTPYGGGFDIAQTYGKPLSPSLETCYPRSS  155



>gb|KDO36696.1| hypothetical protein CISIN_1g017568mg [Citrus sinensis]
Length=332

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 9/58 (16%)
 Frame = +1

Query  445  RPSSEYGSGY-ERPDS-EYGSGHGRKPSSE-YGSGYGRRNEDERPDSE-YGSGNRRKP  606
            RP SEY SGY +RPDS EYGSG+G++P SE YGSGYGR     +PDSE +GSG  R+P
Sbjct  79   RPESEYASGYAKRPDSQEYGSGYGKRPESEEYGSGYGR-----KPDSEVHGSGYGRRP  131



Lambda      K        H        a         alpha
   0.304    0.128    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1105426564043