BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1634

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004233270.1|  PREDICTED: allantoate deiminase                    266   1e-82   Solanum lycopersicum
ref|XP_009774500.1|  PREDICTED: allantoate deiminase                    265   4e-82   Nicotiana sylvestris
ref|XP_009628190.1|  PREDICTED: allantoate deiminase                    265   5e-82   Nicotiana tomentosiformis
ref|XP_006365002.1|  PREDICTED: allantoate deiminase-like               265   5e-82   Solanum tuberosum [potatoes]
emb|CDP18199.1|  unnamed protein product                                250   8e-78   Coffea canephora [robusta coffee]
emb|CBI27216.3|  unnamed protein product                                252   2e-77   Vitis vinifera
ref|XP_002275843.2|  PREDICTED: allantoate deiminase                    252   2e-77   Vitis vinifera
ref|XP_006448626.1|  hypothetical protein CICLE_v10015120mg             250   8e-77   Citrus clementina [clementine]
ref|XP_006468549.1|  PREDICTED: allantoate deiminase-like               249   3e-76   Citrus sinensis [apfelsine]
ref|XP_010051826.1|  PREDICTED: allantoate deiminase isoform X1         245   1e-74   Eucalyptus grandis [rose gum]
gb|KCW75654.1|  hypothetical protein EUGRSUZ_D00017                     245   2e-74   Eucalyptus grandis [rose gum]
ref|XP_010260695.1|  PREDICTED: allantoate deiminase isoform X2         241   7e-74   Nelumbo nucifera [Indian lotus]
ref|XP_003533667.1|  PREDICTED: allantoate deiminase-like isoform X1    241   3e-73   
ref|XP_010260694.1|  PREDICTED: allantoate deiminase isoform X1         241   6e-73   Nelumbo nucifera [Indian lotus]
ref|XP_007138852.1|  hypothetical protein PHAVU_009G242900g             235   9e-73   Phaseolus vulgaris [French bean]
ref|XP_012088570.1|  PREDICTED: allantoate deiminase isoform X1         239   2e-72   Jatropha curcas
ref|XP_006369050.1|  peptidase M20/M25/M40 family protein               239   3e-72   
gb|ACK75561.1|  allantoate amidohydrolase                               238   5e-72   Glycine max [soybeans]
gb|KJB48026.1|  hypothetical protein B456_008G050700                    234   8e-72   Gossypium raimondii
gb|EYU43647.1|  hypothetical protein MIMGU_mgv1a005319mg                238   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_012088571.1|  PREDICTED: allantoate deiminase isoform X2         237   2e-71   Jatropha curcas
emb|CAO78893.1|  allantoate amidohydrolase                              237   2e-71   Glycine max [soybeans]
gb|KHN47732.1|  Allantoate deiminase, chloroplastic                     237   2e-71   Glycine soja [wild soybean]
ref|NP_001236563.1|  allantoate amidohydrolase precursor                237   2e-71   Glycine max [soybeans]
ref|XP_011035487.1|  PREDICTED: allantoate deiminase isoform X2         236   2e-71   Populus euphratica
gb|KEH37362.1|  allantoate amidohydrolase                               233   3e-71   Medicago truncatula
gb|KJB48030.1|  hypothetical protein B456_008G050700                    234   3e-71   Gossypium raimondii
ref|XP_011035486.1|  PREDICTED: allantoate deiminase isoform X1         236   3e-71   Populus euphratica
ref|XP_007138851.1|  hypothetical protein PHAVU_009G242900g             236   4e-71   Phaseolus vulgaris [French bean]
gb|ABR57240.2|  putative allantoate amidohydrolase                      236   4e-71   Phaseolus vulgaris [French bean]
gb|KJB48028.1|  hypothetical protein B456_008G050700                    234   4e-71   Gossypium raimondii
ref|XP_011096836.1|  PREDICTED: allantoate deiminase                    235   8e-71   Sesamum indicum [beniseed]
gb|KJB48025.1|  hypothetical protein B456_008G050700                    234   1e-70   Gossypium raimondii
gb|KEH37360.1|  allantoate amidohydrolase                               233   4e-70   Medicago truncatula
gb|EPS72270.1|  hypothetical protein M569_02484                         231   1e-69   Genlisea aurea
ref|XP_007041019.1|  Allantoate amidohydrolase isoform 1                231   4e-69   Theobroma cacao [chocolate]
ref|XP_008225895.1|  PREDICTED: allantoate deiminase                    231   5e-69   Prunus mume [ume]
ref|XP_003594851.1|  Allantoate amidohydrolase                          232   8e-69   
ref|XP_007212027.1|  hypothetical protein PRUPE_ppa005027mg             229   9e-69   
ref|XP_008383283.1|  PREDICTED: allantoate deiminase                    229   2e-68   Malus domestica [apple tree]
ref|XP_010684279.1|  PREDICTED: allantoate deiminase                    229   2e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007212028.1|  hypothetical protein PRUPE_ppa005027mg             229   2e-68   
ref|XP_009354000.1|  PREDICTED: allantoate deiminase-like               229   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_009340289.1|  PREDICTED: allantoate deiminase-like               229   4e-68   
ref|XP_008446305.1|  PREDICTED: allantoate deiminase                    229   6e-68   
ref|XP_004487907.1|  PREDICTED: allantoate deiminase, chloroplast...    227   6e-68   Cicer arietinum [garbanzo]
ref|XP_004145132.1|  PREDICTED: allantoate deiminase isoform X1         228   7e-68   Cucumis sativus [cucumbers]
ref|XP_008809340.1|  PREDICTED: probable allantoate deiminase iso...    226   6e-67   
ref|XP_004293794.2|  PREDICTED: allantoate deiminase                    227   8e-67   Fragaria vesca subsp. vesca
ref|XP_010914254.1|  PREDICTED: probable allantoate deiminase iso...    225   8e-67   Elaeis guineensis
ref|XP_010914255.1|  PREDICTED: probable allantoate deiminase iso...    225   9e-67   
ref|XP_002869950.1|  hypothetical protein ARALYDRAFT_914645             224   3e-66   Arabidopsis lyrata subsp. lyrata
ref|NP_193740.1|  allantoate amidohydrolase                             224   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097117.1|  Allantoate deiminase                               223   5e-66   
ref|XP_008809341.1|  PREDICTED: probable allantoate deiminase iso...    222   9e-66   Phoenix dactylifera
ref|XP_008809339.1|  PREDICTED: probable allantoate deiminase iso...    223   1e-65   
ref|XP_008809343.1|  PREDICTED: probable allantoate deiminase iso...    222   1e-65   
ref|XP_010536943.1|  PREDICTED: allantoate deiminase                    222   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_011628473.1|  PREDICTED: allantoate deiminase                    222   2e-65   Amborella trichopoda
ref|XP_010449233.1|  PREDICTED: allantoate deiminase                    222   3e-65   Camelina sativa [gold-of-pleasure]
gb|ERN19684.1|  hypothetical protein AMTR_s00062p00185230               221   4e-65   Amborella trichopoda
ref|XP_010434321.1|  PREDICTED: allantoate deiminase-like               220   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010439619.1|  PREDICTED: allantoate deiminase-like               220   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009408249.1|  PREDICTED: probable allantoate deiminase iso...    218   2e-64   
ref|XP_009408248.1|  PREDICTED: probable allantoate deiminase iso...    218   3e-64   
ref|XP_006413903.1|  hypothetical protein EUTSA_v10024702mg             218   8e-64   
ref|NP_001058304.1|  Os06g0665500                                       216   1e-63   
gb|EEC81134.1|  hypothetical protein OsI_24029                          216   1e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_006413904.1|  hypothetical protein EUTSA_v10024702mg             219   2e-63   
ref|XP_006283501.1|  hypothetical protein CARUB_v10004553mg             217   2e-63   Capsella rubella
gb|EEE66180.1|  hypothetical protein OsJ_22281                          216   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137035.1|  PREDICTED: allantoate deiminase                    217   2e-63   Brassica rapa
emb|CDY01635.1|  BnaC07g36250D                                          216   3e-63   
emb|CDX98655.1|  BnaA03g44400D                                          216   3e-63   
ref|XP_002532138.1|  conserved hypothetical protein                     214   5e-63   
ref|NP_001151245.1|  metallopeptidase precursor                         215   5e-63   Zea mays [maize]
ref|XP_002438812.1|  hypothetical protein SORBIDRAFT_10g026590          215   8e-63   Sorghum bicolor [broomcorn]
ref|XP_010240400.1|  PREDICTED: probable allantoate deiminase iso...    214   1e-62   
gb|EMS60014.1|  Allantoate deiminase, chloroplastic                     211   2e-62   Triticum urartu
ref|XP_010240394.1|  PREDICTED: probable allantoate deiminase iso...    213   4e-62   Brachypodium distachyon [annual false brome]
ref|XP_004965622.1|  PREDICTED: allantoate deiminase, chloroplast...    212   1e-61   Setaria italica
ref|XP_004965621.1|  PREDICTED: allantoate deiminase, chloroplast...    210   7e-61   
dbj|BAK06888.1|  predicted protein                                      209   7e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657227.1|  PREDICTED: probable allantoate deiminase-like      209   1e-59   
gb|KDO77269.1|  hypothetical protein CISIN_1g015341mg                   195   1e-57   Citrus sinensis [apfelsine]
gb|KDO77268.1|  hypothetical protein CISIN_1g015341mg                   195   2e-57   Citrus sinensis [apfelsine]
gb|KDO77270.1|  hypothetical protein CISIN_1g015341mg                   195   2e-57   Citrus sinensis [apfelsine]
gb|KDO77266.1|  hypothetical protein CISIN_1g015341mg                   197   3e-57   Citrus sinensis [apfelsine]
gb|KDO77267.1|  hypothetical protein CISIN_1g015341mg                   197   3e-57   Citrus sinensis [apfelsine]
gb|KDO77263.1|  hypothetical protein CISIN_1g015341mg                   196   9e-57   Citrus sinensis [apfelsine]
gb|EMT22145.1|  Allantoate deiminase, chloroplastic                     198   2e-56   
ref|XP_004487908.1|  PREDICTED: allantoate deiminase, chloroplast...    195   5e-56   
ref|XP_004487909.1|  PREDICTED: allantoate deiminase, chloroplast...    194   1e-55   Cicer arietinum [garbanzo]
ref|XP_011652398.1|  PREDICTED: allantoate deiminase isoform X2         194   1e-55   Cucumis sativus [cucumbers]
ref|XP_002986766.1|  hypothetical protein SELMODRAFT_182622             194   4e-55   
ref|XP_002969520.1|  hypothetical protein SELMODRAFT_91525              194   6e-55   
ref|XP_010051828.1|  PREDICTED: allantoate deiminase isoform X2         189   4e-54   Eucalyptus grandis [rose gum]
gb|KJB48032.1|  hypothetical protein B456_008G050700                    187   3e-53   Gossypium raimondii
ref|XP_011035488.1|  PREDICTED: allantoate deiminase isoform X3         186   9e-53   Populus euphratica
ref|XP_001751276.1|  predicted protein                                  182   1e-50   
ref|XP_001783993.1|  predicted protein                                  178   2e-49   
ref|XP_006586949.1|  PREDICTED: allantoate deiminase-like isoform X2    174   3e-48   Glycine max [soybeans]
ref|XP_006596931.1|  PREDICTED: allantoate amidohydrolase isoform X1    169   2e-46   
ref|XP_009408250.1|  PREDICTED: probable allantoate deiminase iso...    162   8e-44   
gb|AFK37421.1|  unknown                                                 159   1e-42   Lotus japonicus
gb|KEH37361.1|  allantoate amidohydrolase                               157   7e-42   Medicago truncatula
pir||T04891  hyuC protein homolog F18F4.170 - Arabidopsis thalian...    154   3e-41
gb|ACN31546.1|  unknown                                                 155   4e-41   Zea mays [maize]
ref|XP_007138853.1|  hypothetical protein PHAVU_009G242900g             143   1e-36   Phaseolus vulgaris [French bean]
ref|XP_005647336.1|  amidase                                            143   4e-36   Coccomyxa subellipsoidea C-169
ref|XP_002507571.1|  predicted protein                                  139   1e-34   Micromonas commoda
ref|WP_027135007.1|  allantoate amidohydrolase                          133   7e-33   Geminicoccus roseus
ref|XP_006413901.1|  hypothetical protein EUTSA_v10025370mg             132   1e-32   
emb|CAN83127.1|  hypothetical protein VITISV_029535                     130   2e-32   Vitis vinifera
ref|XP_007510519.1|  allantoate amidohydrolase                          134   4e-32   Bathycoccus prasinos
ref|WP_043197023.1|  allantoate amidohydrolase                          128   3e-31   Bradyrhizobium sp. URHA0002
ref|WP_035690370.1|  allantoate amidohydrolase                          128   5e-31   Bradyrhizobium elkanii
ref|WP_035726587.1|  allantoate amidohydrolase                          127   6e-31   Bradyrhizobium elkanii
ref|WP_012442327.1|  allantoate amidohydrolase                          127   1e-30   Erwinia tasmaniensis
ref|WP_038388099.1|  allantoate amidohydrolase                          126   2e-30   
ref|WP_012668989.1|  allantoate amidohydrolase                          126   2e-30   Erwinia pyrifoliae
ref|WP_014543524.1|  allantoate amidohydrolase                          126   2e-30   Erwinia sp. Ejp617
ref|WP_028339443.1|  allantoate amidohydrolase                          126   2e-30   Bradyrhizobium elkanii
emb|CAY75357.1|  putative N-carbamyl-L-amino acid amidohydrolase        126   2e-30   Erwinia pyrifoliae DSM 12163
ref|WP_024580744.1|  MULTISPECIES: allantoate amidohydrolase            125   5e-30   Bradyrhizobium
ref|WP_023654116.1|  putative N-carbamyl-L-amino acid amidohydrolase    124   1e-29   Erwinia piriflorinigrans
ref|WP_004156077.1|  allantoate amidohydrolase                          124   2e-29   Erwinia amylovora
ref|WP_004168865.1|  putative N-carbamyl-L-amino acid amidohydrolase    124   2e-29   Erwinia amylovora
emb|CBX79715.1|  putative N-carbamyl-L-amino acid amidohydrolase        124   2e-29   Erwinia amylovora ATCC BAA-2158
ref|WP_021017468.1|  amidase, hydantoinase/carbamoylase family          123   2e-29   Serratia sp. ATCC 39006
ref|WP_025037671.1|  allantoate amidohydrolase                          123   2e-29   Bradyrhizobium sp. DOA9
ref|WP_036045330.1|  allantoate amidohydrolase                          123   3e-29   Bradyrhizobium yuanmingense
ref|WP_044538498.1|  allantoate amidohydrolase                          123   3e-29   Bradyrhizobium sp. LTSP885
ref|WP_027579451.1|  allantoate amidohydrolase                          123   3e-29   Bradyrhizobium sp. Ai1a-2
ref|WP_024511318.1|  allantoate amidohydrolase                          122   4e-29   
ref|WP_044587468.1|  allantoate amidohydrolase                          122   5e-29   Bradyrhizobium sp. LTSPM299
gb|ERF83069.1|  hydantoinase/carbamoylase family amidase                122   5e-29   Bradyrhizobium sp. DFCI-1
ref|WP_035650405.1|  allantoate amidohydrolase                          122   5e-29   Bradyrhizobium sp. MOS004
ref|WP_029987811.1|  MULTISPECIES: allantoate amidohydrolase            122   5e-29   
ref|WP_028334435.1|  allantoate amidohydrolase                          122   5e-29   Bradyrhizobium elkanii
ref|WP_036007776.1|  allantoate amidohydrolase                          122   6e-29   Bradyrhizobium yuanmingense
ref|WP_021181940.1|  N-carbamoyl-L-amino acid hydrolase                 122   7e-29   Serratia fonticola
ref|WP_032418944.1|  allantoate amidohydrolase                          122   7e-29   Klebsiella pneumoniae
ref|XP_011398581.1|  Allantoate deiminase                               122   8e-29   Auxenochlorella protothecoides
ref|WP_032452916.1|  allantoate amidohydrolase                          120   9e-29   Klebsiella quasipneumoniae
ref|WP_035976025.1|  allantoate amidohydrolase                          121   1e-28   Bradyrhizobium sp. th.b2
ref|WP_018270389.1|  allantoate amidohydrolase                          121   1e-28   
ref|WP_018456684.1|  allantoate amidohydrolase                          121   2e-28   Bradyrhizobium sp. WSM4349
ref|WP_008130275.1|  allantoate amidohydrolase                          121   2e-28   Bradyrhizobium sp. YR681
ref|WP_024483633.1|  allantoate amidohydrolase                          121   2e-28   Serratia fonticola
ref|WP_023289752.1|  allantoate deiminase                               120   2e-28   Klebsiella quasipneumoniae
ref|WP_039361118.1|  allantoate amidohydrolase                          120   2e-28   Pectobacterium carotovorum
ref|WP_044523337.1|  allantoate amidohydrolase                          120   2e-28   Klebsiella
ref|WP_034787876.1|  allantoate amidohydrolase                          120   2e-28   Ewingella americana
ref|WP_039382838.1|  allantoate amidohydrolase                          120   2e-28   Pantoea
ref|WP_026462888.1|  amidase                                            120   2e-28   Adhaeribacter aquaticus
ref|WP_015671860.1|  amidase, hydantoinase/carbamoylase family          120   2e-28   Serratia sp. FGI94
ref|WP_024528995.1|  allantoate amidohydrolase                          120   3e-28   Serratia fonticola
ref|WP_037375355.1|  allantoate amidohydrolase                          120   3e-28   
ref|WP_023313204.1|  allantoate deiminase                               120   3e-28   Klebsiella pneumoniae
ref|WP_034874810.1|  hypothetical protein                               120   3e-28   Bifidobacterium moukalabense
ref|WP_040170982.1|  allantoate amidohydrolase                          120   3e-28   Klebsiella pneumoniae
ref|WP_017934472.1|  hypothetical protein                               120   4e-28   Nocardioides sp. Iso805N
ref|WP_036104553.1|  allantoate amidohydrolase                          120   4e-28   
ref|WP_040234485.1|  allantoate amidohydrolase                          119   4e-28   Klebsiella pneumoniae
ref|WP_040202415.1|  allantoate amidohydrolase                          119   4e-28   Klebsiella pneumoniae
ref|WP_033752860.1|  allantoate amidohydrolase                          119   5e-28   Pantoea sp. NGS-ED-1003
ref|WP_027545871.1|  allantoate amidohydrolase                          119   5e-28   
ref|WP_039494543.1|  allantoate amidohydrolase                          119   5e-28   
ref|WP_015684689.1|  allantoate amidohydrolase                          119   5e-28   Bradyrhizobium sp. S23321
ref|WP_032446059.1|  allantoate amidohydrolase                          119   6e-28   Klebsiella pneumoniae
ref|WP_032416200.1|  allantoate amidohydrolase                          119   6e-28   Klebsiella pneumoniae
ref|WP_029677513.1|  allantoate amidohydrolase                          119   6e-28   
ref|WP_036158379.1|  allantoate amidohydrolase                          119   6e-28   Marinomonas ushuaiensis
gb|EJZ31229.1|  allantoate amidohydrolase                               115   6e-28   
emb|CCM91409.1|  N-carbamoyl-L-amino acid hydrolase                     119   7e-28   Klebsiella pneumoniae subsp. pneumoniae ST258-K28BO
ref|WP_009111656.1|  allantoate amidohydrolase                          119   7e-28   Brenneria sp. EniD312
ref|WP_034949019.1|  allantoate amidohydrolase                          119   7e-28   Erwinia oleae
ref|WP_040253118.1|  allantoate amidohydrolase                          119   7e-28   Klebsiella pneumoniae
ref|WP_032438386.1|  allantoate amidohydrolase                          119   7e-28   Klebsiella pneumoniae
ref|WP_038934664.1|  allantoate amidohydrolase                          119   7e-28   Bradyrhizobium japonicum
ref|WP_032414955.1|  allantoate amidohydrolase                          119   7e-28   Klebsiella pneumoniae
ref|WP_040218179.1|  allantoate amidohydrolase                          119   7e-28   Klebsiella pneumoniae
ref|WP_004151872.1|  allantoate amidohydrolase                          119   7e-28   Klebsiella pneumoniae
ref|WP_028170521.1|  allantoate amidohydrolase                          119   7e-28   Bradyrhizobium japonicum
ref|WP_017900275.1|  allantoate amidohydrolase                          119   7e-28   Klebsiella
ref|WP_043519587.1|  allantoate amidohydrolase                          119   8e-28   Klebsiella
ref|WP_016947333.1|  allantoate amidohydrolase                          119   8e-28   Klebsiella pneumoniae
ref|WP_042935552.1|  allantoate amidohydrolase                          119   8e-28   Klebsiella pneumoniae
ref|WP_004205837.1|  allantoate amidohydrolase                          119   8e-28   Klebsiella
ref|WP_038435326.1|  allantoate amidohydrolase                          119   8e-28   Klebsiella pneumoniae
ref|WP_023318290.1|  allantoate deiminase                               119   8e-28   Klebsiella
ref|WP_019705119.1|  allantoate amidohydrolase                          119   9e-28   Klebsiella pneumoniae
ref|WP_039199915.1|  hypothetical protein                               119   9e-28   
ref|WP_033637196.1|  allantoate amidohydrolase                          119   9e-28   Serratia marcescens
ref|WP_032740607.1|  allantoate amidohydrolase                          115   1e-27   
ref|WP_032456079.1|  allantoate amidohydrolase                          119   1e-27   Klebsiella quasipneumoniae
gb|AIZ14689.1|  allantoate amidohydrolase                               119   1e-27   Bifidobacterium kashiwanohense PV20-2
ref|WP_036987768.1|  allantoate amidohydrolase                          119   1e-27   Pseudomonas
gb|ADD76032.1|  AmaB                                                    119   1e-27   Pantoea ananatis LMG 20103
ref|WP_035665434.1|  allantoate amidohydrolase                          119   1e-27   Bradyrhizobium sp. Ec3.3
ref|WP_027888447.1|  MULTISPECIES: allantoate amidohydrolase            118   1e-27   Meiothermus
gb|KEA53939.1|  allantoate amidohydrolase                               120   1e-27   Mangrovibacter sp. MFB070
ref|WP_040196471.1|  allantoate amidohydrolase                          118   1e-27   Klebsiella pneumoniae
ref|WP_014606513.1|  allantoate amidohydrolase                          118   1e-27   Pantoea
ref|WP_040033069.1|  allantoate amidohydrolase                          118   1e-27   Pectobacterium carotovorum
ref|WP_022622715.1|  allantoate amidohydrolase                          118   1e-27   Pantoea ananatis
ref|WP_033071895.1|  allantoate amidohydrolase                          118   1e-27   Pectobacterium parmentieri
ref|WP_035995577.1|  allantoate amidohydrolase                          118   1e-27   Bradyrhizobium sp. WSM1253
ref|WP_015731068.1|  allantoate amidohydrolase                          118   1e-27   Pectobacterium parmentieri
ref|WP_032434558.1|  allantoate amidohydrolase                          118   1e-27   Klebsiella pneumoniae
ref|WP_008105230.1|  allantoate amidohydrolase                          118   1e-27   Pantoea
gb|EIG62038.1|  amidase, hydantoinase/carbamoylase family               118   1e-27   Bradyrhizobium sp. WSM1253
ref|WP_021440158.1|  allantoate amidohydrolase                          118   1e-27   Klebsiella pneumoniae
ref|WP_004179943.1|  allantoate amidohydrolase                          118   1e-27   Klebsiella
ref|WP_027519320.1|  allantoate amidohydrolase                          118   1e-27   Bradyrhizobium sp. WSM1417
ref|WP_014701136.1|  Amidase, hydantoinase/carbamoylase family          118   1e-27   Pectobacterium parmentieri
ref|WP_039530217.1|  allantoate amidohydrolase                          118   1e-27   Pectobacterium carotovorum
ref|WP_042940569.1|  allantoate amidohydrolase                          114   2e-27   
ref|WP_039463139.1|  allantoate amidohydrolase                          118   2e-27   Pectobacterium carotovorum
ref|WP_038966724.1|  allantoate amidohydrolase                          118   2e-27   
ref|WP_026202134.1|  allantoate amidohydrolase                          118   2e-27   Bradyrhizobium sp. WSM2793
ref|WP_038971995.1|  allantoate amidohydrolase                          118   2e-27   Bradyrhizobium sp. CCBAU 15635
ref|WP_039499620.1|  allantoate amidohydrolase                          118   2e-27   Pectobacterium carotovorum
ref|WP_039186028.1|  allantoate amidohydrolase                          118   2e-27   
ref|WP_004224897.1|  allantoate amidohydrolase                          118   2e-27   Klebsiella
ref|WP_028178899.1|  MULTISPECIES: allantoate amidohydrolase            118   2e-27   Bradyrhizobium
ref|WP_018644804.1|  allantoate amidohydrolase                          118   2e-27   Bradyrhizobium japonicum
ref|WP_039317881.1|  allantoate amidohydrolase                          118   2e-27   Pectobacterium carotovorum
ref|WP_027531888.1|  allantoate amidohydrolase                          118   2e-27   
ref|WP_039518013.1|  allantoate amidohydrolase                          118   2e-27   Pectobacterium carotovorum
ref|WP_032427248.1|  allantoate amidohydrolase                          115   2e-27   Klebsiella pneumoniae
ref|WP_039277036.1|  allantoate amidohydrolase                          118   2e-27   Pectobacterium carotovorum
ref|WP_028174413.1|  allantoate amidohydrolase                          118   2e-27   Bradyrhizobium
ref|WP_038949186.1|  allantoate amidohydrolase                          117   2e-27   Bradyrhizobium sp. CCBAU 15544
ref|WP_039504761.1|  allantoate amidohydrolase                          117   2e-27   Pectobacterium carotovorum
ref|WP_011088888.1|  allantoate amidohydrolase                          117   2e-27   Bradyrhizobium diazoefficiens
gb|EPF45025.1|  allantoate amidohydrolase                               114   2e-27   Klebsiella pneumoniae subsp. pneumoniae B5055
ref|WP_045585323.1|  allantoate amidohydrolase                          117   2e-27   Azospirillum thiophilum
ref|WP_038648815.1|  allantoate amidohydrolase                          117   3e-27   Pantoea rwandensis
ref|WP_024050150.1|  allantoate amidohydrolase                          117   3e-27   Meiothermus ruber
ref|WP_013013670.1|  allantoate amidohydrolase                          117   3e-27   Meiothermus ruber
ref|WP_020456676.1|  hypothetical protein                               117   3e-27   Enterobacter sp. R4-368
ref|WP_038027632.1|  allantoate amidohydrolase                          117   3e-27   Tatumella saanichensis
ref|WP_045513267.1|  allantoate amidohydrolase                          117   3e-27   Kosakonia
ref|WP_015958434.1|  allantoate amidohydrolase                          117   3e-27   Klebsiella pneumoniae
ref|WP_039157600.1|  allantoate amidohydrolase                          117   3e-27   Bradyrhizobium japonicum
gb|AIU89518.1|  allantoate amidohydrolase                               117   3e-27   Pectobacterium carotovorum subsp. odoriferum
ref|WP_004860345.1|  MULTISPECIES: allantoate amidohydrolase            117   4e-27   Raoultella ornithinolytica
ref|WP_010282609.1|  allantoate amidohydrolase                          117   4e-27   Pectobacterium carotovorum
gb|AHY53199.1|  N-carbamoyl-L-amino acid hydrolase                      117   4e-27   Bradyrhizobium japonicum SEMIA 5079
ref|WP_038431584.1|  allantoate amidohydrolase                          117   4e-27   Klebsiella pneumoniae
ref|WP_032717661.1|  allantoate amidohydrolase                          117   4e-27   Enterobacteriaceae
ref|WP_038666300.1|  allantoate amidohydrolase                          117   4e-27   Dickeya fangzhongdai
ref|WP_026042639.1|  allantoate amidohydrolase                          117   4e-27   Pantoea sp. A4
gb|AGJ86613.1|  allantoate amidohydrolase                               117   4e-27   Raoultella ornithinolytica B6
ref|WP_040241049.1|  allantoate amidohydrolase                          117   4e-27   Klebsiella pneumoniae
ref|WP_040245256.1|  allantoate amidohydrolase                          117   4e-27   Klebsiella pneumoniae
ref|WP_034912542.1|  allantoate amidohydrolase                          117   4e-27   Erwinia sp. 9145
ref|WP_013200898.1|  allantoate amidohydrolase                          117   4e-27   Erwinia billingiae
ref|WP_032724767.1|  allantoate amidohydrolase                          117   4e-27   Raoultella ornithinolytica
ref|WP_044346530.1|  allantoate amidohydrolase                          117   4e-27   Raoultella ornithinolytica
ref|WP_027576194.1|  allantoate amidohydrolase                          117   4e-27   Bradyrhizobium sp. WSM1743
ref|WP_045006884.1|  allantoate amidohydrolase                          117   4e-27   Bradyrhizobium sp. LTSP857
ref|WP_014907571.1|  allantoate amidohydrolase                          117   5e-27   Enterobacteriaceae
gb|ERO56685.1|  Amino acid hydrolase                                    117   5e-27   Dickeya solani D s0432-1
ref|WP_035048246.1|  allantoate amidohydrolase                          117   5e-27   Dickeya solani
ref|WP_040189717.1|  allantoate amidohydrolase                          117   5e-27   Klebsiella pneumoniae
ref|WP_027566598.1|  allantoate amidohydrolase                          117   5e-27   Bradyrhizobium sp. URHA0013
ref|WP_009485798.1|  putative N-carbamoyl-L-amino-acid hydrolase        116   5e-27   Klebsiella sp. MS 92-3
ref|WP_032439982.1|  allantoate amidohydrolase                          116   5e-27   Klebsiella pneumoniae
ref|WP_035730949.1|  MULTISPECIES: allantoate amidohydrolase            116   5e-27   Bradyrhizobium genosp. SA-4
ref|WP_032447571.1|  allantoate amidohydrolase                          116   5e-27   Klebsiella pneumoniae
ref|WP_034493622.1|  allantoate amidohydrolase                          116   6e-27   
ref|WP_027466257.1|  hydantoinase                                       116   6e-27   Curtobacterium sp. UNCCL17
ref|WP_039694672.1|  allantoate amidohydrolase                          116   6e-27   Dickeya fangzhongdai
ref|WP_040230772.1|  allantoate amidohydrolase                          116   7e-27   Klebsiella pneumoniae
ref|WP_012764538.1|  MULTISPECIES: allantoate amidohydrolase            116   7e-27   Dickeya paradisiaca
ref|WP_032412263.1|  allantoate amidohydrolase                          116   7e-27   Klebsiella pneumoniae
ref|WP_040211336.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_004891852.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_004148417.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_028156669.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_033788672.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_023158331.1|  amidase, hydantoinase/carbamoylase family          116   7e-27   
ref|WP_038924807.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_040238502.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_040175331.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_009307838.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_015696159.1|  allantoate amidohydrolase                          116   7e-27   
gb|ERE64899.1|  allantoate amidohydrolase                               116   7e-27   
ref|WP_032424980.1|  allantoate amidohydrolase                          116   7e-27   
ref|WP_021314380.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_032103157.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_032411097.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_032420066.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_012794334.1|  amidase                                            116   8e-27   
ref|WP_040025949.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_023280098.1|  allantoate deiminase                               116   8e-27   
ref|WP_028724091.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_039333196.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_032441188.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_023341580.1|  allantoate deiminase                               116   8e-27   
ref|WP_025920034.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_025712447.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_041144889.1|  allantoate amidohydrolase                          116   8e-27   
ref|WP_044279941.1|  hypothetical protein                               116   8e-27   
ref|WP_013863088.1|  hydantoinase                                       116   9e-27   
ref|WP_028142651.1|  MULTISPECIES: allantoate amidohydrolase            116   9e-27   
gb|ADM99754.1|  N-carbamoyl-L-amino acid hydrolase                      116   9e-27   
ref|WP_023300987.1|  allantoate deiminase                               116   9e-27   
ref|WP_045854765.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_041069636.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_028472640.1|  hydantoinase                                       116   9e-27   
ref|WP_042318523.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_043875254.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_012968183.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_029504411.1|  allantoate amidohydrolase                          115   9e-27   
ref|WP_038912623.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_038920016.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_012541684.1|  allantoate amidohydrolase                          116   9e-27   
ref|WP_023340170.1|  allantoate deiminase                               116   9e-27   
ref|WP_023297648.1|  MULTISPECIES: allantoate deiminase                 116   9e-27   
ref|WP_004184120.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_042948153.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_032730412.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_015841455.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_016161068.1|  hypothetical protein                               115   1e-26   
ref|WP_011981297.1|  hydantoinase                                       115   1e-26   
ref|WP_038902756.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_023322646.1|  allantoate deiminase                               115   1e-26   
ref|WP_023283732.1|  allantoate deiminase                               115   1e-26   
ref|WP_008804832.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_028686254.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_043600896.1|  hydantoinase                                       115   1e-26   
ref|WP_023282601.1|  allantoate deiminase                               115   1e-26   
ref|WP_039288511.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_045492774.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_019199437.1|  hypothetical protein                               115   1e-26   
gb|ADG75671.1|  amidase, hydantoinase/carbamoylase family               115   1e-26   
ref|WP_045014744.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_042446589.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_039536040.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_004190018.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_039475472.1|  allantoate amidohydrolase                          115   1e-26   
dbj|BAI76499.1|  allantoate amidohydrolase                              115   1e-26   
ref|WP_039542733.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_038926935.1|  MULTISPECIES: allantoate amidohydrolase            115   1e-26   
ref|WP_045813715.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_004212145.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_034845163.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_033570589.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_042783726.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_039547120.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_039552472.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_014916422.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_033634108.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_045833866.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_032417138.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_017888493.1|  hypothetical protein                               115   1e-26   
ref|WP_026870833.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_040222194.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_034882067.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_032445187.1|  allantoate amidohydrolase                          115   1e-26   
ref|WP_041959304.1|  allantoate amidohydrolase                          115   2e-26   
gb|ACT05761.1|  amidase, hydantoinase/carbamoylase family               115   2e-26   
ref|WP_033576747.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_027711100.1|  allantoate amidohydrolase                          115   2e-26   
gb|KGZ34423.1|  allantoate amidohydrolase                               115   2e-26   
ref|WP_033641956.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_035887523.1|  hypothetical protein                               115   2e-26   
ref|WP_005975681.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_039512050.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_040167066.1|  allantoate amidohydrolase                          115   2e-26   
ref|XP_011567128.1|  PREDICTED: allantoate deiminase-like               113   2e-26   
ref|WP_021186147.1|  N-carbamoyl-L-amino acid hydrolase                 115   2e-26   
ref|WP_040149984.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_044209167.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_038381523.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_038022894.1|  allantoate amidohydrolase                          115   2e-26   
gb|KFC83607.1|  N-carbamoyl-L-amino acid hydrolase                      116   2e-26   
ref|WP_024343296.1|  allantoate amidohydrolase                          115   2e-26   
dbj|GAN78059.1|  amidohydrolase/amidase                                 115   2e-26   
ref|WP_026594830.1|  MULTISPECIES: allantoate amidohydrolase            115   2e-26   
ref|WP_039486976.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_017458764.1|  hypothetical protein                               115   2e-26   
ref|WP_040968525.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_044649749.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_034899451.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_039558602.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_034825384.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_038957596.1|  allantoate amidohydrolase                          115   2e-26   
gb|ETI60714.1|  allantoate amidohydrolase                               115   2e-26   
ref|WP_044596843.1|  allantoate amidohydrolase                          114   2e-26   
ref|WP_042860843.1|  allantoate amidohydrolase                          115   2e-26   
ref|WP_007561578.1|  allantoate amidohydrolase                          114   2e-26   
emb|CEG31130.1|  hydantoinase/carbamoylase family amidase               114   2e-26   
ref|WP_007612828.1|  allantoate amidohydrolase                          114   2e-26   
ref|WP_036200247.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_007887175.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_026677006.1|  hydantoinase                                       114   3e-26   
ref|WP_039508771.1|  allantoate amidohydrolase                          114   3e-26   
gb|KGZ11747.1|  allantoate amidohydrolase                               114   3e-26   
ref|WP_033651004.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_038011086.1|  MULTISPECIES: allantoate amidohydrolase            114   3e-26   
gb|EKV29225.1|  N-carbamoyl-L-amino acid hydrolase                      114   3e-26   
ref|WP_014250122.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_031214748.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_043645604.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_039338582.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_039325965.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_006118031.1|  allantoate amidohydrolase                          114   3e-26   
gb|KFD20499.1|  N-carbamoyl-L-amino acid hydrolase                      114   3e-26   
ref|WP_014069675.1|  allantoate amidohydrolase                          114   3e-26   
ref|WP_039308407.1|  allantoate amidohydrolase                          114   4e-26   
ref|WP_034933904.1|  allantoate amidohydrolase                          114   4e-26   
ref|WP_035705107.1|  allantoate amidohydrolase                          114   4e-26   
ref|WP_042717668.1|  allantoate amidohydrolase                          114   4e-26   
ref|WP_013507996.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_037036537.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_033653347.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_032638726.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_021507292.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_038627942.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_033649914.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_029587081.1|  allantoate amidohydrolase                          114   5e-26   
ref|WP_044859494.1|  allantoate amidohydrolase                          113   6e-26   
gb|ENY57477.1|  allantoate amidohydrolase                               113   6e-26   
gb|KGZ17653.1|  allantoate amidohydrolase                               114   6e-26   
dbj|BAL08835.1|  hypothetical protein BJ6T_35610                        113   6e-26   
ref|WP_014169475.1|  allantoate amidohydrolase                          113   6e-26   
ref|WP_032688442.1|  MULTISPECIES: allantoate amidohydrolase            113   6e-26   
ref|WP_021505015.1|  allantoate amidohydrolase                          113   7e-26   
gb|ACG63354.1|  allantoate amidohydrolase                               113   7e-26   
ref|WP_039999934.1|  allantoate amidohydrolase                          113   7e-26   
ref|WP_004871406.1|  allantoate amidohydrolase                          113   7e-26   
ref|WP_015376721.1|  allantoate amidohydrolase                          113   7e-26   
ref|WP_024359595.1|  MULTISPECIES: allantoate amidohydrolase            113   7e-26   
ref|WP_016586446.1|  allantoate amidohydrolase                          111   7e-26   
gb|EEW39425.1|  allantoate amidohydrolase                               113   7e-26   
ref|WP_038916714.1|  allantoate amidohydrolase                          113   7e-26   
ref|WP_023292831.1|  allantoate amidohydrolase                          113   7e-26   
ref|WP_010618321.1|  allantoate amidohydrolase                          113   7e-26   
ref|WP_020947569.1|  hypothetical protein                               113   8e-26   
ref|WP_015450434.1|  hydantoinase/carbamoylase family amidase           113   8e-26   
ref|WP_019845239.1|  allantoate amidohydrolase                          113   8e-26   
ref|WP_042702363.1|  allantoate amidohydrolase                          113   8e-26   
ref|WP_039567064.1|  allantoate amidohydrolase                          113   8e-26   
ref|WP_032674503.1|  allantoate amidohydrolase                          113   8e-26   
ref|WP_007416480.1|  amidase                                            113   9e-26   
ref|WP_016941699.1|  allantoate amidohydrolase                          113   9e-26   
ref|WP_038926489.1|  allantoate amidohydrolase                          113   9e-26   
ref|WP_008499841.1|  allantoate amidohydrolase                          113   9e-26   
ref|WP_038905403.1|  allantoate amidohydrolase                          113   9e-26   
ref|WP_039023894.1|  allantoate amidohydrolase                          113   9e-26   
ref|WP_023343727.1|  allantoate amidohydrolase                          113   9e-26   
gb|AJC67419.1|  allantoate amidohydrolase                               113   9e-26   
ref|WP_038908850.1|  allantoate amidohydrolase                          113   1e-25   
ref|WP_019454329.1|  allantoate amidohydrolase                          113   1e-25   
ref|WP_008512211.1|  amidase                                            113   1e-25   
ref|WP_025912977.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_034314943.1|  hydantoinase                                       112   1e-25   
ref|WP_045406688.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_045417183.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_024274006.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_023327071.1|  MULTISPECIES: allantoate amidohydrolase            112   1e-25   
ref|WP_042538140.1|  hydantoinase                                       112   1e-25   
ref|WP_045354427.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_021240819.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_034849483.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_045334719.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_045372974.1|  allantoate amidohydrolase                          112   1e-25   
ref|WP_027008165.1|  hypothetical protein                               112   1e-25   
gb|ACQ93553.1|  amidase, hydantoinase/carbamoylase family               112   1e-25   
gb|ACZ78096.1|  amidase, hydantoinase/carbamoylase family               112   2e-25   
ref|WP_040235307.1|  allantoate amidohydrolase                          112   2e-25   
gb|EJU27355.1|  putative N-carbamoyl-L-amino-acid hydrolase             112   2e-25   
gb|EHT01327.1|  hydantoinase/carbamoylase family amidase                112   2e-25   
ref|WP_041609834.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_029485028.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_042554060.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_013581211.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_041164578.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_004131231.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_020825352.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_042927919.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_023335202.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_032721364.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_017491123.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_038905612.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_038914500.1|  allantoate amidohydrolase                          112   2e-25   
gb|AHM72513.1|  amino acid hydrolase                                    112   2e-25   
gb|AAM84520.1|AE013696_13  putative N-carbamyl-L-amino acid amido...    112   2e-25   
gb|AAS60949.1|  putative amino acid hydrolase                           112   2e-25   
ref|WP_033849543.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_002208729.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_002231082.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_045123696.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_042819786.1|  allantoate amidohydrolase                          112   2e-25   
ref|WP_032466131.1|  allantoate amidohydrolase                          112   2e-25   



>ref|XP_004233270.1| PREDICTED: allantoate deiminase [Solanum lycopersicum]
Length=493

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  209  GSENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMED  388
            G+EN  G KYDLFP+ILKEEAV RL ELGKVSDA+ YLERTFQSPASVRAGNL+R+WMED
Sbjct  44   GAENTEGIKYDLFPEILKEEAVGRLNELGKVSDANGYLERTFQSPASVRAGNLLRAWMED  103

Query  389  AGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKT  568
            AGL+TW+DQMGNVHGR EGINPS KALLIGSHLDTVIDAG+FDGSLGII AISALK L +
Sbjct  104  AGLKTWVDQMGNVHGRAEGINPSEKALLIGSHLDTVIDAGFFDGSLGIICAISALKALNS  163

Query  569  TGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            +GRL KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  164  SGRLGKLRRPVEVIAFSDEEGVRFQSTFLGSA  195



>ref|XP_009774500.1| PREDICTED: allantoate deiminase [Nicotiana sylvestris]
Length=500

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  215  ENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAG  394
            EN  G KYDLFP+ILKEEAV+RL ELGKVSDA +YLERTFQSP S+RAGNL+R+WMEDAG
Sbjct  53   ENIEGMKYDLFPEILKEEAVARLNELGKVSDASDYLERTFQSPGSIRAGNLLRAWMEDAG  112

Query  395  LRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTG  574
            L+TW+DQMGNVHGR EGINPS KALLIGSHLDTVIDAGYFDGSLGI+ AISALK L  TG
Sbjct  113  LKTWVDQMGNVHGRAEGINPSEKALLIGSHLDTVIDAGYFDGSLGIVCAISALKALNATG  172

Query  575  RLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            RL+KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  173  RLDKLRRPVEVIAFSDEEGVRFQSTFLGSA  202



>ref|XP_009628190.1| PREDICTED: allantoate deiminase [Nicotiana tomentosiformis]
Length=497

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  215  ENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAG  394
            EN  G KYDLFP+ILKEEAV+RL ELGKVSDA++YLERTFQSPAS+RAGNL+R+WMEDAG
Sbjct  50   ENTQGIKYDLFPEILKEEAVARLNELGKVSDANDYLERTFQSPASIRAGNLLRAWMEDAG  109

Query  395  LRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTG  574
            L+TW+DQMGNVHGR +GINPS KALLIGSHLDTVIDAGYFDGSLGII AISALK L  T 
Sbjct  110  LKTWVDQMGNVHGRADGINPSEKALLIGSHLDTVIDAGYFDGSLGIICAISALKALNATR  169

Query  575  RLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            RL+KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  170  RLDKLRRPVEVIAFSDEEGVRFQSTFLGSA  199



>ref|XP_006365002.1| PREDICTED: allantoate deiminase-like [Solanum tuberosum]
Length=492

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  209  GSENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMED  388
            G+EN  G KYDLFP+ILKEEAV RL ELGKVSDA+ YLERTFQSPAS+RAGNL+R+WMED
Sbjct  43   GAENTEGIKYDLFPEILKEEAVGRLNELGKVSDANGYLERTFQSPASIRAGNLLRAWMED  102

Query  389  AGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKT  568
            AGL+TW+DQMGNVHGR EGINPS +ALLIGSHLDTVIDAG+FDGSLGII AISALK L +
Sbjct  103  AGLKTWVDQMGNVHGRAEGINPSERALLIGSHLDTVIDAGFFDGSLGIICAISALKALNS  162

Query  569  TGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            +GRL KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  163  SGRLGKLQRPVEVIAFSDEEGVRFQSTFLGSA  194



>emb|CDP18199.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 137/162 (85%), Gaps = 4/162 (2%)
 Frame = +2

Query  191  PVIAFS----GSENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRA  358
            P  AFS    G E   G KYDLFP+IL EEAV+RL ELG+VSDAD YL+RTFQSPAS++A
Sbjct  40   PTCAFSHIRQGFEEDKGRKYDLFPEILMEEAVARLNELGEVSDADEYLQRTFQSPASIKA  99

Query  359  GNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIIT  538
            GNLIR WMED GL+TW+D+MGNVHGR EGINPS KALLIGSHLDTVIDAG FDGSLGI+ 
Sbjct  100  GNLIRLWMEDVGLKTWVDKMGNVHGRTEGINPSEKALLIGSHLDTVIDAGKFDGSLGIVC  159

Query  539  AISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            A+SALKVL  T R+ +L +PVE+IAFSDEEGVRFQSTFLGSA
Sbjct  160  ALSALKVLNMTNRMGRLRRPVEIIAFSDEEGVRFQSTFLGSA  201



>emb|CBI27216.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G   DLFP++L+EEAV+RLYELGKVSDA+ YLERTF SPAS+RAGNLIR WMEDAGLRTW
Sbjct  35   GKNSDLFPEVLREEAVARLYELGKVSDAEGYLERTFLSPASIRAGNLIREWMEDAGLRTW  94

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +DQMGNVHGR+EG+NPS  ALLIGSHLDTV+DAG FDGSLGII+AIS LKVL  T +L+K
Sbjct  95   MDQMGNVHGRVEGMNPSADALLIGSHLDTVVDAGIFDGSLGIISAISVLKVLNITAKLQK  154

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +P+EVIAFSDEEGVRFQSTFLGSA
Sbjct  155  LRRPIEVIAFSDEEGVRFQSTFLGSA  180



>ref|XP_002275843.2| PREDICTED: allantoate deiminase [Vitis vinifera]
Length=492

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G   DLFP++L+EEAV+RLYELGKVSDA+ YLERTF SPAS+RAGNLIR WMEDAGLRTW
Sbjct  49   GKNSDLFPEVLREEAVARLYELGKVSDAEGYLERTFLSPASIRAGNLIREWMEDAGLRTW  108

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +DQMGNVHGR+EG+NPS  ALLIGSHLDTV+DAG FDGSLGII+AIS LKVL  T +L+K
Sbjct  109  MDQMGNVHGRVEGMNPSADALLIGSHLDTVVDAGIFDGSLGIISAISVLKVLNITAKLQK  168

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +P+EVIAFSDEEGVRFQSTFLGSA
Sbjct  169  LRRPIEVIAFSDEEGVRFQSTFLGSA  194



>ref|XP_006448626.1| hypothetical protein CICLE_v10015120mg [Citrus clementina]
 gb|ESR61866.1| hypothetical protein CICLE_v10015120mg [Citrus clementina]
Length=472

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            LFPQILKEEAV+RL ELGKVSDA+ YL+RTF SPASVRAGNLIR WMEDAGLRTW+D MG
Sbjct  34   LFPQILKEEAVTRLDELGKVSDANGYLQRTFMSPASVRAGNLIRQWMEDAGLRTWVDHMG  93

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            NVHGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGIITAISALKVLK+TG+L KL +PV
Sbjct  94   NVHGRVEGLNASAQALLIGSHLDTVVDAGIFDGSLGIITAISALKVLKSTGKLGKLKRPV  153

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQSTFLGSA
Sbjct  154  EVIAFSDEEGVRFQSTFLGSA  174



>ref|XP_006468549.1| PREDICTED: allantoate deiminase-like [Citrus sinensis]
Length=472

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            LFPQILKEEAV+RL ELGKVSDA+ YL+RTF SPASVRAGNLIR WMEDAGLRTW+D +G
Sbjct  34   LFPQILKEEAVTRLDELGKVSDANGYLQRTFMSPASVRAGNLIRQWMEDAGLRTWVDHLG  93

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            NVHGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGIITAISALKVLK+TG+L KL +PV
Sbjct  94   NVHGRVEGLNASAQALLIGSHLDTVVDAGIFDGSLGIITAISALKVLKSTGKLGKLKRPV  153

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQSTFLGSA
Sbjct  154  EVIAFSDEEGVRFQSTFLGSA  174



>ref|XP_010051826.1| PREDICTED: allantoate deiminase isoform X1 [Eucalyptus grandis]
 ref|XP_010051827.1| PREDICTED: allantoate deiminase isoform X1 [Eucalyptus grandis]
 gb|KCW75653.1| hypothetical protein EUGRSUZ_D00017 [Eucalyptus grandis]
Length=474

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 138/159 (87%), Gaps = 3/159 (2%)
 Frame = +2

Query  197  IAFSGS---ENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNL  367
            +AF+GS   +N    K DL+P+IL++EAV+RL ELGKVSDA+ YLERTF SPASVRAGNL
Sbjct  17   LAFAGSWSAQNLESRKDDLYPEILRDEAVARLNELGKVSDAEAYLERTFMSPASVRAGNL  76

Query  368  IRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAIS  547
            IR WMEDAGLRTWIDQMGNVHGR++GIN S KA+LIGSHLDTV+DAG FDGSLG+++AIS
Sbjct  77   IRGWMEDAGLRTWIDQMGNVHGRVDGINASSKAILIGSHLDTVVDAGIFDGSLGVVSAIS  136

Query  548  ALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            ALKVL   G+L  L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  137  ALKVLNARGKLGNLLRPVEVIAFSDEEGVRFQSTFLGSA  175



>gb|KCW75654.1| hypothetical protein EUGRSUZ_D00017 [Eucalyptus grandis]
Length=502

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 138/159 (87%), Gaps = 3/159 (2%)
 Frame = +2

Query  197  IAFSGS---ENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNL  367
            +AF+GS   +N    K DL+P+IL++EAV+RL ELGKVSDA+ YLERTF SPASVRAGNL
Sbjct  17   LAFAGSWSAQNLESRKDDLYPEILRDEAVARLNELGKVSDAEAYLERTFMSPASVRAGNL  76

Query  368  IRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAIS  547
            IR WMEDAGLRTWIDQMGNVHGR++GIN S KA+LIGSHLDTV+DAG FDGSLG+++AIS
Sbjct  77   IRGWMEDAGLRTWIDQMGNVHGRVDGINASSKAILIGSHLDTVVDAGIFDGSLGVVSAIS  136

Query  548  ALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            ALKVL   G+L  L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  137  ALKVLNARGKLGNLLRPVEVIAFSDEEGVRFQSTFLGSA  175



>ref|XP_010260695.1| PREDICTED: allantoate deiminase isoform X2 [Nelumbo nucifera]
Length=395

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  233  KYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWID  412
            K  LFP+IL++EAV+RL ELGKV+DA+ YLERTF SPAS RAG+LIRSWME+AGLRTW+D
Sbjct  53   KNGLFPEILRDEAVARLKELGKVTDAEGYLERTFLSPASARAGDLIRSWMEEAGLRTWVD  112

Query  413  QMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLS  592
            Q+GN+HGR+EG+N S +ALLIGSHLDTVIDAG +DG+LGII A+SALKVLK+TG+L KLS
Sbjct  113  QIGNIHGRVEGMNASAEALLIGSHLDTVIDAGIYDGALGIICAVSALKVLKSTGKLGKLS  172

Query  593  KPVEVIAFSDEEGVRFQSTFLGSA  664
            +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  173  RPVEVIAFSDEEGVRFQSTFLGSA  196



>ref|XP_003533667.1| PREDICTED: allantoate deiminase-like isoform X1 [Glycine max]
 gb|KHN26612.1| Allantoate deiminase, chloroplastic [Glycine soja]
Length=483

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSDA  YLERTF SPAS+RA NLI
Sbjct  28   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDASGYLERTFLSPASMRAINLI  87

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  88   RKWMEDAGLRTWVDQMGNVHGRVDGANANAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  147

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            LK +   G+L+KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  148  LKAMHVNGKLQKLKRPVEVIAFSDEEGVRFQTTFLGS  184



>ref|XP_010260694.1| PREDICTED: allantoate deiminase isoform X1 [Nelumbo nucifera]
Length=490

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  233  KYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWID  412
            K  LFP+IL++EAV+RL ELGKV+DA+ YLERTF SPAS RAG+LIRSWME+AGLRTW+D
Sbjct  53   KNGLFPEILRDEAVARLKELGKVTDAEGYLERTFLSPASARAGDLIRSWMEEAGLRTWVD  112

Query  413  QMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLS  592
            Q+GN+HGR+EG+N S +ALLIGSHLDTVIDAG +DG+LGII A+SALKVLK+TG+L KLS
Sbjct  113  QIGNIHGRVEGMNASAEALLIGSHLDTVIDAGIYDGALGIICAVSALKVLKSTGKLGKLS  172

Query  593  KPVEVIAFSDEEGVRFQSTFLGSA  664
            +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  173  RPVEVIAFSDEEGVRFQSTFLGSA  196



>ref|XP_007138852.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
 gb|ESW10846.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
Length=310

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSD   YLERTF SPAS+RA  LI
Sbjct  27   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDGKGYLERTFLSPASMRAIILI  86

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  87   RKWMEDAGLRTWVDQMGNVHGRVDGANANAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  146

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            LK +   G+LEKL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  147  LKAMHFNGKLEKLKRPVEVIAFSDEEGVRFQTTFLGS  183



>ref|XP_012088570.1| PREDICTED: allantoate deiminase isoform X1 [Jatropha curcas]
 gb|KDP23910.1| hypothetical protein JCGZ_27110 [Jatropha curcas]
Length=479

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  209  GSENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMED  388
            G+E+    + DL+ +IL++EAV+RL +LGKVSDAD YLERTF S ASV+AGNLIRSWMED
Sbjct  30   GNEDVDSRRNDLYREILRDEAVARLNDLGKVSDADGYLERTFMSAASVKAGNLIRSWMED  89

Query  389  AGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKT  568
            AGL TW+D MGNVHGR+EG NPS +ALLIGSHLDTV+DAG FDGSLGII+A+SALKVLK+
Sbjct  90   AGLMTWMDHMGNVHGRVEGSNPSAEALLIGSHLDTVVDAGIFDGSLGIISALSALKVLKS  149

Query  569  TGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
             G L KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  150  KGMLSKLKRPVEVIAFSDEEGVRFQSTFLGSA  181



>ref|XP_006369050.1| peptidase M20/M25/M40 family protein [Populus trichocarpa]
 gb|ERP65619.1| peptidase M20/M25/M40 family protein [Populus trichocarpa]
Length=471

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G + DLF +IL++EAVSRL +LGKVSDAD YLERTF SPASVRA NLIR+WMEDAGL TW
Sbjct  28   GREDDLFAEILRDEAVSRLNQLGKVSDADGYLERTFMSPASVRAANLIRAWMEDAGLTTW  87

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G L  
Sbjct  88   VDYMGNVHGRVEGLNASAEALLIGSHLDTVVDAGIFDGSLGIISAISALKVLKSNGTLTN  147

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  148  LIRPVEVIAFSDEEGVRFQSTFLGSA  173



>gb|ACK75561.1| allantoate amidohydrolase [Glycine max]
Length=479

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSDA  YLERTF SPAS+RA N I
Sbjct  24   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDASGYLERTFLSPASMRAINPI  83

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  84   RKWMEDAGLRTWVDQMGNVHGRVDGANANAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  143

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            LK +   G+L+KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  144  LKAMHVNGKLQKLKRPVEVIAFSDEEGVRFQTTFLGS  180



>gb|KJB48026.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
 gb|KJB48027.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
 gb|KJB48029.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
 gb|KJB48031.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=369

 Score =   234 bits (598),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G    L+ +IL++EAV+RL +LGKVSDAD YLERTF SPASVRAG LIR WMEDAGLRTW
Sbjct  39   GKTRSLYSEILRDEAVARLNDLGKVSDADGYLERTFMSPASVRAGFLIREWMEDAGLRTW  98

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G+L +
Sbjct  99   VDSMGNLHGRVEGMNASAQALLIGSHLDTVVDAGMFDGSLGIISAISALKVLKSIGKLGE  158

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  159  LKRPVEVIAFSDEEGVRFQSTFLGSA  184



>gb|EYU43647.1| hypothetical protein MIMGU_mgv1a005319mg [Erythranthe guttata]
Length=489

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +2

Query  209  GSENGVGTKYDLF-PQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWME  385
             S NG+    +L   +ILK+EAV+RL +LGKVSD + YLERTFQSPASVRAGNLIR WME
Sbjct  39   ASPNGLSEGANLLHSEILKDEAVARLIDLGKVSDTEEYLERTFQSPASVRAGNLIRLWME  98

Query  386  DAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLK  565
            DAGL TW DQMGNVHGR EG+NPS KALLIGSHLDTVIDAG FDG+LGII+A+SALKVLK
Sbjct  99   DAGLLTWADQMGNVHGRHEGLNPSEKALLIGSHLDTVIDAGKFDGALGIISAVSALKVLK  158

Query  566  TTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            T G L KL++PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  159  TRGMLGKLTRPVEVIAFSDEEGVRFQSTFLGSA  191



>ref|XP_012088571.1| PREDICTED: allantoate deiminase isoform X2 [Jatropha curcas]
Length=474

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  233  KYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWID  412
            + DL+ +IL++EAV+RL +LGKVSDAD YLERTF S ASV+AGNLIRSWMEDAGL TW+D
Sbjct  33   RNDLYREILRDEAVARLNDLGKVSDADGYLERTFMSAASVKAGNLIRSWMEDAGLMTWMD  92

Query  413  QMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLS  592
             MGNVHGR+EG NPS +ALLIGSHLDTV+DAG FDGSLGII+A+SALKVLK+ G L KL 
Sbjct  93   HMGNVHGRVEGSNPSAEALLIGSHLDTVVDAGIFDGSLGIISALSALKVLKSKGMLSKLK  152

Query  593  KPVEVIAFSDEEGVRFQSTFLGSA  664
            +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  153  RPVEVIAFSDEEGVRFQSTFLGSA  176



>emb|CAO78893.1| allantoate amidohydrolase [Glycine max]
Length=483

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSDA  YLERTF SPAS++A +LI
Sbjct  28   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDASGYLERTFLSPASMKAIDLI  87

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  88   RKWMEDAGLRTWVDQMGNVHGRVDGANENAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  147

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +K +   G+L+KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  148  VKAMHVNGKLQKLKRPVEVIAFSDEEGVRFQTTFLGS  184



>gb|KHN47732.1| Allantoate deiminase, chloroplastic [Glycine soja]
Length=483

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSDA  YLERTF SPAS++A +LI
Sbjct  28   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDASGYLERTFLSPASMKAIDLI  87

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  88   RKWMEDAGLRTWVDQMGNVHGRVDGANENAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  147

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +K +   G+L+KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  148  VKAMHVNGKLQKLKRPVEVIAFSDEEGVRFQTTFLGS  184



>ref|NP_001236563.1| allantoate amidohydrolase precursor [Glycine max]
 gb|ACN87318.1| allantoate amidohydrolase [Glycine max]
Length=483

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSDA  YLERTF SPAS++A +LI
Sbjct  28   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDASGYLERTFLSPASMKAIDLI  87

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  88   RKWMEDAGLRTWVDQMGNVHGRVDGANENAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  147

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +K +   G+L+KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  148  VKAMHVNGKLQKLKRPVEVIAFSDEEGVRFQTTFLGS  184



>ref|XP_011035487.1| PREDICTED: allantoate deiminase isoform X2 [Populus euphratica]
Length=471

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G + DLF +IL++EAVSRL +LGKVSDAD +LERTF SPASVRA NLIR+WMEDAGL TW
Sbjct  28   GREDDLFAEILRDEAVSRLDQLGKVSDADGHLERTFMSPASVRAANLIRAWMEDAGLTTW  87

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G L  
Sbjct  88   VDYMGNVHGRVEGLNASAEALLIGSHLDTVVDAGIFDGSLGIISAISALKVLKSNGTLTN  147

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  148  LIRPVEVIAFSDEEGVRFQSTFLGSA  173



>gb|KEH37362.1| allantoate amidohydrolase [Medicago truncatula]
Length=352

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +2

Query  203  FSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSW  379
             SG E G +  + DLFPQIL++EAV+RL ELGKVSDA++YLERTF SPA+ RA NLIR W
Sbjct  27   LSGIETGDLEKRGDLFPQILRDEAVARLVELGKVSDANDYLERTFLSPATTRAINLIRKW  86

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            MEDAGLRTW+DQMGNVHGR+EG N + +ALL+GSH+DTV+DAG FDG+LGI++AISALKV
Sbjct  87   MEDAGLRTWVDQMGNVHGRVEGANANAEALLVGSHMDTVVDAGKFDGALGIVSAISALKV  146

Query  560  LKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +   G+L+ L++PVEVIAF DEEGVRFQ+TFLGS
Sbjct  147  MHVNGKLQNLTRPVEVIAFCDEEGVRFQTTFLGS  180



>gb|KJB48030.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=396

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G    L+ +IL++EAV+RL +LGKVSDAD YLERTF SPASVRAG LIR WMEDAGLRTW
Sbjct  39   GKTRSLYSEILRDEAVARLNDLGKVSDADGYLERTFMSPASVRAGFLIREWMEDAGLRTW  98

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G+L +
Sbjct  99   VDSMGNLHGRVEGMNASAQALLIGSHLDTVVDAGMFDGSLGIISAISALKVLKSIGKLGE  158

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  159  LKRPVEVIAFSDEEGVRFQSTFLGSA  184



>ref|XP_011035486.1| PREDICTED: allantoate deiminase isoform X1 [Populus euphratica]
Length=476

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G + DLF +IL++EAVSRL +LGKVSDAD +LERTF SPASVRA NLIR+WMEDAGL TW
Sbjct  33   GREDDLFAEILRDEAVSRLDQLGKVSDADGHLERTFMSPASVRAANLIRAWMEDAGLTTW  92

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G L  
Sbjct  93   VDYMGNVHGRVEGLNASAEALLIGSHLDTVVDAGIFDGSLGIISAISALKVLKSNGTLTN  152

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  153  LIRPVEVIAFSDEEGVRFQSTFLGSA  178



>ref|XP_007138851.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
 gb|ESW10845.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
Length=482

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSD   YLERTF SPAS+RA  LI
Sbjct  27   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDGKGYLERTFLSPASMRAIILI  86

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  87   RKWMEDAGLRTWVDQMGNVHGRVDGANANAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  146

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            LK +   G+LEKL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  147  LKAMHFNGKLEKLKRPVEVIAFSDEEGVRFQTTFLGS  183



>gb|ABR57240.2| putative allantoate amidohydrolase [Phaseolus vulgaris]
Length=483

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +2

Query  194  VIAFSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLI  370
            V  FSG E G +  + DLFPQIL++EAV+RLYELGKVSD   YLERTF SPAS+RA  LI
Sbjct  28   VSMFSGIETGDLEKRDDLFPQILRDEAVARLYELGKVSDGKGYLERTFLSPASMRAIILI  87

Query  371  RSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISA  550
            R WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISA
Sbjct  88   RKWMEDAGLRTWVDQMGNVHGRVDGANANAEALLIGSHMDTVVDAGMFDGSLGIVSAISA  147

Query  551  LKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            LK +   G+LEKL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  148  LKAMHFNGKLEKLKRPVEVIAFSDEEGVRFQTTFLGS  184



>gb|KJB48028.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=401

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G    L+ +IL++EAV+RL +LGKVSDAD YLERTF SPASVRAG LIR WMEDAGLRTW
Sbjct  39   GKTRSLYSEILRDEAVARLNDLGKVSDADGYLERTFMSPASVRAGFLIREWMEDAGLRTW  98

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G+L +
Sbjct  99   VDSMGNLHGRVEGMNASAQALLIGSHLDTVVDAGMFDGSLGIISAISALKVLKSIGKLGE  158

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  159  LKRPVEVIAFSDEEGVRFQSTFLGSA  184



>ref|XP_011096836.1| PREDICTED: allantoate deiminase [Sesamum indicum]
Length=489

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GT + L  +ILK+EAV+RL ELGKVSDA  +L RTFQSPASVRAGNLIR WMEDAGL+TW
Sbjct  47   GTSF-LHSEILKDEAVARLNELGKVSDAQEFLARTFQSPASVRAGNLIRLWMEDAGLQTW  105

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +DQMGNVHGR EG+NPS KALLIGSHLDTVIDAG FDG+LGI+TA+SALKVL  +G L K
Sbjct  106  VDQMGNVHGRYEGLNPSEKALLIGSHLDTVIDAGIFDGALGIVTALSALKVLNISGMLGK  165

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  166  LRRPVEVIAFSDEEGVRFQSTFLGSA  191



>gb|KJB48025.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=482

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G    L+ +IL++EAV+RL +LGKVSDAD YLERTF SPASVRAG LIR WMEDAGLRTW
Sbjct  39   GKTRSLYSEILRDEAVARLNDLGKVSDADGYLERTFMSPASVRAGFLIREWMEDAGLRTW  98

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+EG+N S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G+L +
Sbjct  99   VDSMGNLHGRVEGMNASAQALLIGSHLDTVVDAGMFDGSLGIISAISALKVLKSIGKLGE  158

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  159  LKRPVEVIAFSDEEGVRFQSTFLGSA  184



>gb|KEH37360.1| allantoate amidohydrolase [Medicago truncatula]
Length=478

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +2

Query  203  FSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSW  379
             SG E G +  + DLFPQIL++EAV+RL ELGKVSDA++YLERTF SPA+ RA NLIR W
Sbjct  27   LSGIETGDLEKRGDLFPQILRDEAVARLVELGKVSDANDYLERTFLSPATTRAINLIRKW  86

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            MEDAGLRTW+DQMGNVHGR+EG N + +ALL+GSH+DTV+DAG FDG+LGI++AISALKV
Sbjct  87   MEDAGLRTWVDQMGNVHGRVEGANANAEALLVGSHMDTVVDAGKFDGALGIVSAISALKV  146

Query  560  LKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +   G+L+ L++PVEVIAF DEEGVRFQ+TFLGS
Sbjct  147  MHVNGKLQNLTRPVEVIAFCDEEGVRFQTTFLGS  180



>gb|EPS72270.1| hypothetical protein M569_02484, partial [Genlisea aurea]
Length=442

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            +ILK+EA++RL ELGKVSDA+N+L RTFQSPAS+RAG+LIR WMEDAGL TW+DQMGNVH
Sbjct  5    EILKDEAMARLIELGKVSDAENFLARTFQSPASIRAGDLIREWMEDAGLLTWVDQMGNVH  64

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+N S KALLIGSHLDTVIDAG FDG+LGIITA+SALKVL+  G L KL +PVEVI
Sbjct  65   GRYEGMNSSEKALLIGSHLDTVIDAGIFDGALGIITALSALKVLRINGMLTKLKRPVEVI  124

Query  611  AFSDEEGVRFQSTFLGSA  664
            AFSDEEGVRFQSTFLGSA
Sbjct  125  AFSDEEGVRFQSTFLGSA  142



>ref|XP_007041019.1| Allantoate amidohydrolase isoform 1 [Theobroma cacao]
 gb|EOX96850.1| Allantoate amidohydrolase isoform 1 [Theobroma cacao]
Length=490

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            G    L  +IL+ EAV+RL ELGKVSDAD YLERTF SPASVRAG LIR WMEDAGLRTW
Sbjct  47   GKTSALHSEILRNEAVARLNELGKVSDADGYLERTFMSPASVRAGILIREWMEDAGLRTW  106

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+ GIN S +ALLIGSHLDTV+DAG FDGSLGII+AISALKVLK+ G+L +
Sbjct  107  VDSMGNLHGRVGGINSSAQALLIGSHLDTVVDAGIFDGSLGIISAISALKVLKSNGKLGE  166

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +P+EVIAFSDEEGVRFQSTFLGSA
Sbjct  167  LKRPIEVIAFSDEEGVRFQSTFLGSA  192



>ref|XP_008225895.1| PREDICTED: allantoate deiminase [Prunus mume]
Length=503

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            DL+P+IL++EAV+RL++LG VSD D YLERTF SPA+VRAGNLIR WMEDAGLRTW+D +
Sbjct  63   DLYPEILRDEAVARLHQLGGVSDGDGYLERTFMSPAAVRAGNLIREWMEDAGLRTWVDSL  122

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GNVHGR+EG N S +ALL+GSHLDTV+DAG FDGSLGII+ ++ALKVL   G+L +LS+P
Sbjct  123  GNVHGRVEGRNASAEALLMGSHLDTVVDAGKFDGSLGIISVLAALKVLNINGKLGELSRP  182

Query  599  VEVIAFSDEEGVRFQSTFLGSA  664
            VEVIAFSDEEGVRFQSTFLGSA
Sbjct  183  VEVIAFSDEEGVRFQSTFLGSA  204



>ref|XP_003594851.1| Allantoate amidohydrolase [Medicago truncatula]
Length=568

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            DLFPQIL++EAV+RL ELGKVSDA++YLERTF SPA+ RA NLIR WMEDAGLRTW+DQM
Sbjct  130  DLFPQILRDEAVARLVELGKVSDANDYLERTFLSPATTRAINLIRKWMEDAGLRTWVDQM  189

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GNVHGR+EG N + +ALL+GSH+DTV+DAG FDG+LGI++AISALKV+   G+L+ L++P
Sbjct  190  GNVHGRVEGANANAEALLVGSHMDTVVDAGKFDGALGIVSAISALKVMHVNGKLQNLTRP  249

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            VEVIAF DEEGVRFQ+TFLGS
Sbjct  250  VEVIAFCDEEGVRFQTTFLGS  270


 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  296  KVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLI  475
            +VSDA++YLERTF SPA+ RA NLIR WMEDAGLRTW+DQMGNVHGR+EG N + +ALL+
Sbjct  7    QVSDANDYLERTFLSPATTRAINLIRKWMEDAGLRTWVDQMGNVHGRVEGANANAEALLV  66

Query  476  GSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
            GSH+DTV+DAG FDG+LGI++AISALKV+   G+L+ L++PVE  A+
Sbjct  67   GSHMDTVVDAGKFDGALGIVSAISALKVMHVNGKLQNLTRPVESDAW  113



>ref|XP_007212027.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
 gb|EMJ13226.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
Length=456

 Score =   229 bits (584),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            DL+P+IL++E V+RL++LG VSD D YLERTF SPA+VRAGNLIR WMEDAGLRTW+D +
Sbjct  16   DLYPEILRDEVVARLHQLGGVSDGDGYLERTFMSPAAVRAGNLIREWMEDAGLRTWVDSL  75

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GNVHGR+EG N S +ALL+GSHLDTV+DAG FDGSLGII+ ++ALKVL   G+L +LS+P
Sbjct  76   GNVHGRVEGRNASAEALLMGSHLDTVVDAGKFDGSLGIISVLAALKVLNINGKLGELSRP  135

Query  599  VEVIAFSDEEGVRFQSTFLGSA  664
            VEVIAFSDEEGVRFQSTFLGSA
Sbjct  136  VEVIAFSDEEGVRFQSTFLGSA  157



>ref|XP_008383283.1| PREDICTED: allantoate deiminase [Malus domestica]
Length=499

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +2

Query  218  NGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGL  397
            +GVG +   +P+IL++EAV+RL++LG+VSD D YLERTF SPA++RAGNLIR WMEDAGL
Sbjct  52   SGVGEESGSYPKILRDEAVARLHQLGRVSDGDGYLERTFMSPAALRAGNLIREWMEDAGL  111

Query  398  RTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGR  577
            RTW+D +GNVHGR+EG N S +ALL+GSHLDTV+D G FDG+LGII+ +SALKVLK  G+
Sbjct  112  RTWVDCLGNVHGRVEGRNASAEALLMGSHLDTVVDGGKFDGALGIISVLSALKVLKVNGK  171

Query  578  LEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +LS+PVEVIAFSDEEGVR+QSTFLGSA
Sbjct  172  LGELSRPVEVIAFSDEEGVRYQSTFLGSA  200



>ref|XP_010684279.1| PREDICTED: allantoate deiminase [Beta vulgaris subsp. vulgaris]
Length=480

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +2

Query  203  FSGSENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWM  382
              GSE       DL  + L++EAVSRL ELGK+SD D YLERTF SPASVRA N IR WM
Sbjct  31   LHGSEEAEVVGNDLHREFLRDEAVSRLNELGKISDVDGYLERTFLSPASVRAANAIRQWM  90

Query  383  EDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVL  562
            EDAGLRTW+D MGNVHGR++GIN S  ALL+GSH+DTV+DAG FDG+LGII+AISALKVL
Sbjct  91   EDAGLRTWVDLMGNVHGRVDGINASAPALLMGSHMDTVVDAGKFDGALGIISAISALKVL  150

Query  563  KTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            K T +LE L +PVEVIAF DEEGVRFQSTFLGSA
Sbjct  151  KVTEKLEMLRRPVEVIAFCDEEGVRFQSTFLGSA  184



>ref|XP_007212028.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
 gb|EMJ13227.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
Length=480

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            DL+P+IL++E V+RL++LG VSD D YLERTF SPA+VRAGNLIR WMEDAGLRTW+D +
Sbjct  16   DLYPEILRDEVVARLHQLGGVSDGDGYLERTFMSPAAVRAGNLIREWMEDAGLRTWVDSL  75

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GNVHGR+EG N S +ALL+GSHLDTV+DAG FDGSLGII+ ++ALKVL   G+L +LS+P
Sbjct  76   GNVHGRVEGRNASAEALLMGSHLDTVVDAGKFDGSLGIISVLAALKVLNINGKLGELSRP  135

Query  599  VEVIAFSDEEGVRFQSTFLGSA  664
            VEVIAFSDEEGVRFQSTFLGSA
Sbjct  136  VEVIAFSDEEGVRFQSTFLGSA  157



>ref|XP_009354000.1| PREDICTED: allantoate deiminase-like [Pyrus x bretschneideri]
Length=498

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +2

Query  218  NGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGL  397
            +GVG +   +P+IL++EAV+RL++LG+VSD D YLERTF SPA++RAGNLIR WMEDAGL
Sbjct  51   SGVGEESGSYPEILRDEAVARLHQLGRVSDGDGYLERTFMSPAALRAGNLIREWMEDAGL  110

Query  398  RTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGR  577
            RTW+D +GNVHGR+EG N S +ALL+GSHLDTV+D G FDG+LGI++ +SALKVLK  G+
Sbjct  111  RTWVDCLGNVHGRVEGRNASAEALLMGSHLDTVVDGGKFDGALGIVSVLSALKVLKVNGK  170

Query  578  LEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +LS+PVEVIAFSDEEGVR+QSTFLGSA
Sbjct  171  LGELSRPVEVIAFSDEEGVRYQSTFLGSA  199



>ref|XP_009340289.1| PREDICTED: allantoate deiminase-like [Pyrus x bretschneideri]
 ref|XP_009340290.1| PREDICTED: allantoate deiminase-like [Pyrus x bretschneideri]
Length=498

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  218  NGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGL  397
            +GVG +   +P+IL++EAV+RL++LG+VSD D YLERTF SPA++RAGNLIR WMED GL
Sbjct  51   SGVGEESGSYPEILRDEAVARLHQLGRVSDGDGYLERTFMSPAALRAGNLIREWMEDTGL  110

Query  398  RTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGR  577
            RTW+D +GNVHGR+EG N S +ALL+GSHLDTV+D G FDG+LGI++ +SALKVLK  GR
Sbjct  111  RTWVDCLGNVHGRVEGRNASAEALLMGSHLDTVVDGGKFDGALGIVSVLSALKVLKVNGR  170

Query  578  LEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +LS+PVEVIAFSDEEGVR+QSTFLGSA
Sbjct  171  LGELSRPVEVIAFSDEEGVRYQSTFLGSA  199



>ref|XP_008446305.1| PREDICTED: allantoate deiminase, partial [Cucumis melo]
Length=538

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = +2

Query  200  AFSG--SENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIR  373
            AF+G  +E+    + DLF QILK+EAV RL ELGKVSDAD YLERTF SPAS++A  L++
Sbjct  84   AFTGDVAEDSKNRRADLFVQILKDEAVGRLNELGKVSDADRYLERTFLSPASIKARFLLQ  143

Query  374  SWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISAL  553
             WMEDAGLRTW+D MGN+HGR EG N S +ALLIGSHLDTV+DAG FDG+LGII+AISAL
Sbjct  144  KWMEDAGLRTWVDCMGNLHGRTEGRNASAEALLIGSHLDTVVDAGKFDGALGIISAISAL  203

Query  554  KVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            KVL   G+LE+L +P+EVIAFSDEEGVRFQSTFLGSA
Sbjct  204  KVLNMNGKLEELKRPIEVIAFSDEEGVRFQSTFLGSA  240



>ref|XP_004487907.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X1 
[Cicer arietinum]
Length=473

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = +2

Query  203  FSGSENG-VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSW  379
            FSG E G +  + DLFPQIL++EA++RL ELG VSDA++YLERTF SPAS+RA +L + W
Sbjct  22   FSGIETGDLEKRGDLFPQILRDEALARLLELGMVSDANDYLERTFLSPASMRAIHLTQKW  81

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            MEDAGLRTW+DQMGNVHGR++G+N + +ALL+GSHLDTV+DAG FDGSLGI++AISALKV
Sbjct  82   MEDAGLRTWVDQMGNVHGRVDGVNANTEALLVGSHLDTVVDAGKFDGSLGIVSAISALKV  141

Query  560  LKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +   G+L+KL +PVEVIAF +EEGVRFQ+TFLGS
Sbjct  142  MHVHGKLQKLRRPVEVIAFCEEEGVRFQTTFLGS  175



>ref|XP_004145132.1| PREDICTED: allantoate deiminase isoform X1 [Cucumis sativus]
 gb|KGN64461.1| hypothetical protein Csa_1G056970 [Cucumis sativus]
Length=504

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 2/157 (1%)
 Frame = +2

Query  200  AFSG--SENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIR  373
            AF+G  +E+    + DLF QILK+EAV RL ELGKVSDA  YLERTF SPAS++A  L++
Sbjct  50   AFTGDVAEDSKNRRADLFVQILKDEAVGRLNELGKVSDAARYLERTFLSPASIKASFLLQ  109

Query  374  SWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISAL  553
             WMEDAGLRTW+D MGN+HGR EG N S +ALLIGSHLDTV+DAG FDG+LGII+AISAL
Sbjct  110  KWMEDAGLRTWVDCMGNLHGRTEGRNASAEALLIGSHLDTVVDAGKFDGALGIISAISAL  169

Query  554  KVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            KVL   G+LE+L +P+EVIAFSDEEGVRFQSTFLGSA
Sbjct  170  KVLNMNGKLEELKRPIEVIAFSDEEGVRFQSTFLGSA  206



>ref|XP_008809340.1| PREDICTED: probable allantoate deiminase isoform X2 [Phoenix 
dactylifera]
Length=506

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  203  FSGSENGVGTK--YDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRS  376
            FSG E G G     +LF +IL++EAVSR+ +LGK+SDAD YLERTF SP S+RA +LI S
Sbjct  33   FSGLEVGSGEDGGDELFREILRDEAVSRINQLGKISDADGYLERTFLSPGSIRATDLIMS  92

Query  377  WMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALK  556
            WM+DAGL+TW+DQMGN+HGR   IN + + LLIGSHLDTV+DAG +DGSLGI+ AISALK
Sbjct  93   WMQDAGLKTWVDQMGNLHGRTNAINATAETLLIGSHLDTVVDAGKYDGSLGIVCAISALK  152

Query  557  VLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            VLK  G+LEKL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  153  VLKVKGKLEKLYRPVEVIAFSDEEGVRFQSTFLGSA  188



>ref|XP_004293794.2| PREDICTED: allantoate deiminase [Fragaria vesca subsp. vesca]
Length=575

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = +2

Query  191  PVIAFSG--SENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGN  364
            P   FSG   E+      +L P+IL++EAV+RL++LGKVSD D YLER F SPA+VRAGN
Sbjct  118  PCFGFSGVGGEDEGNRGGELCPEILRDEAVARLHQLGKVSDGDGYLERIFMSPAAVRAGN  177

Query  365  LIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAI  544
            LIR WMEDAGLRTW+D +GNVHGR+EG N S +ALLIGSHLDTV+DAG FDGSLGII+ I
Sbjct  178  LIREWMEDAGLRTWVDCLGNVHGRVEGGNASAEALLIGSHLDTVVDAGIFDGSLGIISVI  237

Query  545  SALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            SALKVL   G++ +L +PVEVIAFSDEEGVRFQSTF+GSA
Sbjct  238  SALKVLSINGKVGELKRPVEVIAFSDEEGVRFQSTFIGSA  277



>ref|XP_010914254.1| PREDICTED: probable allantoate deiminase isoform X1 [Elaeis guineensis]
Length=488

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  203  FSGSENGVGTK--YDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRS  376
             SG E G G     +LFP IL++EAVSR+ +LGK+SDAD YLERTF SP S+RA +LI S
Sbjct  33   ISGLEVGSGEDGGDELFPAILRDEAVSRINQLGKISDADGYLERTFLSPGSIRATDLIMS  92

Query  377  WMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALK  556
            WM+DAGL+TW+DQMGN+HGR + +N + + LLIGSHLDTV+DAG +DGSLGII AISALK
Sbjct  93   WMQDAGLKTWVDQMGNLHGRTDTVNATAETLLIGSHLDTVVDAGKYDGSLGIICAISALK  152

Query  557  VLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            VL+  G+LEKL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  153  VLRIKGKLEKLYRPVEVIAFSDEEGVRFQSTFLGSA  188



>ref|XP_010914255.1| PREDICTED: probable allantoate deiminase isoform X2 [Elaeis guineensis]
Length=487

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  203  FSGSENGVGTK--YDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRS  376
             SG E G G     +LFP IL++EAVSR+ +LGK+SDAD YLERTF SP S+RA +LI S
Sbjct  33   ISGLEVGSGEDGGDELFPAILRDEAVSRINQLGKISDADGYLERTFLSPGSIRATDLIMS  92

Query  377  WMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALK  556
            WM+DAGL+TW+DQMGN+HGR + +N + + LLIGSHLDTV+DAG +DGSLGII AISALK
Sbjct  93   WMQDAGLKTWVDQMGNLHGRTDTVNATAETLLIGSHLDTVVDAGKYDGSLGIICAISALK  152

Query  557  VLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            VL+  G+LEKL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  153  VLRIKGKLEKLYRPVEVIAFSDEEGVRFQSTFLGSA  188



>ref|XP_002869950.1| hypothetical protein ARALYDRAFT_914645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46209.1| hypothetical protein ARALYDRAFT_914645 [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK+DL   I+++EAV+RL+ELG+VSDA  +LERTF SPAS+RA +LIR WMEDAGL TW
Sbjct  86   GTKHDLHQTIIRDEAVARLHELGQVSDAVAHLERTFMSPASIRAIDLIRRWMEDAGLSTW  145

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+E  N S +ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK +GRL +
Sbjct  146  VDYMGNVHGRVEPKNGSSQALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKISGRLGE  205

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  206  LKRPVEVIAFSDEEGVRFQSTFLGSA  231



>ref|NP_193740.1| allantoate amidohydrolase [Arabidopsis thaliana]
 sp|O49434.2|AAH_ARATH RecName: Full=Allantoate deiminase; AltName: Full=Allantoate 
amidohydrolase; Short=AtAAH; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16615.2| hyuC-like protein [Arabidopsis thaliana]
 emb|CAB79007.1| hyuC-like protein [Arabidopsis thaliana]
 gb|ABF57290.1| At4g20070 [Arabidopsis thaliana]
 gb|AEE84269.1| allantoate amidohydrolase [Arabidopsis thaliana]
Length=525

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK+DL   IL++EAV+RL+ELG+VSDA  +LERTF SPAS+RA  LIR WMEDAGL TW
Sbjct  82   GTKHDLHQAILRDEAVARLHELGQVSDAATHLERTFMSPASIRAIPLIRGWMEDAGLSTW  141

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+E  N S +ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  GRL +
Sbjct  142  VDYMGNVHGRVEPKNGSSQALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKIDGRLGE  201

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  202  LKRPVEVIAFSDEEGVRFQSTFLGSA  227



>ref|XP_010097117.1| Allantoate deiminase [Morus notabilis]
 gb|EXB66978.1| Allantoate deiminase [Morus notabilis]
Length=480

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            D++P+IL++EAV+RL +LG++SDA+ YLERTF S ASV+AGNLIR WMEDAGLRTW+D +
Sbjct  41   DVYPEILRDEAVARLQQLGQISDAEGYLERTFLSSASVKAGNLIRGWMEDAGLRTWVDSL  100

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+HGR+EG N S +AL+IGSHLDTV+DAG FDGSLGII+A++ALKVL   G+L    +P
Sbjct  101  GNIHGRVEGRNASAEALIIGSHLDTVVDAGIFDGSLGIISALAALKVLHVNGKLRTRKRP  160

Query  599  VEVIAFSDEEGVRFQSTFLGSA  664
            VEVIAFSDEEGVRFQSTFLGSA
Sbjct  161  VEVIAFSDEEGVRFQSTFLGSA  182



>ref|XP_008809341.1| PREDICTED: probable allantoate deiminase isoform X3 [Phoenix 
dactylifera]
Length=491

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            +LF +IL++EAVSR+ +LGK+SDAD YLERTF SP S+RA +LI SWM+DAGL+TW+DQM
Sbjct  48   ELFREILRDEAVSRINQLGKISDADGYLERTFLSPGSIRATDLIMSWMQDAGLKTWVDQM  107

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+HGR   IN + + LLIGSHLDTV+DAG +DGSLGI+ AISALKVLK  G+LEKL +P
Sbjct  108  GNLHGRTNAINATAETLLIGSHLDTVVDAGKYDGSLGIVCAISALKVLKVKGKLEKLYRP  167

Query  599  VEVIAFSDEEGVRFQSTFLGSA  664
            VEVIAFSDEEGVRFQSTFLGSA
Sbjct  168  VEVIAFSDEEGVRFQSTFLGSA  189



>ref|XP_008809339.1| PREDICTED: probable allantoate deiminase isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            +LF +IL++EAVSR+ +LGK+SDAD YLERTF SP S+RA +LI SWM+DAGL+TW+DQM
Sbjct  48   ELFREILRDEAVSRINQLGKISDADGYLERTFLSPGSIRATDLIMSWMQDAGLKTWVDQM  107

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+HGR   IN + + LLIGSHLDTV+DAG +DGSLGI+ AISALKVLK  G+LEKL +P
Sbjct  108  GNLHGRTNAINATAETLLIGSHLDTVVDAGKYDGSLGIVCAISALKVLKVKGKLEKLYRP  167

Query  599  VEVIAFSDEEGVRFQSTFLGSA  664
            VEVIAFSDEEGVRFQSTFLGSA
Sbjct  168  VEVIAFSDEEGVRFQSTFLGSA  189



>ref|XP_008809343.1| PREDICTED: probable allantoate deiminase isoform X4 [Phoenix 
dactylifera]
Length=487

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            +LF +IL++EAVSR+ +LGK+SDAD YLERTF SP S+RA +LI SWM+DAGL+TW+DQM
Sbjct  48   ELFREILRDEAVSRINQLGKISDADGYLERTFLSPGSIRATDLIMSWMQDAGLKTWVDQM  107

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+HGR   IN + + LLIGSHLDTV+DAG +DGSLGI+ AISALKVLK  G+LEKL +P
Sbjct  108  GNLHGRTNAINATAETLLIGSHLDTVVDAGKYDGSLGIVCAISALKVLKVKGKLEKLYRP  167

Query  599  VEVIAFSDEEGVRFQSTFLGSA  664
            VEVIAFSDEEGVRFQSTFLGSA
Sbjct  168  VEVIAFSDEEGVRFQSTFLGSA  189



>ref|XP_010536943.1| PREDICTED: allantoate deiminase [Tarenaya hassleriana]
Length=520

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GT+ DL  Q+L++EAV+RL+ELGKVSDAD +LERTF SPAS+RA NLI+ WM+DAGL TW
Sbjct  75   GTRQDLHQQLLRDEAVARLHELGKVSDADGHLERTFMSPASMRARNLIKGWMDDAGLSTW  134

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR++  N S +ALLIGSH+DTV+DAG +DGSLGII+AISALK L   G+L +
Sbjct  135  VDVMGNVHGRVDPKNGSTQALLIGSHMDTVVDAGKYDGSLGIISAISALKALNVNGKLRE  194

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  195  LKRPVEVIAFSDEEGVRFQSTFLGSA  220



>ref|XP_011628473.1| PREDICTED: allantoate deiminase [Amborella trichopoda]
Length=508

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  224  VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            V  + +++  IL+++AV++LY LGK+SDAD YLERTF S AS++A ++IR WMEDAGL T
Sbjct  62   VQGRDEMYKAILRDDAVAKLYHLGKISDADGYLERTFLSHASIQASSVIRGWMEDAGLTT  121

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W+DQMGNVHGR EG+N S +ALLIGSHLDTVIDAG +DGSLGII AISA+KVLK +G LE
Sbjct  122  WVDQMGNVHGRTEGMNASAEALLIGSHLDTVIDAGIYDGSLGIICAISAMKVLKMSGMLE  181

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            KL +PVE+IAFSDEEGVRFQ TFLGSA
Sbjct  182  KLRRPVEIIAFSDEEGVRFQMTFLGSA  208



>ref|XP_010449233.1| PREDICTED: allantoate deiminase [Camelina sativa]
Length=530

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK+DL   IL++E+V+RL+ELG+VSDA  +LERTF SPAS+RA NL+R WMEDAGL TW
Sbjct  87   GTKHDLHQAILRDESVARLHELGQVSDAVAHLERTFMSPASIRAINLLRGWMEDAGLSTW  146

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+E  N S +ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  147  VDYMGNLHGRVEPKNGSSQALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKVNGKLSE  206

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQ TFLGSA
Sbjct  207  LKRPVEVIAFSDEEGVRFQCTFLGSA  232



>gb|ERN19684.1| hypothetical protein AMTR_s00062p00185230 [Amborella trichopoda]
Length=513

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  224  VGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            V  + +++  IL+++AV++LY LGK+SDAD YLERTF S AS++A ++IR WMEDAGL T
Sbjct  67   VQGRDEMYKAILRDDAVAKLYHLGKISDADGYLERTFLSHASIQASSVIRGWMEDAGLTT  126

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W+DQMGNVHGR EG+N S +ALLIGSHLDTVIDAG +DGSLGII AISA+KVLK +G LE
Sbjct  127  WVDQMGNVHGRTEGMNASAEALLIGSHLDTVIDAGIYDGSLGIICAISAMKVLKMSGMLE  186

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            KL +PVE+IAFSDEEGVRFQ TFLGSA
Sbjct  187  KLRRPVEIIAFSDEEGVRFQMTFLGSA  213



>ref|XP_010434321.1| PREDICTED: allantoate deiminase-like [Camelina sativa]
Length=532

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK+DL   IL++E+V+RL+ELG+VSDA ++LERTF SPAS+RA +L+R WMEDAGL TW
Sbjct  89   GTKHDLHQAILRDESVARLHELGQVSDAVSHLERTFMSPASIRAIDLLRGWMEDAGLSTW  148

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+E  N S +ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  149  VDYMGNLHGRVEPKNGSSQALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKANGKLAE  208

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQ TFLGSA
Sbjct  209  LKRPVEVIAFSDEEGVRFQCTFLGSA  234



>ref|XP_010439619.1| PREDICTED: allantoate deiminase-like [Camelina sativa]
Length=535

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK+DL   IL++E+V+RL+ELG+VSDA  +LERTF SPASVRA +L+R WMEDAGL TW
Sbjct  92   GTKHDLHQTILRDESVARLHELGQVSDAVAHLERTFMSPASVRAIDLLRGWMEDAGLSTW  151

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGN+HGR+E  N S +ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  152  VDYMGNLHGRVEPKNGSSQALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKVNGKLAE  211

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQ TFLGSA
Sbjct  212  LKRPVEVIAFSDEEGVRFQCTFLGSA  237



>ref|XP_009408249.1| PREDICTED: probable allantoate deiminase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +2

Query  233  KYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWID  412
            +  LF  IL++EAV R+ +L K+SDAD YLERTF S ASV+A  LI  WM DAGLRTW+D
Sbjct  45   RNQLFAGILRDEAVERINQLAKISDADGYLERTFLSSASVKAAQLIIEWMRDAGLRTWVD  104

Query  413  QMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLS  592
            QMGNVHGR E +N + + LLIGSH DTV+DAG FDGSLGII AISALKVLKT G+L KLS
Sbjct  105  QMGNVHGRSEALNTTAETLLIGSHADTVVDAGKFDGSLGIICAISALKVLKTNGKLHKLS  164

Query  593  KPVEVIAFSDEEGVRFQSTFLGSA  664
            +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  165  RPVEVIAFSDEEGVRFQSTFLGSA  188



>ref|XP_009408248.1| PREDICTED: probable allantoate deiminase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +2

Query  233  KYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWID  412
            +  LF  IL++EAV R+ +L K+SDAD YLERTF S ASV+A  LI  WM DAGLRTW+D
Sbjct  46   RNQLFAGILRDEAVERINQLAKISDADGYLERTFLSSASVKAAQLIIEWMRDAGLRTWVD  105

Query  413  QMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLS  592
            QMGNVHGR E +N + + LLIGSH DTV+DAG FDGSLGII AISALKVLKT G+L KLS
Sbjct  106  QMGNVHGRSEALNTTAETLLIGSHADTVVDAGKFDGSLGIICAISALKVLKTNGKLHKLS  165

Query  593  KPVEVIAFSDEEGVRFQSTFLGSA  664
            +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  166  RPVEVIAFSDEEGVRFQSTFLGSA  189



>ref|XP_006413903.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
 gb|ESQ55356.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
Length=536

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  194  VIAFSGSENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIR  373
            +I+  G     GTK DL   IL++E+V+RL+ELG+VSDA ++LERTF SPAS+RA  LIR
Sbjct  171  IISGKGFGETEGTKNDLHQAILRDESVARLHELGQVSDAVSHLERTFMSPASIRAITLIR  230

Query  374  SWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISAL  553
             WMEDAGL TW+D MGNVHGR++  N S +ALLIGSH+DTVIDAG +DGSLGII+AISAL
Sbjct  231  GWMEDAGLSTWVDYMGNVHGRVDPKNGSTQALLIGSHMDTVIDAGKYDGSLGIISAISAL  290

Query  554  KVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            KVLK  G+L +L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  291  KVLKINGKLGELKRPVEVIAFSDEEGVRFQSTFLGSA  327



>ref|NP_001058304.1| Os06g0665500 [Oryza sativa Japonica Group]
 sp|Q655X8.1|AAH_ORYSJ RecName: Full=Probable allantoate deiminase; AltName: Full=Allantoate 
amidohydrolase; Short=OsAAH; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD45389.1| putative N-carbamyl-L-amino acid amidohydrolase [Oryza sativa 
Japonica Group]
 dbj|BAF20218.1| Os06g0665500 [Oryza sativa Japonica Group]
 dbj|BAG93368.1| unnamed protein product [Oryza sativa Japonica Group]
Length=491

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELGK+SD + YLERTF SPAS+RA  +I SWM+DAGL TWIDQMG
Sbjct  40   LYREILRDETVLRLKELGKISDGEGYLERTFLSPASIRASAVIISWMKDAGLTTWIDQMG  99

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + +ALLIGSH+DTVIDAG +DG+LGII+AISALKVLK TGRL++L++PV
Sbjct  100  NIHGRFEPTNSTKEALLIGSHMDTVIDAGMYDGALGIISAISALKVLKVTGRLQRLTRPV  159

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  160  EVIAFSDEEGVRFQTTFLGSA  180



>gb|EEC81134.1| hypothetical protein OsI_24029 [Oryza sativa Indica Group]
Length=475

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELGK+SD + YLERTF SPAS+RA  +I SWM+DAGL TWIDQMG
Sbjct  40   LYREILRDETVLRLKELGKISDGEGYLERTFLSPASIRASAVIISWMKDAGLTTWIDQMG  99

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + +ALLIGSH+DTVIDAG +DG+LGII+AISALKVLK TGRL++L++PV
Sbjct  100  NIHGRFEPTNSTKEALLIGSHMDTVIDAGMYDGALGIISAISALKVLKVTGRLQRLTRPV  159

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  160  EVIAFSDEEGVRFQTTFLGSA  180



>ref|XP_006413904.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
 gb|ESQ55357.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
Length=610

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK DL   IL++E+V+RL+ELG+VSDA ++LERTF SPAS+RA  LIR WMEDAGL TW
Sbjct  154  GTKNDLHQAILRDESVARLHELGQVSDAVSHLERTFMSPASIRAITLIRGWMEDAGLSTW  213

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR++  N S +ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  214  VDYMGNVHGRVDPKNGSTQALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKINGKLGE  273

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  274  LKRPVEVIAFSDEEGVRFQSTFLGSA  299



>ref|XP_006283501.1| hypothetical protein CARUB_v10004553mg [Capsella rubella]
 gb|EOA16399.1| hypothetical protein CARUB_v10004553mg [Capsella rubella]
Length=537

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK DL   IL++EAV+RL+ELG+VSDA  +LERTF SPAS+RA  LIR WMEDAGL TW
Sbjct  94   GTKNDLHQTILRDEAVARLHELGQVSDAVAHLERTFMSPASIRAIPLIRGWMEDAGLSTW  153

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+E  N S  ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  154  VDYMGNVHGRVEPKNGSSPALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKVNGKLGE  213

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQ TFLGSA
Sbjct  214  LKRPVEVIAFSDEEGVRFQYTFLGSA  239



>gb|EEE66180.1| hypothetical protein OsJ_22281 [Oryza sativa Japonica Group]
Length=491

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELGK+SD + YLERTF SPAS+RA  +I SWM+DAGL TWIDQMG
Sbjct  40   LYREILRDETVLRLKELGKISDGEGYLERTFLSPASIRASAVIISWMKDAGLTTWIDQMG  99

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + +ALLIGSH+DTVIDAG +DG+LGII+AISALKVLK TGRL++L++PV
Sbjct  100  NIHGRFEPTNSTKEALLIGSHMDTVIDAGMYDGALGIISAISALKVLKVTGRLQRLTRPV  159

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  160  EVIAFSDEEGVRFQTTFLGSA  180



>ref|XP_009137035.1| PREDICTED: allantoate deiminase [Brassica rapa]
Length=527

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK DL   IL++E+V+RL+ELG+VSDA  +LERTF SPAS+R   L+R WMEDAGL TW
Sbjct  84   GTKQDLHLSILRDESVARLHELGQVSDAATHLERTFMSPASIRGIKLLREWMEDAGLSTW  143

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+E  N S  ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  144  VDNMGNVHGRVEPKNGSTPALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKVNGKLGE  203

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQ TFLGSA
Sbjct  204  LKRPVEVIAFSDEEGVRFQCTFLGSA  229



>emb|CDY01635.1| BnaC07g36250D [Brassica napus]
Length=525

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK DL   IL++E+V+RL+ELG+VSDA  +LERTF SPAS+R   L+R WMEDAGL TW
Sbjct  87   GTKQDLHLSILRDESVARLHELGQVSDAATHLERTFMSPASIRGIKLLREWMEDAGLSTW  146

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+E  N S  ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  147  VDNMGNVHGRVEPKNGSTPALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKVNGKLGE  206

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQ TFLGSA
Sbjct  207  LKRPVEVIAFSDEEGVRFQCTFLGSA  232



>emb|CDX98655.1| BnaA03g44400D [Brassica napus]
Length=519

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +2

Query  227  GTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTW  406
            GTK DL   IL++E+V+RL+ELG+VSDA  +LERTF SPAS+R   L+R WMEDAGL TW
Sbjct  81   GTKQDLHMSILRDESVARLHELGQVSDAATHLERTFMSPASIRGIKLLREWMEDAGLLTW  140

Query  407  IDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK  586
            +D MGNVHGR+E  N S  ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G+L +
Sbjct  141  VDNMGNVHGRVEPKNGSTPALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKVNGKLGE  200

Query  587  LSKPVEVIAFSDEEGVRFQSTFLGSA  664
            L +PVEVIAFSDEEGVRFQ TFLGSA
Sbjct  201  LKRPVEVIAFSDEEGVRFQCTFLGSA  226



>ref|XP_002532138.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30237.1| conserved hypothetical protein, partial [Ricinus communis]
Length=436

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            +IL++EAV+RL EL KVSD+D  LERTF S AS++AGNLI+SWMEDAGL TW+D MGN+H
Sbjct  1    EILRDEAVARLNELAKVSDSDGCLERTFMSAASLKAGNLIQSWMEDAGLTTWVDHMGNIH  60

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR+ G N S +ALLIGSHLDTV+DAG +DG+LGII+A+SALK LK+ G L KL +PVEVI
Sbjct  61   GRVAGSNASAEALLIGSHLDTVVDAGKYDGTLGIISAMSALKALKSKGMLNKLKRPVEVI  120

Query  611  AFSDEEGVRFQSTFLGSA  664
            AFSDEEGVRFQSTFLGSA
Sbjct  121  AFSDEEGVRFQSTFLGSA  138



>ref|NP_001151245.1| metallopeptidase precursor [Zea mays]
 gb|ACF79000.1| unknown [Zea mays]
 gb|ACF86140.1| unknown [Zea mays]
 gb|ACG42112.1| metallopeptidase [Zea mays]
Length=505

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELGK+SD D YLERTF SPAS+RA  +I SWM+DAGL TW+DQMG
Sbjct  45   LYREILRDETVQRLKELGKISDGDGYLERTFLSPASIRATGVIVSWMKDAGLTTWVDQMG  104

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N +  ALLIGSH+DTV+DAG +DG+LGII+AISALKVLK TG+L++L++PV
Sbjct  105  NIHGRYEPANSTRDALLIGSHMDTVVDAGMYDGALGIISAISALKVLKVTGKLQRLTRPV  164

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEG+RFQ+TFLGSA
Sbjct  165  EVIAFSDEEGIRFQTTFLGSA  185



>ref|XP_002438812.1| hypothetical protein SORBIDRAFT_10g026590 [Sorghum bicolor]
 gb|EER90179.1| hypothetical protein SORBIDRAFT_10g026590 [Sorghum bicolor]
Length=506

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELGK+SD + YLERTF SPAS+RA  +I SWM+DAGL TW+DQMG
Sbjct  48   LYREILRDETVLRLKELGKISDGEGYLERTFLSPASIRATAVIISWMKDAGLTTWVDQMG  107

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + +ALLIGSH+DTV+DAG +DGSLGII AISALKVLK TG+L++L++PV
Sbjct  108  NIHGRFEPTNSTKEALLIGSHMDTVVDAGMYDGSLGIICAISALKVLKVTGKLQRLTRPV  167

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  168  EVIAFSDEEGVRFQTTFLGSA  188



>ref|XP_010240400.1| PREDICTED: probable allantoate deiminase isoform X2 [Brachypodium 
distachyon]
Length=488

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELG++SD + YLERTF SPAS+RA  +I SWMEDAGL TW+DQMG
Sbjct  30   LYREILRDETVRRLKELGQISDGEGYLERTFLSPASLRATGVIISWMEDAGLPTWVDQMG  89

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N S +ALLIGSH+DTVIDAG +DG+LGII AISALKVLK TG+L++L++PV
Sbjct  90   NIHGRFEPANSSKEALLIGSHMDTVIDAGMYDGALGIICAISALKVLKVTGKLQRLTRPV  149

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  150  EVIAFSDEEGVRFQTTFLGSA  170



>gb|EMS60014.1| Allantoate deiminase, chloroplastic [Triticum urartu]
Length=402

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELGK+SD + +LERTF SPAS RA ++I SWM+DAGL TW+DQMG
Sbjct  41   LYREILRDETVLRLKELGKISDGEGFLERTFLSPASFRATDVIISWMKDAGLTTWVDQMG  100

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + KALLIGSH+DTVIDAG +DG+LGII AISALKVL+ TG+L++L++PV
Sbjct  101  NIHGRFEPSNSTDKALLIGSHMDTVIDAGMYDGALGIICAISALKVLRVTGKLQRLTRPV  160

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  161  EVIAFSDEEGVRFQTTFLGSA  181



>ref|XP_010240394.1| PREDICTED: probable allantoate deiminase isoform X1 [Brachypodium 
distachyon]
Length=495

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  245  FPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGN  424
            + +IL++E V RL ELG++SD + YLERTF SPAS+RA  +I SWMEDAGL TW+DQMGN
Sbjct  38   YREILRDETVRRLKELGQISDGEGYLERTFLSPASLRATGVIISWMEDAGLPTWVDQMGN  97

Query  425  VHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVE  604
            +HGR E  N S +ALLIGSH+DTVIDAG +DG+LGII AISALKVLK TG+L++L++PVE
Sbjct  98   IHGRFEPANSSKEALLIGSHMDTVIDAGMYDGALGIICAISALKVLKVTGKLQRLTRPVE  157

Query  605  VIAFSDEEGVRFQSTFLGSA  664
            VIAFSDEEGVRFQ+TFLGSA
Sbjct  158  VIAFSDEEGVRFQTTFLGSA  177



>ref|XP_004965622.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X2 
[Setaria italica]
Length=500

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L  +IL++E V RL ELGK+SD + YLERTF SPAS+RA  +I SWM+DAGL TW+DQMG
Sbjct  43   LHREILRDETVMRLKELGKISDGEGYLERTFLSPASIRATAVIVSWMKDAGLTTWVDQMG  102

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + +ALLIGSH+DTVIDAG +DGSLGII AISALKVLK TG+L +L +PV
Sbjct  103  NIHGRFEPANSTKEALLIGSHMDTVIDAGMYDGSLGIICAISALKVLKVTGKLHRLIRPV  162

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  163  EVIAFSDEEGVRFQTTFLGSA  183



>ref|XP_004965621.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X1 
[Setaria italica]
Length=539

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L  +IL++E V RL ELGK+SD + YLERTF SPAS+RA  +I SWM+DAGL TW+DQMG
Sbjct  82   LHREILRDETVMRLKELGKISDGEGYLERTFLSPASIRATAVIVSWMKDAGLTTWVDQMG  141

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + +ALLIGSH+DTVIDAG +DGSLGII AISALKVLK TG+L +L +PV
Sbjct  142  NIHGRFEPANSTKEALLIGSHMDTVIDAGMYDGSLGIICAISALKVLKVTGKLHRLIRPV  201

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  202  EVIAFSDEEGVRFQTTFLGSA  222



>dbj|BAK06888.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  209  GSENGVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMED  388
            G E   G    L+ +IL++E V RL +LGK+SD + +LERTF SPAS RA ++I  WM+D
Sbjct  34   GPEQQPGGGDGLYREILRDETVLRLNQLGKISDGEGFLERTFLSPASFRATDVIIGWMKD  93

Query  389  AGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKT  568
            AGL TW+DQMGN+HGR E  N + KALLIGSH+DTVIDAG +DG+LGII AISALKVL+ 
Sbjct  94   AGLTTWVDQMGNIHGRFEPSNSTEKALLIGSHMDTVIDAGMYDGALGIICAISALKVLRV  153

Query  569  TGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            TG+L++L++PVEVIAFSDEEGVRFQ+TFLGSA
Sbjct  154  TGKLQRLTRPVEVIAFSDEEGVRFQTTFLGSA  185



>ref|XP_006657227.1| PREDICTED: probable allantoate deiminase-like [Oryza brachyantha]
Length=689

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELG +SD + YLERTF SPAS+RA  +I SWM+DAGL TW+DQMG
Sbjct  52   LYREILRDETVLRLKELGMISDGEGYLERTFLSPASIRASAVIISWMKDAGLTTWVDQMG  111

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + +ALLIGSH+DTVIDAG +DGSLGII+AISALKV K TG+L+++++PV
Sbjct  112  NIHGRFEPANSTSEALLIGSHMDTVIDAGMYDGSLGIISAISALKVFKVTGKLQRITRPV  171

Query  602  EVIAFSDEEGVRFQSTFLGSA  664
            EVIAFSDEEGVRFQ+TFLGSA
Sbjct  172  EVIAFSDEEGVRFQTTFLGSA  192



>gb|KDO77269.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=275

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAGNLIR WMEDAGLRTW+D +GNVHGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGNLIRQWMEDAGLRTWVDHLGNVHGRVEGLNASAQALLIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGIITAISALKVLK+TG+L KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIITAISALKVLKSTGKLGKLKRPVEVIAFSDEEGVRFQSTFLGSA  110



>gb|KDO77268.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=286

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAGNLIR WMEDAGLRTW+D +GNVHGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGNLIRQWMEDAGLRTWVDHLGNVHGRVEGLNASAQALLIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGIITAISALKVLK+TG+L KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIITAISALKVLKSTGKLGKLKRPVEVIAFSDEEGVRFQSTFLGSA  110



>gb|KDO77270.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=291

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAGNLIR WMEDAGLRTW+D +GNVHGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGNLIRQWMEDAGLRTWVDHLGNVHGRVEGLNASAQALLIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGIITAISALKVLK+TG+L KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIITAISALKVLKSTGKLGKLKRPVEVIAFSDEEGVRFQSTFLGSA  110



>gb|KDO77266.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=366

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAGNLIR WMEDAGLRTW+D +GNVHGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGNLIRQWMEDAGLRTWVDHLGNVHGRVEGLNASAQALLIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGIITAISALKVLK+TG+L KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIITAISALKVLKSTGKLGKLKRPVEVIAFSDEEGVRFQSTFLGSA  110



>gb|KDO77267.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=381

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAGNLIR WMEDAGLRTW+D +GNVHGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGNLIRQWMEDAGLRTWVDHLGNVHGRVEGLNASAQALLIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGIITAISALKVLK+TG+L KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIITAISALKVLKSTGKLGKLKRPVEVIAFSDEEGVRFQSTFLGSA  110



>gb|KDO77263.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
 gb|KDO77264.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=408

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAGNLIR WMEDAGLRTW+D +GNVHGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGNLIRQWMEDAGLRTWVDHLGNVHGRVEGLNASAQALLIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGIITAISALKVLK+TG+L KL +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIITAISALKVLKSTGKLGKLKRPVEVIAFSDEEGVRFQSTFLGSA  110



>gb|EMT22145.1| Allantoate deiminase, chloroplastic [Aegilops tauschii]
Length=524

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 122/163 (75%), Gaps = 22/163 (13%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L+ +IL++E V RL ELGK+SD + +LERTF SPAS RA ++I SWM+DAGL TW+DQMG
Sbjct  39   LYREILRDETVLRLKELGKISDGEGFLERTFLSPASFRATDVIISWMKDAGLTTWVDQMG  98

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPV  601
            N+HGR E  N + KALLIGSH+DTVIDAG +DG+LGII AISALKVL+ TG+L++L++PV
Sbjct  99   NIHGRFEPSNSTDKALLIGSHMDTVIDAGMYDGALGIICAISALKVLRVTGKLQRLTRPV  158

Query  602  E----------------------VIAFSDEEGVRFQSTFLGSA  664
            E                      VIAFSDEEGVRFQ+TFLGSA
Sbjct  159  EDSVLVSLQSVSWLREPLSYCSQVIAFSDEEGVRFQTTFLGSA  201



>ref|XP_004487908.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=423

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  296  KVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLI  475
            +VSDA++YLERTF SPAS+RA +L + WMEDAGLRTW+DQMGNVHGR++G+N + +ALL+
Sbjct  4    QVSDANDYLERTFLSPASMRAIHLTQKWMEDAGLRTWVDQMGNVHGRVDGVNANTEALLV  63

Query  476  GSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFL  655
            GSHLDTV+DAG FDGSLGI++AISALKV+   G+L+KL +PVEVIAF +EEGVRFQ+TFL
Sbjct  64   GSHLDTVVDAGKFDGSLGIVSAISALKVMHVHGKLQKLRRPVEVIAFCEEEGVRFQTTFL  123

Query  656  GS  661
            GS
Sbjct  124  GS  125



>ref|XP_004487909.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X3 
[Cicer arietinum]
Length=420

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  299  VSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIG  478
            VSDA++YLERTF SPAS+RA +L + WMEDAGLRTW+DQMGNVHGR++G+N + +ALL+G
Sbjct  2    VSDANDYLERTFLSPASMRAIHLTQKWMEDAGLRTWVDQMGNVHGRVDGVNANTEALLVG  61

Query  479  SHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLG  658
            SHLDTV+DAG FDGSLGI++AISALKV+   G+L+KL +PVEVIAF +EEGVRFQ+TFLG
Sbjct  62   SHLDTVVDAGKFDGSLGIVSAISALKVMHVHGKLQKLRRPVEVIAFCEEEGVRFQTTFLG  121

Query  659  S  661
            S
Sbjct  122  S  122



>ref|XP_011652398.1| PREDICTED: allantoate deiminase isoform X2 [Cucumis sativus]
Length=421

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  299  VSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIG  478
            VSDA  YLERTF SPAS++A  L++ WMEDAGLRTW+D MGN+HGR EG N S +ALLIG
Sbjct  2    VSDAARYLERTFLSPASIKASFLLQKWMEDAGLRTWVDCMGNLHGRTEGRNASAEALLIG  61

Query  479  SHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLG  658
            SHLDTV+DAG FDG+LGII+AISALKVL   G+LE+L +P+EVIAFSDEEGVRFQSTFLG
Sbjct  62   SHLDTVVDAGKFDGALGIISAISALKVLNMNGKLEELKRPIEVIAFSDEEGVRFQSTFLG  121

Query  659  SA  664
            SA
Sbjct  122  SA  123



>ref|XP_002986766.1| hypothetical protein SELMODRAFT_182622 [Selaginella moellendorffii]
 gb|EFJ12096.1| hypothetical protein SELMODRAFT_182622 [Selaginella moellendorffii]
Length=494

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            + L++EAV+RL +LGK SD+  +LERTF SPA++RAG L++ WM+DAGL TW+D +GN+H
Sbjct  53   KTLRDEAVARLNQLGKTSDSKEFLERTFLSPAAIRAGKLVQEWMQDAGLSTWMDDIGNIH  112

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR +G N S  ALL+GSHLDTVIDAG +DG+LGI++AI+A+K+L + G+L    +P+E+I
Sbjct  113  GRADGANASAPALLMGSHLDTVIDAGKYDGALGIVSAIAAVKMLNSNGKLRSYVRPIEII  172

Query  611  AFSDEEGVRFQSTFLGSA  664
            AF DEEGVRFQSTFLGSA
Sbjct  173  AFCDEEGVRFQSTFLGSA  190



>ref|XP_002969520.1| hypothetical protein SELMODRAFT_91525 [Selaginella moellendorffii]
 gb|EFJ29608.1| hypothetical protein SELMODRAFT_91525 [Selaginella moellendorffii]
Length=494

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            + L++EAV+RL +LGK SD+  +LERTF SPA++RAG L++ WM+DAGL TW+D +GN+H
Sbjct  53   KTLRDEAVARLNQLGKTSDSKEFLERTFLSPAAIRAGKLVQEWMQDAGLDTWMDDIGNIH  112

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR +G N S  ALL+GSHLDTVIDAG +DG+LGI++AI+A+K+L + G+L    +P+E+I
Sbjct  113  GRADGANASAPALLMGSHLDTVIDAGKYDGALGIVSAIAAVKMLNSNGKLRSYVRPIEII  172

Query  611  AFSDEEGVRFQSTFLGSA  664
            AF DEEGVRFQSTFLGSA
Sbjct  173  AFCDEEGVRFQSTFLGSA  190



>ref|XP_010051828.1| PREDICTED: allantoate deiminase isoform X2 [Eucalyptus grandis]
 gb|KCW75655.1| hypothetical protein EUGRSUZ_D00017 [Eucalyptus grandis]
Length=409

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAGNLIR WMEDAGLRTWIDQMGNVHGR++GIN S KA+LIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGNLIRGWMEDAGLRTWIDQMGNVHGRVDGINASSKAILIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLG+++AISALKVL   G+L  L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGVVSAISALKVLNARGKLGNLLRPVEVIAFSDEEGVRFQSTFLGSA  110



>gb|KJB48032.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=408

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRAG LIR WMEDAGLRTW+D MGN+HGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAGFLIREWMEDAGLRTWVDSMGNLHGRVEGMNASAQALLIGSHLDTVVDAGMFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGII+AISALKVLK+ G+L +L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIISAISALKVLKSIGKLGELKRPVEVIAFSDEEGVRFQSTFLGSA  110



>ref|XP_011035488.1| PREDICTED: allantoate deiminase isoform X3 [Populus euphratica]
Length=408

 Score =   186 bits (472),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  338  SPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFD  517
            SPASVRA NLIR+WMEDAGL TW+D MGNVHGR+EG+N S +ALLIGSHLDTV+DAG FD
Sbjct  2    SPASVRAANLIRAWMEDAGLTTWVDYMGNVHGRVEGLNASAEALLIGSHLDTVVDAGIFD  61

Query  518  GSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            GSLGII+AISALKVLK+ G L  L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  62   GSLGIISAISALKVLKSNGTLTNLIRPVEVIAFSDEEGVRFQSTFLGSA  110



>ref|XP_001751276.1| predicted protein [Physcomitrella patens]
 gb|EDQ83593.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +2

Query  254  ILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHG  433
            IL++E  +RL ELG VSD+ + LERTF SPA++ AG L+ SWM DAGLRTW D++GNVHG
Sbjct  6    ILRDEVAARLKELGNVSDSRHVLERTFLSPAALAAGRLLASWMRDAGLRTWEDELGNVHG  65

Query  434  RIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIA  613
            R +G N +  ALL+GSHLDTVIDAG +DG+LGI+TAI+A+KVLK  G+L++  +P+E+IA
Sbjct  66   RSDGANATAPALLLGSHLDTVIDAGKYDGALGIVTAIAAVKVLKIEGKLQQFPRPIEIIA  125

Query  614  FSDEEGVRFQSTFLGSA  664
            FSDEEG+RFQ+TFLGS+
Sbjct  126  FSDEEGIRFQTTFLGSS  142



>ref|XP_001783993.1| predicted protein [Physcomitrella patens]
 gb|EDQ51218.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
             IL++E  +RL ELG VSD+ + L+RTF SPA++ AG L+  WM+DAGLRTW D++GNVH
Sbjct  5    NILRDEVTARLKELGNVSDSKDVLQRTFLSPAALAAGRLLAVWMKDAGLRTWEDELGNVH  64

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR +G N +  ALL+GSH+DTVIDAG +DG+LGI+TAI+A+KVLK  G+L +  +P+E+I
Sbjct  65   GRSDGANATAPALLLGSHMDTVIDAGRYDGALGIVTAIAAVKVLKVEGKLHQFPRPIEII  124

Query  611  AFSDEEGVRFQSTFLGSA  664
            AFSDEEG+RFQ+TFLGS+
Sbjct  125  AFSDEEGIRFQTTFLGSS  142



>ref|XP_006586949.1| PREDICTED: allantoate deiminase-like isoform X2 [Glycine max]
Length=403

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  350  VRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLG  529
            +RA NLIR WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLG
Sbjct  1    MRAINLIRKWMEDAGLRTWVDQMGNVHGRVDGANANAEALLIGSHMDTVVDAGMFDGSLG  60

Query  530  IITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            I++AISALK +   G+L+KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  61   IVSAISALKAMHVNGKLQKLKRPVEVIAFSDEEGVRFQTTFLGS  104



>ref|XP_006596931.1| PREDICTED: allantoate amidohydrolase isoform X1 [Glycine max]
Length=403

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  350  VRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLG  529
            ++A +LIR WMEDAGLRTW+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLG
Sbjct  1    MKAIDLIRKWMEDAGLRTWVDQMGNVHGRVDGANENAEALLIGSHMDTVVDAGMFDGSLG  60

Query  530  IITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            I++AISA+K +   G+L+KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  61   IVSAISAVKAMHVNGKLQKLKRPVEVIAFSDEEGVRFQTTFLGS  104



>ref|XP_009408250.1| PREDICTED: probable allantoate deiminase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            M DAGLRTW+DQMGNVHGR E +N + + LLIGSH DTV+DAG FDGSLGII AISALKV
Sbjct  1    MRDAGLRTWVDQMGNVHGRSEALNTTAETLLIGSHADTVVDAGKFDGSLGIICAISALKV  60

Query  560  LKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            LKT G+L KLS+PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  61   LKTNGKLHKLSRPVEVIAFSDEEGVRFQSTFLGSA  95



>gb|AFK37421.1| unknown [Lotus japonicus]
Length=393

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            MEDAGLRTW+DQMGNVHGR+EG N + +ALL+GSH+DTV+DAG FDGSLGII+AISALKV
Sbjct  1    MEDAGLRTWVDQMGNVHGRVEGPNANAEALLLGSHMDTVVDAGKFDGSLGIISAISALKV  60

Query  560  LKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +   G+L+KL +PVEVIAF DEEGVRFQSTFLGS
Sbjct  61   MHDNGKLQKLRRPVEVIAFCDEEGVRFQSTFLGS  94



>gb|KEH37361.1| allantoate amidohydrolase [Medicago truncatula]
Length=392

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            MEDAGLRTW+DQMGNVHGR+EG N + +ALL+GSH+DTV+DAG FDG+LGI++AISALKV
Sbjct  1    MEDAGLRTWVDQMGNVHGRVEGANANAEALLVGSHMDTVVDAGKFDGALGIVSAISALKV  60

Query  560  LKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +   G+L+ L++PVEVIAF DEEGVRFQ+TFLGS
Sbjct  61   MHVNGKLQNLTRPVEVIAFCDEEGVRFQTTFLGS  94



>pir||T04891 hyuC protein homolog F18F4.170 - Arabidopsis thaliana  (fragment)
Length=338

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 87/114 (76%), Gaps = 16/114 (14%)
 Frame = +2

Query  323  ERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVID  502
            ERTF SPAS+RA  LIR WMEDAGL TW+D MGNVHGR+E  N S +ALLIGSH+DTVID
Sbjct  1    ERTFMSPASIRAIPLIRGWMEDAGLSTWVDYMGNVHGRVEPKNGSSQALLIGSHMDTVID  60

Query  503  AGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            AG +DGSLGII+AISALK                VIAFSDEEGVRFQSTFLGSA
Sbjct  61   AGKYDGSLGIISAISALK----------------VIAFSDEEGVRFQSTFLGSA  98



>gb|ACN31546.1| unknown [Zea mays]
Length=415

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            M+DAGL TW+DQMGN+HGR E  N +  ALLIGSH+DTV+DAG +DG+LGII+AISALKV
Sbjct  1    MKDAGLTTWVDQMGNIHGRYEPANSTRDALLIGSHMDTVVDAGMYDGALGIISAISALKV  60

Query  560  LKTTGRLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            LK TG+L++L++PVEVIAFSDEEG+RFQ+TFLGSA
Sbjct  61   LKVTGKLQRLTRPVEVIAFSDEEGIRFQTTFLGSA  95



>ref|XP_007138853.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
 gb|ESW10847.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
Length=391

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W+DQMGNVHGR++G N + +ALLIGSH+DTV+DAG FDGSLGI++AISALK +   G+LE
Sbjct  7    WVDQMGNVHGRVDGANANAEALLIGSHMDTVVDAGMFDGSLGIVSAISALKAMHFNGKLE  66

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            KL +PVEVIAFSDEEGVRFQ+TFLGS
Sbjct  67   KLKRPVEVIAFSDEEGVRFQTTFLGS  92



>ref|XP_005647336.1| amidase [Coccomyxa subellipsoidea C-169]
 gb|EIE22792.1| amidase [Coccomyxa subellipsoidea C-169]
Length=556

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 102/169 (60%), Gaps = 29/169 (17%)
 Frame = +2

Query  242  LFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMG  421
            L   +L  E   R+  LGK+SDA+  L R F SPA +RA + IR WM+DAG+RTW D +G
Sbjct  45   LLQDVLYREPAERIQLLGKISDAEGSLYRRFFSPAHIRAASQIRRWMKDAGMRTWQDGVG  104

Query  422  NVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALK---------------  556
            NVHGRI+G      AL+ GSH DTV+DAG +DG+LGII AI+++K               
Sbjct  105  NVHGRIDGRARDAPALISGSHYDTVMDAGKYDGALGIIVAIASVKATILQAALATRIMTP  164

Query  557  -----VLKTTGRLEK---------LSKPVEVIAFSDEEGVRFQSTFLGS  661
                  ++ +  L +          + P+E+IAFSDEEGVRFQ+TFLGS
Sbjct  165  EEVRAAVRESADLGQWLGAKAHNLFATPMEIIAFSDEEGVRFQTTFLGS  213



>ref|XP_002507571.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68829.1| predicted protein [Micromonas sp. RCC299]
Length=479

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 100/141 (71%), Gaps = 4/141 (3%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDA-DNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNV  427
            + +  EA +RL  LG++SDA D  L+RTF S  S RA   + +WM  AGL TW+D++GNV
Sbjct  26   EAVDHEAWNRLQILGRISDAQDGTLQRTFLSLGSRRAMATVENWMIRAGLDTWVDEIGNV  85

Query  428  HGRIEGINPSG-KALLIGSHLDTVIDAGYFDGSLGIITAISALK--VLKTTGRLEKLSKP  598
            HGRIEG    G K LL GSHLDTV DAG +DG+LGI+  ++A+K  VL++   +E +   
Sbjct  86   HGRIEGAGCVGHKVLLFGSHLDTVKDAGKYDGALGILVGLAAVKALVLESITEMEPVPCS  145

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            ++++AFSDEEGVRF STFLGS
Sbjct  146  LQLVAFSDEEGVRFSSTFLGS  166



>ref|WP_027135007.1| allantoate amidohydrolase [Geminicoccus roseus]
Length=414

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +  ++RL +LG++S  D  L R   +PA   A +L+R+WM +AG+ T +D +GN+ GR
Sbjct  6    LGQVLMARLDQLGRISADDGRLNRQPFTPAHRAAIDLVRTWMHEAGMTTRVDPIGNLIGR  65

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG +PS   +++GSH+DTV+DAG +DG LGI+  ++A+  L   G  E+L  PVEV AF
Sbjct  66   YEGADPSAPVMMLGSHIDTVVDAGRYDGPLGILVGVAAVGALNEAG--ERLPFPVEVAAF  123

Query  617  SDEEGVRFQSTFLGS  661
             DEEGVRF +TFLGS
Sbjct  124  CDEEGVRFSTTFLGS  138



>ref|XP_006413901.1| hypothetical protein EUTSA_v10025370mg [Eutrema salsugineum]
 gb|ESQ55354.1| hypothetical protein EUTSA_v10025370mg [Eutrema salsugineum]
Length=400

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  395  LRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTG  574
            ++ +   MGNVHGR++  N S +ALLIGSH+DTVIDAG +DGSLGII+AISALKVLK  G
Sbjct  1    MQVYQHYMGNVHGRVDPKNGSTQALLIGSHMDTVIDAGKYDGSLGIISAISALKVLKING  60

Query  575  RLEKLSKPVEVIAFSDEEGVRFQSTFLGSA  664
            +L +L +PVEVIAFSDEEGVRFQSTFLGSA
Sbjct  61   KLGELKRPVEVIAFSDEEGVRFQSTFLGSA  90



>emb|CAN83127.1| hypothetical protein VITISV_029535 [Vitis vinifera]
Length=321

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  380  MEDAGLRTWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKV  559
            MEDAGLRTW+DQMGNVHGR+EG+NPS  ALLIGSHLDTV+DAG FDGSLGII+AIS LKV
Sbjct  1    MEDAGLRTWMDQMGNVHGRVEGMNPSADALLIGSHLDTVVDAGIFDGSLGIISAISVLKV  60

Query  560  LKTTGRLEKLSKPVEV  607
            L  T +L+KL +P+EV
Sbjct  61   LNITAKLQKLRRPIEV  76



>ref|XP_007510519.1| allantoate amidohydrolase [Bathycoccus prasinos]
 emb|CCO18052.1| allantoate amidohydrolase [Bathycoccus prasinos]
Length=787

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 93/147 (63%), Gaps = 12/147 (8%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
             +L+++ V RL  LG  SDA  +LER F S AS+ A + I+ WM DAGLR + D  GN+H
Sbjct  255  HVLEDQPVRRLNVLGTFSDAAGHLERQFLSKASMEAHSKIKEWMADAGLRVFTDAAGNIH  314

Query  431  GRIEGINPSG----------KALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRL  580
            G ++   P            K + +GSHLDTVID G FDG+LG++ AI+A K L+ T  +
Sbjct  315  GVLDATTPPSLDEHGEKMIRKEMFVGSHLDTVIDGGMFDGALGVVVAIAATKALRRTNPV  374

Query  581  EKLSKPVEVIAFSDEEGVRFQSTFLGS  661
             + +  + +I FSDEEGVRF STFLGS
Sbjct  375  REYN--IHIIGFSDEEGVRFGSTFLGS  399



>ref|WP_043197023.1| allantoate amidohydrolase [Bradyrhizobium sp. URHA0002]
Length=424

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 89/141 (63%), Gaps = 2/141 (1%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            +L P  L +E V R+  LG +S+   +L R F SP    A +LI SWM DAG+   +D +
Sbjct  10   ELKPSSLGDEIVGRIDRLGAISETPEHLARVFLSPEHRIAADLILSWMRDAGMSARLDAI  69

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GNV GR EG  P    L++GSH DTV DAG +DG LG+ITAIS +  L   G+  +L   
Sbjct  70   GNVCGRYEGERPGLPCLMLGSHYDTVRDAGKWDGPLGVITAISCVADLDKRGK--RLPFA  127

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +EV+ F+DEEGVRF ST LGS
Sbjct  128  IEVVGFADEEGVRFASTLLGS  148



>ref|WP_035690370.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=422

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 94/147 (64%), Gaps = 6/147 (4%)
 Frame = +2

Query  221  GVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLR  400
            G GT+    P +L EE V+R+ +L  +S+A ++L R + +P   +A +L+ SWM +AG+ 
Sbjct  8    GAGTR----PTLLGEEIVARIDQLAAISEAPSHLARIYLTPQHRKAADLLLSWMREAGMS  63

Query  401  TWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRL  580
              +D +GNV GR E   P    L++GSH DTV DAG +DG LG+ITAIS +  L   GR 
Sbjct  64   AHLDAIGNVCGRYEAATPGLPCLMLGSHYDTVRDAGKWDGPLGLITAISCVADLNRRGR-  122

Query  581  EKLSKPVEVIAFSDEEGVRFQSTFLGS  661
             +L   +EV  F+DEEGVRF ST LGS
Sbjct  123  -RLPFAIEVTGFADEEGVRFASTLLGS  148



>ref|WP_035726587.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=407

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 89/136 (65%), Gaps = 2/136 (1%)
 Frame = +2

Query  254  ILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHG  433
            +L +E VSR+ +LG +S+  ++L R F SP    A +LI SWM DAG+   +D +GNV G
Sbjct  1    MLGDEIVSRINQLGMISETPDHLARIFLSPEHRTAADLILSWMRDAGMEAHLDAIGNVCG  60

Query  434  RIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIA  613
            R EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G   +L   +E++ 
Sbjct  61   RYEGDRPGLSCLMLGSHYDTVRDAGKWDGPLGVITAIACVTDLNRRG--VRLPFAIEIVG  118

Query  614  FSDEEGVRFQSTFLGS  661
            F+DEEGVRF ST LGS
Sbjct  119  FADEEGVRFASTLLGS  134



>ref|WP_012442327.1| allantoate amidohydrolase [Erwinia tasmaniensis]
 emb|CAO97662.1| N-carbamoyl-L-amino acid hydrolase [Erwinia tasmaniensis Et1/99]
Length=419

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            +  ++R   L ++S+   YL R + SP  +RA  L+  WM+ AG++ W D +GN+ GR E
Sbjct  16   DRVMARCDALAEISETPQYLTRVYLSPEHLRANALVAKWMQAAGMQVWQDGVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G  P  KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   +E+I F+D
Sbjct  76   GQRPDAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLAIEIIGFAD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_038388099.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=423

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 91/144 (63%), Gaps = 2/144 (1%)
 Frame = +2

Query  230  TKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWI  409
            TK    P  L EE V+R+ +L  +S+   +L R F +    +A +LI SWM +AG+   +
Sbjct  4    TKPSSKPSSLGEEIVARINQLATISETPEHLARIFLTDEHRKAADLILSWMREAGMSAHL  63

Query  410  DQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKL  589
            D +GNV GR EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   GR  +L
Sbjct  64   DAIGNVCGRYEGERPGLPALMLGSHYDTVRDAGRWDGPLGVITAIACIADLNRRGR--RL  121

Query  590  SKPVEVIAFSDEEGVRFQSTFLGS  661
               +E++ F+DEEGVRF ST LGS
Sbjct  122  PFAIEIVGFADEEGVRFASTLLGS  145



>ref|WP_012668989.1| allantoate amidohydrolase [Erwinia pyrifoliae]
 emb|CAX56519.1| N-carbamoyl-L-amino acid hydrolase [Erwinia pyrifoliae Ep1/96]
Length=419

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            +  ++R   L ++S+   YL R + SP  +RA  L+  WM+ AG++ W D +GN+ GR E
Sbjct  16   DRVMARCDALAEISETPQYLTRVYLSPEHLRANALVGKWMQAAGMQVWQDGVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G  P  KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   +E+I F+D
Sbjct  76   GQRPEAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLAIEIIGFAD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_014543524.1| allantoate amidohydrolase [Erwinia sp. Ejp617]
 gb|ADP11676.1| allantoate amidohydrolase [Erwinia sp. Ejp617]
Length=419

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            +  ++R   L ++S+   YL R + SP  +RA  L+  WM+ AG++ W D +GN+ GR E
Sbjct  16   DRVMARCDALAEISETPQYLTRVYLSPEHLRANALVGKWMQAAGMQVWQDGVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G  P  KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   +E+I F+D
Sbjct  76   GQRPDAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLAIEIIGFAD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_028339443.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=423

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 91/144 (63%), Gaps = 2/144 (1%)
 Frame = +2

Query  230  TKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWI  409
            TK    P  L EE V+R+ +L  +S+   +L R F +    +A +LI SWM +AG+   +
Sbjct  4    TKPSSKPSSLGEEIVARIDQLATISETPEHLARVFLTDEHRKAADLILSWMREAGMSAHL  63

Query  410  DQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKL  589
            D +GNV GR EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   GR  +L
Sbjct  64   DAIGNVCGRYEGERPGLPALMLGSHYDTVRDAGRWDGPLGVITAIACVADLNRRGR--RL  121

Query  590  SKPVEVIAFSDEEGVRFQSTFLGS  661
               +E++ F+DEEGVRF ST LGS
Sbjct  122  PFAIEIVGFADEEGVRFASTLLGS  145



>emb|CAY75357.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia pyrifoliae 
DSM 12163]
Length=457

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            +  ++R   L ++S+   YL R + SP  +RA  L+  WM+ AG++ W D +GN+ GR E
Sbjct  54   DRVMARCDALAEISETPQYLTRVYLSPEHLRANALVGKWMQAAGMQVWQDGVGNICGRYE  113

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G  P  KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   +E+I F+D
Sbjct  114  GQRPEAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLAIEIIGFAD  171

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  172  EEGTRFGITLLGS  184



>ref|WP_024580744.1| MULTISPECIES: allantoate amidohydrolase [Bradyrhizobium]
 gb|KIU46337.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=420

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 88/138 (64%), Gaps = 2/138 (1%)
 Frame = +2

Query  248  PQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNV  427
            P     E V+R+ +L  +S+   +L R F +P   +A +LI SWM +AG+   +D +GNV
Sbjct  10   PSAFGAEIVARIDQLAAISETSEHLARVFLTPEHRKAADLILSWMREAGMSAHLDAIGNV  69

Query  428  HGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEV  607
             GR EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   GR  +L   +E+
Sbjct  70   CGRYEGERPGLPALVLGSHYDTVRDAGRWDGPLGVITAIACVADLNRRGR--RLPFAIEI  127

Query  608  IAFSDEEGVRFQSTFLGS  661
            + F+DEEGVRF ST LGS
Sbjct  128  VGFADEEGVRFASTLLGS  145



>ref|WP_023654116.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia piriflorinigrans]
 emb|CCG86298.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia piriflorinigrans 
CFBP 5888]
Length=419

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 86/141 (61%), Gaps = 2/141 (1%)
 Frame = +2

Query  239  DLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            D       E  ++R   L ++S+   YL R + SP  +RA  L+  WM+ AG++ W D +
Sbjct  8    DQMASAAAERVMARCDALAEISETPEYLTRVYLSPEHLRANALVGKWMQAAGMQVWQDGV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG     KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   
Sbjct  68   GNICGRYEGQRSEAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E+I F+DEEG RF  T LGS
Sbjct  126  IEIIGFADEEGTRFGITLLGS  146



>ref|WP_004156077.1| allantoate amidohydrolase [Erwinia amylovora]
 emb|CBJ45552.1| putative peptidase/hydantoinase/carbamoylase [Erwinia amylovora 
ATCC 49946]
 emb|CBA19815.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
CFBP1430]
 gb|EKV53574.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
ACW56400]
 emb|CCO77718.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
Ea356]
 emb|CCO81503.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
Ea266]
 emb|CCO85305.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
CFBP 2585]
 emb|CCO89090.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
01SFR-BO]
 emb|CCO92847.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
CFBP 1232]
 emb|CCO98200.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
UPN527]
 emb|CDK14436.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
LA635]
 emb|CDK17803.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
LA636]
 emb|CDK21172.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
LA637]
 dbj|GAJ88466.1| N-carbamoyl-L-amino acid hydrolase [Erwinia amylovora NBRC 12687]
Length=419

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R   L ++S++ + L R + SP  +RA  L+  WM+ AG++ W D +GN+ GR EG  
Sbjct  19   MARCDALAEISESPHDLTRVYLSPEHLRANALVAKWMQAAGMQVWQDGVGNICGRYEGQR  78

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P  KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   +EVI F+DEEG
Sbjct  79   PEAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLAIEVIGFADEEG  136

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  137  TRFGITLLGS  146



>ref|WP_004168865.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora]
 emb|CCP02231.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
Ea644]
 emb|CCP06254.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
MR1]
Length=419

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R   L ++S++ + L R + SP  +RA  L+  WM+ AG++ W D +GN+ GR EG  
Sbjct  19   MARCDALAEISESPHDLTRVYLSPEHLRANALVAKWMQAAGMQVWQDGVGNICGRYEGQR  78

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P  KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   +EVI F+DEEG
Sbjct  79   PEAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLAIEVIGFADEEG  136

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  137  TRFGITLLGS  146



>emb|CBX79715.1| putative N-carbamyl-L-amino acid amidohydrolase [Erwinia amylovora 
ATCC BAA-2158]
Length=419

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R   L ++S++ + L R + SP  +RA  L+  WM+ AG++ W D +GN+ GR EG  
Sbjct  19   MARCDALAEISESPHDLTRVYLSPEHLRANALVAKWMQAAGMQVWQDGVGNICGRYEGQR  78

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P  KALL+GSHLDTV +AG +DG LG++ AI A++ L   G  E+L   +EVI F+DEEG
Sbjct  79   PEAKALLLGSHLDTVRNAGRYDGMLGVLAAIEAVQFLHDRG--ERLPLAIEVIGFADEEG  136

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  137  TRFGITLLGS  146



>ref|WP_021017468.1| amidase, hydantoinase/carbamoylase family [Serratia sp. ATCC 
39006]
 gb|ESN61183.1| N-carbamoyl-L-amino-acid hydrolase [Serratia sp. ATCC 39006]
Length=417

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  ++ +SR   L ++S+    L R + SP  +RA   +  WM DAG+R W D +GN+ 
Sbjct  12   QVAAQQVMSRCDSLAEISETAGQLTRVYLSPEHLRANQQVGEWMRDAGMRVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++ L    R  +L   +E++
Sbjct  72   GRYEGVVPGAPALLLGSHLDTVRNAGRYDGMLGVLTAIETVRYLYQ--REIRLPVALEIV  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_025037671.1| allantoate amidohydrolase [Bradyrhizobium sp. DOA9]
 dbj|GAJ36751.1| N-carbamoyl-L-amino acid hydrolase [Bradyrhizobium sp. DOA9]
Length=418

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 89/147 (61%), Gaps = 5/147 (3%)
 Frame = +2

Query  221  GVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLR  400
            G GT ++     L  E V R+ ELG +S+    L R F S    +A +LI  WM +AG+ 
Sbjct  2    GAGTVHEAS---LGNEIVRRINELGAISEEPEKLTRIFLSKELRKAADLIMGWMREAGMS  58

Query  401  TWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRL  580
              +D +GNV GR EG  P    L++GSH DTV DAG +DG LG+ITAIS +  L   G+ 
Sbjct  59   AHLDAIGNVRGRYEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAISCVADLNRRGK-  117

Query  581  EKLSKPVEVIAFSDEEGVRFQSTFLGS  661
             +L   +EVI F+DEEGVRF ST LGS
Sbjct  118  -RLPFAIEVIGFADEEGVRFASTLLGS  143



>ref|WP_036045330.1| allantoate amidohydrolase [Bradyrhizobium yuanmingense]
Length=418

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 89/147 (61%), Gaps = 5/147 (3%)
 Frame = +2

Query  221  GVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLR  400
            G GT +D     L  E V R+ ELG +S+    L R F S    +A +LI  WM +AG+ 
Sbjct  2    GAGTVHDAS---LGNEIVRRINELGAISEEPEKLTRIFLSKELRKAADLIMGWMREAGMS  58

Query  401  TWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRL  580
              +D +GNV GR EG  P    L++GSH DTV DAG +DG LG+ITAIS +  L   G+ 
Sbjct  59   AHLDAIGNVCGRYEGDRPGMPCLMLGSHYDTVRDAGKWDGPLGVITAISCVADLNRRGK-  117

Query  581  EKLSKPVEVIAFSDEEGVRFQSTFLGS  661
             +L   +EVI F+DEEGVRF ST LGS
Sbjct  118  -RLPFAIEVIGFADEEGVRFASTLLGS  143



>ref|WP_044538498.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSP885]
 gb|KJC46842.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSP885]
Length=418

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 87/135 (64%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +E V+R+ +LG +S+   +L R F +P    A +LI SWM +AG+   +D +GNV GR
Sbjct  12   LGDEIVARIGQLGAISETPEHLARIFLTPEHREAADLILSWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   VE+  F
Sbjct  72   YEGDRPGLPCLMLGSHYDTVRDAGRWDGPLGVITAIACVADLNRRGK--RLPFAVEIAGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_027579451.1| allantoate amidohydrolase [Bradyrhizobium sp. Ai1a-2]
Length=425

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 6/147 (4%)
 Frame = +2

Query  221  GVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLR  400
            G GT+    P +L E  V+R+  L  +S+   +L R + +P   +A +L+ SWM +AG+ 
Sbjct  8    GAGTR----PTLLGEAIVARIDLLAAISETPEHLARIYLTPEHRKAADLLLSWMREAGMS  63

Query  401  TWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRL  580
              +D +GNV GR EG  P    L++GSH DTV DAG +DG LG+ITAIS +  L   GR 
Sbjct  64   AHLDAIGNVCGRYEGDRPGLPCLMLGSHYDTVRDAGKWDGPLGLITAISCVADLNRRGR-  122

Query  581  EKLSKPVEVIAFSDEEGVRFQSTFLGS  661
             +L   +EV  F+DEEGVRF ST LGS
Sbjct  123  -RLPFAIEVTGFADEEGVRFASTLLGS  148



>ref|WP_024511318.1| allantoate amidohydrolase [Bradyrhizobium sp. ARR65]
Length=422

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            V+R+ EL ++S++ + L R F S     A  LI  WM  AG+R  +D +GNV GR EGI+
Sbjct  18   VARINELARISESADKLTRIFLSREHRAASELILGWMRAAGMRAHLDAIGNVCGRYEGIS  77

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P    L++GSH DTV DAG +DG LG+ITAIS +  L   GR  +L   +EVI F+DEEG
Sbjct  78   PGLPCLMLGSHYDTVRDAGKWDGPLGLITAISCVADLNKRGR--RLPLAIEVIGFADEEG  135

Query  632  VRFQSTFLGS  661
            VRF ST LGS
Sbjct  136  VRFASTLLGS  145



>ref|WP_044587468.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSPM299]
 gb|KJC60861.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSPM299]
Length=419

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 88/135 (65%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +E V+R+ +LG +S+   +L R F +P   +A +LI SWM +AG+   +D +GNV GR
Sbjct  12   LGDEIVARIGQLGVISETPEHLARIFLTPEHGKAADLILSWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   VE+  F
Sbjct  72   YEGERPGLPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAVEIAGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>gb|ERF83069.1| hydantoinase/carbamoylase family amidase [Bradyrhizobium sp. 
DFCI-1]
Length=419

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 89/138 (64%), Gaps = 2/138 (1%)
 Frame = +2

Query  248  PQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNV  427
            P  L +E V+R+ +L  +S+   +L R F +    +A +LI SWM +AG+   +D +GNV
Sbjct  6    PSSLGDEIVARIDQLAAISETPEHLARIFLTEEHRKAADLILSWMREAGMSAHLDAIGNV  65

Query  428  HGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEV  607
             GR EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E+
Sbjct  66   CGRYEGERPGLPALMLGSHYDTVRDAGRWDGPLGVITAIACVADLNRRGK--RLPFAIEI  123

Query  608  IAFSDEEGVRFQSTFLGS  661
            + F+DEEGVRF ST LGS
Sbjct  124  VGFADEEGVRFASTLLGS  141



>ref|WP_035650405.1| allantoate amidohydrolase [Bradyrhizobium sp. DFCI-1]
Length=423

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 89/138 (64%), Gaps = 2/138 (1%)
 Frame = +2

Query  248  PQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNV  427
            P  L +E V+R+ +L  +S+   +L R F +    +A +LI SWM +AG+   +D +GNV
Sbjct  10   PSSLGDEIVARIDQLAAISETPEHLARIFLTEEHRKAADLILSWMREAGMSAHLDAIGNV  69

Query  428  HGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEV  607
             GR EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E+
Sbjct  70   CGRYEGERPGLPALMLGSHYDTVRDAGRWDGPLGVITAIACVADLNRRGK--RLPFAIEI  127

Query  608  IAFSDEEGVRFQSTFLGS  661
            + F+DEEGVRF ST LGS
Sbjct  128  VGFADEEGVRFASTLLGS  145



>ref|WP_029987811.1| MULTISPECIES: allantoate amidohydrolase, partial [Serratia]
Length=410

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R  EL  +S +   L R + SP  +RA  L+ +WM + G++ W D +GN+ GR EG  
Sbjct  14   MARCDELAAISSSPGQLTRVYLSPEHLRANQLVGNWMRELGMKVWQDGVGNICGRYEGTQ  73

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            PS  ALL+GSHLDTV +AG +DG LG++TA+  +  L +  R  +L + +EVI F+DEEG
Sbjct  74   PSAPALLLGSHLDTVRNAGRYDGMLGVLTALEVVAFLHS--RKRRLPQAIEVIGFADEEG  131

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  132  TRFGITLLGS  141



>ref|WP_028334435.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=423

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 88/135 (65%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V+R+ +L  +S+   +L R F +    +A +LI SW+ +AG+   +D +GNV GR
Sbjct  13   LGEEIVARIDQLASISETPEHLARIFLTDEHRKAADLILSWIREAGMSAHLDAIGNVCGR  72

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   GR  +L   +E++ F
Sbjct  73   YEGERPGQPALMLGSHYDTVRDAGRWDGPLGVITAIACVADLNRRGR--RLPFAIEIVGF  130

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  131  ADEEGVRFASTLLGS  145



>ref|WP_036007776.1| allantoate amidohydrolase [Bradyrhizobium yuanmingense]
Length=418

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 89/147 (61%), Gaps = 5/147 (3%)
 Frame = +2

Query  221  GVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLR  400
            G GT +D     L  E V R+ +LG +S+    L R F S    +A +LI  WM +AG+ 
Sbjct  2    GAGTVHDAS---LGNEIVRRINQLGAISEEPEKLTRIFLSKELRKAADLIMGWMREAGMS  58

Query  401  TWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRL  580
              +D +GNV GR EG  P    L++GSH DTV DAG +DG LG+ITAIS +  L   G+ 
Sbjct  59   AHLDAIGNVCGRYEGDRPDMPCLMLGSHYDTVRDAGKWDGPLGVITAISCVADLNRRGK-  117

Query  581  EKLSKPVEVIAFSDEEGVRFQSTFLGS  661
             +L   +EVI F+DEEGVRF ST LGS
Sbjct  118  -RLPFAIEVIGFADEEGVRFASTLLGS  143



>ref|WP_021181940.1| N-carbamoyl-L-amino acid hydrolase [Serratia fonticola]
 gb|ERK06127.1| N-carbamoyl-L-amino acid hydrolase [Serratia fonticola AU-P3(3)]
Length=416

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R  EL  +S     L R + SP  +RA  L+ +WM + G+  W D +GN+ GR EG+ 
Sbjct  18   MARCDELAAISSTPGQLTRVYLSPEHLRANQLVGNWMRELGMEVWQDGVGNICGRYEGLQ  77

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P+  ALL+GSHLDTV +AG +DG LG++TA+  + +L +  R  +L + +EVI F+DEEG
Sbjct  78   PAAPALLLGSHLDTVRNAGRYDGMLGVLTALEVVALLHSRNR--RLPQAIEVIGFADEEG  135

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  136  TRFGITLLGS  145



>ref|WP_032418944.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|EWF41009.1| allantoate deiminase [Klebsiella pneumoniae BWH 2]
Length=419

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D F Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTFRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|XP_011398581.1| Allantoate deiminase [Auxenochlorella protothecoides]
 gb|KFM25685.1| Allantoate deiminase [Auxenochlorella protothecoides]
Length=491

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 32/158 (20%)
 Frame = +2

Query  281  LYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSG  460
            L +LG VSD    L RT+ SPA  +A  L+++WM+ AG+ +W+D +GNVHGR+EG  P G
Sbjct  2    LQKLGAVSDDPAVLTRTYLSPAHRQAAQLLKAWMQAAGMDSWVDAIGNVHGRVEGSLP-G  60

Query  461  KALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEK------------------  586
             A   GSH DTV+D G +DG+LGII  I+A+K L     + +                  
Sbjct  61   PATFTGSHYDTVVDGGKYDGALGIIAGIAAVKALVLEAAVARGALTREEAARLPVDPALG  120

Query  587  -------------LSKPVEVIAFSDEEGVRFQSTFLGS  661
                         L + + V+ F+DEEGVRFQST+LGS
Sbjct  121  TTALPTTLNASALLRRSLRVVGFADEEGVRFQSTYLGS  158



>ref|WP_032452916.1| allantoate amidohydrolase, partial [Klebsiella sp. 18A069]
Length=321

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++TAI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLTAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_035976025.1| allantoate amidohydrolase [Bradyrhizobium sp. th.b2]
Length=423

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 87/138 (63%), Gaps = 2/138 (1%)
 Frame = +2

Query  248  PQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNV  427
            P  L +  V+R+ +L  +S+    L R F +    +A +LI SWM +AG+   +D +GNV
Sbjct  10   PSCLGDAIVARIDQLATISETPEQLARVFLTDEHRKAADLILSWMREAGMSAHLDAIGNV  69

Query  428  HGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEV  607
             GR EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   GR  +L   +E+
Sbjct  70   CGRYEGERPHLPALMLGSHYDTVRDAGRWDGPLGVITAIACVADLNRRGR--RLPFAIEI  127

Query  608  IAFSDEEGVRFQSTFLGS  661
            + F+DEEGVRF ST LGS
Sbjct  128  VGFADEEGVRFASTLLGS  145



>ref|WP_018270389.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=419

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 88/138 (64%), Gaps = 2/138 (1%)
 Frame = +2

Query  248  PQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNV  427
            P  L  E V+R+ +L  +S+   +L R F +    +A +LI SWM +AG+   +D +GNV
Sbjct  6    PSPLGGEIVARIDQLATISETPEHLARVFLTDEHRKAADLILSWMREAGMSAHLDAIGNV  65

Query  428  HGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEV  607
             GR EG  P   AL++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EV
Sbjct  66   CGRYEGERPGLPALMLGSHYDTVRDAGRWDGPLGVITAIACVADLDRRGK--RLPFAIEV  123

Query  608  IAFSDEEGVRFQSTFLGS  661
            + F+DEEGVRF ST LGS
Sbjct  124  VGFADEEGVRFASTLLGS  141



>ref|WP_018456684.1| allantoate amidohydrolase [Bradyrhizobium sp. WSM4349]
Length=419

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+ EL  +S+  + L R + +    +A +LI SWM DAG+   +D +GNV GR
Sbjct  12   LGEEIVRRINELAAISEEGDKLTRIYLTGELRKAADLILSWMRDAGMSARLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E++ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEIVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_008130275.1| allantoate amidohydrolase [Bradyrhizobium sp. YR681]
 gb|EJN15850.1| amidase, hydantoinase/carbamoylase family [Bradyrhizobium sp. 
YR681]
Length=419

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +E V R+ ELG +S+    L R + S     A +LI +WM DAG+   +D +GNV GR
Sbjct  12   LGKEIVRRINELGAISEDPEKLTRIYLSKELRTAADLILTWMRDAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   VEVI F
Sbjct  72   YEGERPGSPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAVEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_024483633.1| allantoate amidohydrolase [Serratia fonticola]
Length=420

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R  EL  +S     L R + SP  +RA  L+ +WM + G+  W D +GN+ GR EG+ 
Sbjct  18   MARCDELAAISSTPGQLTRVYLSPEHLRANQLVGNWMRELGMAVWQDGVGNICGRYEGLQ  77

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P+  ALL+GSHLDTV +AG +DG LG++TA+  + +L +  R  +L + +EVI F+DEEG
Sbjct  78   PAAPALLLGSHLDTVRNAGRYDGMLGVLTALEIVALLHSRNR--RLPQAIEVIGFADEEG  135

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  136  TRFGITLLGS  145



>ref|WP_023289752.1| allantoate deiminase [Klebsiella pneumoniae]
 gb|ESL76414.1| allantoate deiminase [Klebsiella pneumoniae UCICRE 14]
Length=419

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++TAI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLTAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_039361118.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KHN93178.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
actinidiae]
Length=428

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q   E+ +SR + L  +S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QAAAEQIMSRCHALADISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     GR  +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFHQQGR--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_044523337.1| allantoate amidohydrolase [Klebsiella sp.]
 emb|CDQ14533.1| Hydantoinase/carbamoylase family amidase [Klebsiella sp.]
Length=419

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++TAI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLTAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_034787876.1| allantoate amidohydrolase [Ewingella americana]
 gb|KFC84992.1| N-carbamoyl-L-amino acid hydrolase [Ewingella americana ATCC 
33852]
Length=413

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            +  +SR   L ++++    L R + SP  +RA  L+  WM+  G+ TW D +GN+ GR E
Sbjct  11   QRVMSRCDALAEITETPGQLTRVYLSPEHLRANQLVAEWMQAVGMSTWTDSVGNICGRYE  70

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G+NP   ALL+GSHLD+V +AG +DG LG++TAI  +  L       +L   VEV+ F+D
Sbjct  71   GLNPGAPALLLGSHLDSVRNAGRYDGPLGVLTAIETVAYLHQNAI--RLPMAVEVVGFAD  128

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  129  EEGTRFGITLLGS  141



>ref|WP_039382838.1| allantoate amidohydrolase [Pantoea sp. PSNIH1]
 gb|AIX50357.1| allantoate amidohydrolase [Pantoea sp. PSNIH1]
Length=416

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R   L ++S+ ++ L R + SP  +RA   +  WM+ AG+RTW D +GN+ GR E   
Sbjct  19   MARCDALAEISEEEDSLTRVYLSPEHLRANACVAEWMQAAGMRTWQDAVGNICGRYEAAE  78

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P   ALL+GSHLDTV +AG +DG LG+++AI  ++ L    R ++L   VE++ F+DEEG
Sbjct  79   PGAAALLLGSHLDTVRNAGRYDGMLGVLSAIETVQWLHD--RRQRLPLAVEIVGFADEEG  136

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  137  TRFGITLLGS  146



>ref|WP_026462888.1| amidase [Adhaeribacter aquaticus]
Length=412

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = +2

Query  251  QILK--EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGN  424
            Q LK  E+ + ++ EL  +S+    + RT+ S A ++A   I++WME AGL T+ID +GN
Sbjct  3    QYLKRAEKLLKQINELATISEQSGAITRTYGSEAFIKASQQIKNWMEAAGLDTYIDNIGN  62

Query  425  VHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVE  604
            V G++   NP  K  +IGSHLD+V +AG FDG LGI+  +  +  +       KL   +E
Sbjct  63   VRGKLTCSNPEAKTFVIGSHLDSVANAGKFDGPLGIVMGLEMVSQIDKN----KLPFNIE  118

Query  605  VIAFSDEEGVRFQSTFLGS  661
            +IAF DEEGVRF ST+LGS
Sbjct  119  LIAFCDEEGVRFHSTYLGS  137



>ref|WP_015671860.1| amidase, hydantoinase/carbamoylase family [Serratia marcescens]
 gb|AGB82017.1| amidase, hydantoinase/carbamoylase family [Serratia marcescens 
FGI94]
Length=420

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 90/144 (63%), Gaps = 6/144 (4%)
 Frame = +2

Query  242  LFPQILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWI  409
            L PQ   E+A +R+     +L  +S+  + L R + SP  ++A  L+ SWM +AG++   
Sbjct  5    LSPQAASEQAAARVMARADQLAALSETPDGLTRVYLSPQHLQANRLVGSWMAEAGMQVRQ  64

Query  410  DQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKL  589
            D +GN+ GR EG  P   ALL+GSHLDTV +AG +DG LG++TAI  ++ L+  GR  +L
Sbjct  65   DAVGNICGRYEGERPGAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVQALQQQGR--RL  122

Query  590  SKPVEVIAFSDEEGVRFQSTFLGS  661
               +EV+ F DEEG RF  T LGS
Sbjct  123  PLALEVVGFGDEEGTRFGITLLGS  146



>ref|WP_024528995.1| allantoate amidohydrolase [Serratia fonticola]
Length=428

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R  EL  +S     L R + SP  +RA  L+ +WM + G+  W D +GN+ GR EG  
Sbjct  18   MARCDELAAISSTPGQLTRVYLSPEHLRANQLVGNWMRELGMEVWQDGVGNICGRYEGQQ  77

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P+  ALL+GSHLDTV +AG +DG LG++TA+  + +L +  R  +L + +EVI F+DEEG
Sbjct  78   PAAPALLLGSHLDTVRNAGRYDGMLGVLTALEVVALLHSHNR--RLPQAIEVIGFADEEG  135

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  136  TRFGITLLGS  145



>ref|WP_037375355.1| allantoate amidohydrolase, partial [Serratia fonticola]
Length=415

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R  EL  +S     L R + SP  +RA  L+ +WM + G+  W D +GN+ GR EG  
Sbjct  18   MARCDELAAISSTPGQLTRVYLSPEHLRANQLVGNWMRELGMEVWQDGVGNICGRYEGRQ  77

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P+  ALL+GSHLDTV +AG +DG LG++TA+  + +L +  R  +L + +EVI F+DEEG
Sbjct  78   PAAPALLLGSHLDTVRNAGRYDGMLGVLTALEVVALLHSRNR--RLPQAIEVIGFADEEG  135

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  136  TRFGITLLGS  145



>ref|WP_023313204.1| allantoate deiminase [Klebsiella pneumoniae]
 gb|ESM39558.1| allantoate deiminase [Klebsiella pneumoniae BWH 30]
Length=419

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D F Q+ + EA     ++R   L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTFRQLAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGMQEGSPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_034874810.1| hypothetical protein [Bifidobacterium moukalabense]
 gb|ETY71906.1| hydantoinase/carbamoylase family amidase [Bifidobacterium moukalabense 
DSM 27321]
Length=429

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 87/133 (65%), Gaps = 0/133 (0%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            EE + R  +L +++  +N +ER + SP   +A  L   W+E+ GL T IDQ GN+ GR+E
Sbjct  12   EEILDRCDQLAELTCMENGIERDYLSPQMAQAYELTARWLEEGGLATHIDQAGNLVGRLE  71

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G  P   AL++GSHLD+V DAG +DG LG++TA+S    L  TG+ ++L   +EV+ F D
Sbjct  72   GREPGLPALVLGSHLDSVPDAGKYDGILGVVTAVSVATHLARTGKNKELPFAIEVLGFGD  131

Query  623  EEGVRFQSTFLGS  661
            EEG RF +T LGS
Sbjct  132  EEGARFGATLLGS  144



>ref|WP_040170982.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV++AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVLNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_017934472.1| hypothetical protein [Nocardioides sp. Iso805N]
Length=420

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = +2

Query  266  EAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEG  445
            E + R  EL + S +  +LERT+ +P    A      WM  AGLRTW+D  GN +GR EG
Sbjct  11   EVLRRCAELDRHSASPTHLERTYLTPEHAAANRATEGWMRQAGLRTWVDAAGNQYGRREG  70

Query  446  INPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDE  625
              P   ALL+GSHLDTV DAG +DG LG++ AI+  + L+ T    +L   +EV+ FSDE
Sbjct  71   PEPGMPALLLGSHLDTVPDAGSYDGMLGVLMAIAVAERLRAT----ELPFALEVVGFSDE  126

Query  626  EGVRFQSTFLGS  661
            EG RF    LGS
Sbjct  127  EGARFGKALLGS  138



>ref|WP_036104553.1| allantoate amidohydrolase, partial [Mangrovibacter sp. MFB070]
Length=411

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 83/143 (58%), Gaps = 6/143 (4%)
 Frame = +2

Query  245  FPQILKEEAVSRLYE----LGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWID  412
             P     +A SR+      L  +S     L R F SP  +RA   +  WME+AG+ TW D
Sbjct  1    MPDEQSRQAASRIMARSDTLALISQTPGQLTRVFLSPEHLRANQQVARWMEEAGMTTWQD  60

Query  413  QMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLS  592
              GN+ GR EG      A+L+GSHLDTV +AG +DG LG++TAI  +  L   G+  +L+
Sbjct  61   ATGNICGRYEGATEGASAVLLGSHLDTVRNAGRYDGMLGVLTAIEVVDWLNQQGK--RLN  118

Query  593  KPVEVIAFSDEEGVRFQSTFLGS  661
            + +EVI FSDEEG RF  T LGS
Sbjct  119  QAIEVIGFSDEEGTRFGITLLGS  141



>ref|WP_040234485.1| allantoate amidohydrolase, partial [Klebsiella pneumoniae]
Length=358

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_040202415.1| allantoate amidohydrolase, partial [Klebsiella pneumoniae]
Length=350

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_033752860.1| allantoate amidohydrolase [Pantoea sp. NGS-ED-1003]
Length=419

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 86/137 (63%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E  ++R   L  +S++ + L R + SP  +RA   +  WME AG+R W D++GN+ 
Sbjct  9    QLAAERVMARCDALAAISESPDQLTRVYLSPEHLRANAQVGEWMEQAGMRVWQDEVGNIC  68

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG +    ALL+GSHLDTV +AG +DG LG++TAI  ++ L    + ++L   +E++
Sbjct  69   GRYEGASDGAPALLLGSHLDTVRNAGRYDGMLGVLTAIETVQWLHQ--QRQRLPLAIEIV  126

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  127  GFGDEEGTRFGITLLGS  143



>ref|WP_027545871.1| allantoate amidohydrolase [Bradyrhizobium sp. WSM2254]
Length=419

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +E V R+ ELG +S+  + L R + S     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGKEIVRRINELGAISEETDKLTRIYLSKELRAAADLILGWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_039494543.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KGA30315.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
odoriferum]
Length=417

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+   +L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGHLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFHQQG--TRLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_015684689.1| allantoate amidohydrolase [Bradyrhizobium sp. S23321]
 dbj|BAL75360.1| allantoate amidohydrolase [Bradyrhizobium sp. S23321]
Length=424

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +E V R+ ELG +S+    L R + S    +A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGKEIVRRINELGAISEDPEKLTRIYLSKELRKAADLILIWMREAGMDAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAIS +  L   G+  +L   VEV+ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAISCVADLNRRGK--RLPFAVEVVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_032446059.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 emb|CDI21624.1| Allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
BJ1-GA]
Length=419

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLASLSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_032416200.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|EWD58160.1| allantoate deiminase [Klebsiella pneumoniae UCI 25]
 gb|EWE09650.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 48]
Length=419

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_029677513.1| allantoate amidohydrolase [Bradyrhizobium sp. JGI 0001019-J21]
Length=430

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +E V R+ ELG +S+  + L R + S     A +LI  WM +AG+   +D +GNV GR
Sbjct  18   LGKEIVRRINELGAISEETDKLTRIYLSKELRAAADLILGWMREAGMSAHLDAIGNVCGR  77

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  78   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVIGF  135

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  136  ADEEGVRFASTLLGS  150



>ref|WP_036158379.1| allantoate amidohydrolase [Marinomonas ushuaiensis]
 gb|ETX12409.1| allantoate amidohydrolase [Marinomonas ushuaiensis DSM 15871]
Length=409

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 88/135 (65%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            + ++ +SR  ELGK+S +D YL+R + +    +A  L+  WM  AG++TW D+ GN+ GR
Sbjct  7    IAQQVMSRCDELGKISQSDEYLDRRYLTAEHKQANELVGGWMTQAGMQTWQDEAGNLCGR  66

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
            +E   P+    LIGSHLDTV + G +DG LG+IT IS ++ +  T +  +L   ++++ F
Sbjct  67   LESKTPNAPRYLIGSHLDTVPNGGKYDGMLGVITPISLIQAI--TDQSVELPFHLDLVGF  124

Query  617  SDEEGVRFQSTFLGS  661
             DEEG RF+ST LGS
Sbjct  125  GDEEGTRFRSTLLGS  139



>gb|EJZ31229.1| allantoate amidohydrolase, partial [Bradyrhizobium sp. CCGE-LA001]
Length=180

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L E+ VSR+ EL  +S+    L R + S     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGEQIVSRIDELSAISEEAGNLTRVYLSNELREAADLILRWMREAGMSARLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EV+ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DE+GVRF ST LGS
Sbjct  130  ADEKGVRFASTLLGS  144



>emb|CCM91409.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae subsp. 
pneumoniae ST258-K28BO]
Length=404

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_009111656.1| allantoate amidohydrolase [Brenneria sp. EniD312]
 gb|EHD20348.1| amidase, hydantoinase/carbamoylase family [Brenneria sp. EniD312]
Length=427

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 2/132 (2%)
 Frame = +2

Query  266  EAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEG  445
            + ++R   L ++S+    L R + SP  +RA  L+  WM +AG+R W D +GN+ GR EG
Sbjct  17   QVMARCDALAEISETAGQLTRVYLSPQHLRANALVGEWMREAGMRVWQDSVGNICGRYEG  76

Query  446  INPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDE  625
              P   ALL+GSHLDTV +AG +DG LG++TAI  ++ L    R  +L   +E++ F DE
Sbjct  77   RRPGAPALLLGSHLDTVRNAGRYDGMLGVLTAIETVRALHR--RAIRLPVALEIVGFGDE  134

Query  626  EGVRFQSTFLGS  661
            EG RF  T LGS
Sbjct  135  EGTRFGITLLGS  146



>ref|WP_034949019.1| allantoate amidohydrolase [Erwinia oleae]
Length=415

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +2

Query  290  LGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGINPSGKAL  469
            L  +S+A + L R + SP  +RA  L   WM  AG+R W D +GN+ GR E   P   AL
Sbjct  20   LAAISEAPDGLTRVYLSPEHLRANALTGEWMRAAGMRVWQDSVGNICGRYEASTPGAPAL  79

Query  470  LIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEGVRFQST  649
            L+GSHLDTV DAG +DG LG++TAI  ++ L  +G   +L   +E+I F+DEEG RF  T
Sbjct  80   LLGSHLDTVRDAGRYDGMLGVLTAIEIVQTLNASG--TRLPHAIEIIGFADEEGTRFGIT  137

Query  650  FLGS  661
             LGS
Sbjct  138  LLGS  141



>ref|WP_040253118.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_032438386.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|EWD52353.1| allantoate deiminase [Klebsiella pneumoniae UCI 26]
Length=419

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_038934664.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=424

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+ EL  +S+  + L R + +     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGEEIVRRIDELAAISEDGDRLTRIYLTNELRSAADLILGWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  LK  G+  +L   +EVI F
Sbjct  72   YEGEQPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLKRRGK--RLPFAIEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_032414955.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|EWD96671.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 52]
 gb|EWF73739.1| allantoate deiminase [Klebsiella pneumoniae MGH 39]
Length=419

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_040218179.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 88/146 (60%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D F Q+ + EA     ++R   L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTFRQLAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG      A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGQQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_004151872.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|EJJ37023.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH2]
 gb|EJJ41151.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH4]
 gb|EJJ52956.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH6]
 gb|EJJ54377.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH5]
 gb|EJJ58909.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH7]
 gb|EJJ67611.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH9]
 gb|EJJ71716.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH8]
 gb|EJJ85761.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH11]
 gb|EJJ87608.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH12]
 gb|EJJ95591.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH14]
 gb|EJK02180.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH17]
 gb|EJK02728.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH16]
 gb|EJK11828.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH18]
 gb|EJK18780.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH20]
 gb|EJK23151.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH19]
 gb|EJK29397.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH21]
 gb|EJK34890.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH22]
 gb|EJK39387.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH23]
 gb|EMI38083.1| amidase, hydantoinase/carbamoylase family protein [Klebsiella 
pneumoniae VA360]
 gb|EMR27554.1| allantoate amidohydrolase [Klebsiella pneumoniae ATCC BAA-1705]
 gb|EOR16863.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC23]
 gb|EOY71769.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC40]
 gb|EOY86161.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC09]
 gb|EOY87241.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC01]
 gb|EOY94022.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC27]
 gb|EOY96000.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC26]
 gb|EOZ01785.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC24]
 gb|EOZ11398.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC04]
 gb|EOZ15735.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC252]
 gb|EOZ16756.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC22]
 gb|EOZ30952.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC254]
 gb|EOZ33945.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC269]
 gb|EOZ39501.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC280]
 gb|EOZ45065.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC276]
 gb|EOZ48951.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC270]
 gb|EOZ55466.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC297]
 gb|EOZ59868.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC309]
 gb|EOZ68911.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
361_1301]
 gb|EOZ78881.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
500_1420]
 gb|EOZ86757.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
440_1540]
 gb|EOZ98215.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
646_1568]
 gb|EPA01703.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
540_1460]
 gb|EPB06398.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC05]
 gb|EPB12698.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC 52]
 gb|EPB16495.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC45]
 gb|EPB22944.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC29]
 gb|EPB27002.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
VAKPC278]
 gb|EPB34950.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
DMC0526]
 gb|EPB41696.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC48]
 gb|EPB43637.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC32]
 gb|EPN94782.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC47]
 gb|EPN95024.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC28]
 gb|EPO02999.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC69]
 gb|EPO12777.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC77]
 gb|EPO15941.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC96]
 gb|EPO26790.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
DMC1097]
 gb|EPO27959.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
DMC1316]
 gb|EPO31322.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC61]
 gb|EPO43338.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC33]
 gb|EPO47783.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC07]
 gb|EPO52429.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC59]
 gb|EPO57296.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC18]
 gb|EPO63496.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC17]
 gb|EPO73292.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC31]
 gb|EPO74240.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC06]
 gb|EPO76655.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC02]
 gb|EPO85448.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC67]
 gb|EPO92692.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
160_1080]
 gb|EPP02823.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
140_1040]
 gb|EPP03145.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
120_1020]
 gb|EPP12551.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
280_1220]
 gb|EPS09290.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
UKKV901664]
 gb|EPS10336.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
MP14]
 gb|ERO74795.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 16]
 gb|ERO79898.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 18C]
 gb|ERO85742.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 12C]
 gb|AHE44521.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae subsp. 
pneumoniae Kp13]
 gb|EWD12819.1| allantoate deiminase [Klebsiella pneumoniae UCI 43]
 gb|EWD18081.1| allantoate deiminase [Klebsiella pneumoniae UCI 44]
 gb|EWD26282.1| allantoate deiminase [Klebsiella pneumoniae UCI 41]
 gb|EWD34474.1| allantoate deiminase [Klebsiella pneumoniae UCI 38]
 gb|EWD35841.1| allantoate deiminase [Klebsiella pneumoniae UCI 37]
 gb|EWD48742.1| allantoate deiminase [Klebsiella pneumoniae UCI 33]
 gb|EWD62889.1| allantoate deiminase [Klebsiella pneumoniae UCI 22]
 gb|EWD65901.1| allantoate deiminase [Klebsiella pneumoniae UCI 21]
 gb|EWD72834.1| allantoate deiminase [Klebsiella pneumoniae UCI 19]
 gb|EWD91207.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 45]
 gb|EWE46319.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 34]
 gb|EWE50773.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 32]
 gb|EWE58296.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 18A]
 gb|EWE66525.1| hypothetical protein L443_01143 [Klebsiella pneumoniae BIDMC 
14]
 gb|EWE73105.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 13]
 gb|EWE73765.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 12B]
 gb|EWE82660.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 12A]
 gb|EWE92308.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 5]
 gb|EWE95150.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 7B]
 gb|EWF06041.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 4]
 gb|EWF08556.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 2A]
 gb|EWF12844.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 1]
 gb|EWF17179.1| allantoate deiminase [Klebsiella pneumoniae UCICRE 1]
 gb|EWF25856.1| allantoate deiminase [Klebsiella pneumoniae BWH 41]
 gb|EWF34767.1| allantoate deiminase [Klebsiella pneumoniae BWH 36]
 gb|EWF35346.1| allantoate deiminase [Klebsiella pneumoniae BWH 22]
 gb|EWF62840.1| allantoate deiminase [Klebsiella pneumoniae MGH 45]
 gb|EWF92668.1| allantoate deiminase [Klebsiella pneumoniae MGH 29]
 gb|EWF93255.1| allantoate deiminase [Klebsiella pneumoniae MGH 31]
 gb|EWF97182.1| allantoate deiminase [Klebsiella pneumoniae UCICRE 13]
 gb|EWG05832.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 7A]
 gb|AHM79466.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae 30684/NJST258_2]
 gb|AHM85138.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae 30660/NJST258_1]
 gb|EYB72384.1| amidase, hydantoinase/carbamoylase family protein [Klebsiella 
pneumoniae Kb677]
 gb|EYB76026.1| amidase, hydantoinase/carbamoylase family protein [Klebsiella 
pneumoniae Kb140]
 gb|EZQ75564.1| allantoate deiminase [Klebsiella pneumoniae CHS 60]
 gb|EZQ80058.1| allantoate deiminase [Klebsiella pneumoniae CHS 47]
 gb|EZQ92240.1| allantoate deiminase [Klebsiella pneumoniae CHS 42]
 gb|EZQ99111.1| allantoate deiminase [Klebsiella pneumoniae CHS 16]
 gb|KAI87856.1| allantoate deiminase [Klebsiella pneumoniae CHS 08]
 gb|KDH04566.1| hypothetical protein L449_00480 [Klebsiella pneumoniae BIDMC 
18B]
 gb|KDH13334.1| hypothetical protein AE28_01648 [Klebsiella pneumoniae BIDMC 
54]
 gb|KDH21209.1| hypothetical protein AE35_00478 [Klebsiella pneumoniae BIDMC 
60]
 gb|KDH33048.1| hypothetical protein AE43_00478 [Klebsiella pneumoniae BIDMC 
68]
 gb|KDH45062.1| hypothetical protein AE08_01900 [Klebsiella pneumoniae BWH 45]
 gb|KDH54392.1| hypothetical protein AE55_01879 [Klebsiella pneumoniae BWH 47]
 gb|KDH55404.1| hypothetical protein AE58_05460 [Klebsiella pneumoniae CHS 02]
 gb|KDH62751.1| hypothetical protein AE61_05114 [Klebsiella pneumoniae CHS 05]
 gb|KDH72605.1| hypothetical protein AE59_01966 [Klebsiella pneumoniae CHS 03]
 gb|KDH78097.1| hypothetical protein AE63_05155 [Klebsiella pneumoniae CHS 07]
 gb|KDH83192.1| hypothetical protein AE62_00488 [Klebsiella pneumoniae CHS 06]
 gb|KDH91863.1| hypothetical protein AE65_01962 [Klebsiella pneumoniae CHS 09]
 gb|KDI00094.1| hypothetical protein AE69_05410 [Klebsiella pneumoniae CHS 13]
 gb|KDI02190.1| hypothetical protein AE68_01978 [Klebsiella pneumoniae CHS 12]
 gb|KDI02779.1| hypothetical protein AE70_05199 [Klebsiella pneumoniae CHS 14]
 gb|KDI14747.1| hypothetical protein AE73_04793 [Klebsiella pneumoniae CHS 17]
 gb|KDI24343.1| hypothetical protein AE75_04630 [Klebsiella pneumoniae CHS 19]
 gb|KDI36816.1| hypothetical protein AE76_01554 [Klebsiella pneumoniae CHS 20]
 gb|KDI43019.1| hypothetical protein AE79_01966 [Klebsiella pneumoniae CHS 23]
 gb|KDI43362.1| hypothetical protein AE78_00721 [Klebsiella pneumoniae CHS 22]
 gb|KDI59441.1| hypothetical protein AE81_01753 [Klebsiella pneumoniae CHS 25]
 gb|KDI61139.1| hypothetical protein AE82_00485 [Klebsiella pneumoniae CHS 26]
 gb|KDI64046.1| hypothetical protein AE85_05348 [Klebsiella pneumoniae CHS 29]
 gb|KDI71113.1| hypothetical protein AE84_03925 [Klebsiella pneumoniae CHS 28]
 gb|KDI73875.1| hypothetical protein AE83_00482 [Klebsiella pneumoniae CHS 27]
 gb|KDI88636.1| hypothetical protein AE87_01742 [Klebsiella pneumoniae CHS 31]
 gb|KDI89301.1| hypothetical protein AE86_02131 [Klebsiella pneumoniae CHS 30]
 gb|KDI95404.1| hypothetical protein AE88_00484 [Klebsiella pneumoniae CHS 32]
 gb|KDI96150.1| hypothetical protein AE89_05321 [Klebsiella pneumoniae CHS 33]
 gb|KDI99639.1| hypothetical protein AE91_04748 [Klebsiella pneumoniae CHS 35]
 gb|KDJ06919.1| hypothetical protein AE90_01959 [Klebsiella pneumoniae CHS 34]
 gb|KDJ18278.1| hypothetical protein AE92_01974 [Klebsiella pneumoniae CHS 36]
 gb|KDJ20397.1| hypothetical protein AE94_04714 [Klebsiella pneumoniae CHS 38]
 gb|KDJ25929.1| hypothetical protein AE93_00576 [Klebsiella pneumoniae CHS 37]
 gb|KDJ33177.1| hypothetical protein AE96_04591 [Klebsiella pneumoniae CHS 40]
 gb|KDJ37875.1| hypothetical protein AE95_00483 [Klebsiella pneumoniae CHS 39]
 gb|KDJ44827.1| hypothetical protein AE97_00484 [Klebsiella pneumoniae CHS 41]
 gb|KDJ48442.1| hypothetical protein AF01_05360 [Klebsiella pneumoniae CHS 45]
 gb|KDJ50561.1| hypothetical protein AF00_05231 [Klebsiella pneumoniae CHS 44]
 gb|KDJ69526.1| hypothetical protein AF02_00490 [Klebsiella pneumoniae CHS 46]
 gb|KDJ76254.1| hypothetical protein AF05_01898 [Klebsiella pneumoniae CHS 49]
 gb|KDJ84243.1| hypothetical protein AF08_05318 [Klebsiella pneumoniae CHS 52]
 gb|KDJ85203.1| hypothetical protein AF06_00525 [Klebsiella pneumoniae CHS 50]
 gb|KDJ92102.1| hypothetical protein AF07_00489 [Klebsiella pneumoniae CHS 51]
 gb|KDJ95812.1| hypothetical protein AF10_05356 [Klebsiella pneumoniae CHS 54]
 gb|KDJ95985.1| hypothetical protein AF09_04804 [Klebsiella pneumoniae CHS 53]
 gb|KDK09773.1| hypothetical protein AF11_01922 [Klebsiella pneumoniae CHS 55]
 gb|KDK16658.1| hypothetical protein AF12_01755 [Klebsiella pneumoniae CHS 56]
 gb|KDK24843.1| hypothetical protein AF13_00492 [Klebsiella pneumoniae CHS 57]
 gb|KDK32180.1| hypothetical protein AF15_01983 [Klebsiella pneumoniae CHS 59]
 gb|KDK40210.1| hypothetical protein AF17_00491 [Klebsiella pneumoniae CHS 61]
 gb|KDK47569.1| hypothetical protein AF18_00481 [Klebsiella pneumoniae CHS 62]
 gb|KDK48704.1| hypothetical protein AF19_01968 [Klebsiella pneumoniae CHS 63]
 gb|KDK57490.1| hypothetical protein AF20_00477 [Klebsiella pneumoniae CHS 64]
 gb|KDK58715.1| hypothetical protein AF21_01761 [Klebsiella pneumoniae CHS 65]
 gb|KDK63584.1| hypothetical protein AF26_05616 [Klebsiella pneumoniae CHS 70]
 gb|KDK69419.1| hypothetical protein AF23_01979 [Klebsiella pneumoniae CHS 67]
 gb|KDK76153.1| hypothetical protein AF27_05384 [Klebsiella pneumoniae CHS 71]
 gb|KDK83732.1| hypothetical protein AF28_01972 [Klebsiella pneumoniae CHS 72]
 gb|KDK84220.1| hypothetical protein AF29_05326 [Klebsiella pneumoniae CHS 73]
 gb|KDK92553.1| hypothetical protein AF30_05359 [Klebsiella pneumoniae CHS 74]
 gb|KDK96973.1| hypothetical protein AF32_05525 [Klebsiella pneumoniae CHS 76]
 gb|KDK99371.1| hypothetical protein AF31_01971 [Klebsiella pneumoniae CHS 75]
 gb|KDL09659.1| hypothetical protein AF36_05335 [Klebsiella pneumoniae CHS 80]
 gb|KDL20146.1| hypothetical protein AF37_01962 [Klebsiella pneumoniae MGH 51]
 gb|KDL30761.1| hypothetical protein AF45_01472 [Klebsiella pneumoniae MGH 59]
 gb|KDL53853.1| hypothetical protein AD93_01303 [Klebsiella pneumoniae MGH 67]
 gb|KDL78996.1| hypothetical protein AD97_00384 [Klebsiella pneumoniae MGH 71]
 gb|KDL86161.1| hypothetical protein AD99_00381 [Klebsiella pneumoniae MGH 73]
 gb|KDL96716.1| hypothetical protein AE05_02573 [Klebsiella pneumoniae MGH 79]
 gb|KDM07867.1| hypothetical protein AE14_01903 [Klebsiella pneumoniae UCI 55]
 gb|KDM17412.1| hypothetical protein AE18_01809 [Klebsiella pneumoniae UCI 59]
 gb|KDM27700.1| hypothetical protein AE20_01799 [Klebsiella pneumoniae UCI 61]
 gb|KDM38444.1| hypothetical protein AE22_01660 [Klebsiella pneumoniae UCI 63]
 gb|KDM42035.1| hypothetical protein AE26_01793 [Klebsiella pneumoniae UCI 67]
 gb|AIA36909.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH10]
 gb|KEC94712.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 10]
 gb|KEF68317.1| allantoate amidohydrolase [Klebsiella pneumoniae 160_1080]
 gb|KEF70222.1| allantoate amidohydrolase [Klebsiella pneumoniae UHKPC 52]
 gb|KEF74742.1| allantoate amidohydrolase [Klebsiella pneumoniae UHKPC45]
 gb|KEF81497.1| allantoate amidohydrolase [Klebsiella pneumoniae UHKPC05]
 gb|KEF85543.1| allantoate amidohydrolase [Klebsiella pneumoniae VAKPC278]
 gb|AID96462.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH24]
 gb|AIE23220.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPNIH1]
 gb|AIE28620.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
KPR0928]
 gb|KFG16485.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|KFG16761.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|AIW71235.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae]
 gb|AIW76741.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae]
 gb|AIX79295.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae]
 gb|KHF66569.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae subsp. 
pneumoniae]
 gb|KHQ27919.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|KHQ34237.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|AJB76052.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|AJB57595.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_028170521.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
 gb|AJA61896.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=424

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+ EL  +S+  + L R + +     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGEEIVRRIDELAAISEDGDRLTRIYLTNELRSAADLILGWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  LK  G+  +L   +EVI F
Sbjct  72   YEGEQPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLKRRGK--RLPFAIEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_017900275.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_043519587.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|KII59595.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 emb|CEL82567.1| allantoate amidohydrolase [Klebsiella pneumoniae ATCC 43816]
Length=419

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_016947333.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_042935552.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_004205837.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|EMR17119.1| allantoate amidohydrolase [Klebsiella pneumoniae 700603]
Length=419

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_038435326.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|AIX69530.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae]
Length=419

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQHGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_023318290.1| allantoate deiminase [Klebsiella pneumoniae]
 gb|ESM64882.1| allantoate deiminase [Klebsiella pneumoniae MGH 44]
Length=419

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_019705119.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|ESM52669.1| allantoate deiminase [Klebsiella pneumoniae BWH 28]
Length=419

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R  +L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQHGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_039199915.1| hypothetical protein, partial [Bifidobacterium kashiwanohense]
Length=412

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +2

Query  263  EEAVSRLYE----LGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            E+A S + E    L +++  +N +ERT+ SP   +A +L  +WM  AGL T ID  GN+ 
Sbjct  8    EQAASTILERCDRLAELTSLNNGIERTYLSPQMAQAYDLTGTWMRQAGLATHIDPAGNLV  67

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR+EGI P   AL++GSHLD+V DAG +DG LG++TAIS  + L  +G    L   +EV+
Sbjct  68   GRVEGIKPGLPALILGSHLDSVPDAGKYDGILGVVTAISVAEHLIDSGITATLPFAIEVV  127

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF +T LGS
Sbjct  128  GFGDEEGARFGATLLGS  144



>ref|WP_033637196.1| allantoate amidohydrolase [Serratia marcescens]
 gb|ETX40593.1| allantoate amidohydrolase [Serratia marcescens BIDMC 44]
Length=414

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 81/130 (62%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R  EL  +S   + L R + SP   RA  L+  WM ++G+R W D +GN+ GR EG+ 
Sbjct  14   MARCDELAAISAQPDRLTRLYLSPEHQRANRLVGEWMRESGMRVWQDSVGNICGRYEGMT  73

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P   ALL+GSHLDTV +AG +DG LG++TA+  +      GR  +L   +EVI F+DEEG
Sbjct  74   PGAPALLLGSHLDTVRNAGRYDGMLGVLTALETVAHHHRQGR--RLPLALEVIGFADEEG  131

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  132  ARFGVTLLGS  141



>ref|WP_032740607.1| allantoate amidohydrolase, partial [Klebsiella pneumoniae]
 gb|KDM11985.1| hypothetical protein AE02_03302, partial [Klebsiella pneumoniae 
MGH 76]
Length=200

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 85/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLATLSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG      A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGQQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_032456079.1| allantoate amidohydrolase [Klebsiella sp. 07A044]
 emb|CDN06668.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella sp. 07A044]
Length=419

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQHLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>gb|AIZ14689.1| allantoate amidohydrolase [Bifidobacterium kashiwanohense PV20-2]
Length=440

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +2

Query  263  EEAVSRLYE----LGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            E+A S + E    L +++  +N +ERT+ SP   +A +L  +WM  AGL T ID  GN+ 
Sbjct  8    EQAASTILERCDRLAELTSLNNGIERTYLSPQMAQAYDLTGTWMRQAGLATHIDPAGNLV  67

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR+EGI P   AL++GSHLD+V DAG +DG LG++TAIS  + L  +G    L   +EV+
Sbjct  68   GRVEGIKPGLPALILGSHLDSVPDAGKYDGILGVVTAISVAEHLIDSGITATLPFAIEVV  127

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF +T LGS
Sbjct  128  GFGDEEGARFGATLLGS  144



>ref|WP_036987768.1| allantoate amidohydrolase [Pseudomonas sp. URMO17WK12:I3]
Length=420

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R  EL  +S++   L R + SP   RA  L+  WM+ AG+RTW D +GN+ GR EG N
Sbjct  14   MARCDELAAISESTEGLTRVYLSPEHQRANALVGEWMQAAGMRTWQDAVGNICGRYEGQN  73

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
               +ALL+GSHLDTV +AG +DG LG+I AI  ++     G   +L   +E++ F+DEEG
Sbjct  74   AGAQALLLGSHLDTVRNAGRYDGMLGVIAAIEVVQRFHDLG--IRLPLAIEIVGFADEEG  131

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  132  TRFGITLLGS  141



>gb|ADD76032.1| AmaB [Pantoea ananatis LMG 20103]
 dbj|BAK10280.1| N-carbamoyl-L-amino acid hydrolase AmaB [Pantoea ananatis AJ13355]
Length=425

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            QI     ++R   L ++S++D  L R + SP  +RA   +  WM+ AG+  W D++GN+ 
Sbjct  17   QIAARRVMARCDALAEISESDQGLTRVYLSPEHLRANARVGEWMQAAGMTVWQDEVGNIC  76

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR E   P   ALL+GSHLDTV +AG +DG LG+++AI  ++ L    R  +L   +EVI
Sbjct  77   GRYEAAQPGAPALLLGSHLDTVRNAGRYDGMLGVLSAIETVQWLHD--RQRRLPLAIEVI  134

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  135  GFGDEEGTRFGITLLGS  151



>ref|WP_035665434.1| allantoate amidohydrolase [Bradyrhizobium sp. Ec3.3]
Length=424

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +E V R+ ELG +S+  + L R + S     A +LI +WM +AG+   +D +GNV GR
Sbjct  12   LGDEIVRRINELGSISEDADKLTRIYLSKELRTAADLILAWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  72   YEGERPGLPCLMLGSHYDTVRDAGKWDGPLGVITAIACVAELNRRGK--RLPFAIEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_027888447.1| MULTISPECIES: allantoate amidohydrolase [Meiothermus]
 gb|KIQ54169.1| allantoate amidohydrolase [Meiothermus ruber]
Length=416

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 90/139 (65%), Gaps = 5/139 (4%)
 Frame = +2

Query  245  FPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGN  424
            FPQ L +EA+ R + LG++S+    L RTF SP       L+ +WM++ G+   +D +GN
Sbjct  9    FPQ-LAQEALERCHILGRLSEETGRLTRTFLSPPMREVHRLLTAWMQELGMTVRVDAVGN  67

Query  425  VHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVE  604
            + G   G NP   ALL+GSH+DTV DAG +DG LG++ A++ +K L   GR  +L   +E
Sbjct  68   LIGHYPGQNPEAPALLMGSHVDTVRDAGRYDGLLGVVLALAVVKALG--GR--RLPFALE  123

Query  605  VIAFSDEEGVRFQSTFLGS  661
            VIAFS+EEGVRF   FLGS
Sbjct  124  VIAFSEEEGVRFGVPFLGS  142



>gb|KEA53939.1| allantoate amidohydrolase [Mangrovibacter sp. MFB070]
Length=585

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 83/143 (58%), Gaps = 6/143 (4%)
 Frame = +2

Query  245  FPQILKEEAVSRLYE----LGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWID  412
             P     +A SR+      L  +S     L R F SP  +RA   +  WME+AG+ TW D
Sbjct  6    MPDEQSRQAASRIMARSDTLALISQTPGQLTRVFLSPEHLRANQQVARWMEEAGMTTWQD  65

Query  413  QMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLS  592
              GN+ GR EG      A+L+GSHLDTV +AG +DG LG++TAI  +  L   G+  +L+
Sbjct  66   ATGNICGRYEGATEGASAVLLGSHLDTVRNAGRYDGMLGVLTAIEVVDWLNQQGK--RLN  123

Query  593  KPVEVIAFSDEEGVRFQSTFLGS  661
            + +EVI FSDEEG RF  T LGS
Sbjct  124  QAIEVIGFSDEEGTRFGITLLGS  146



>ref|WP_040196471.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 86/141 (61%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      LG +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLGALSETADVLTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG      A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGQQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_014606513.1| allantoate amidohydrolase [Pantoea ananatis]
 gb|AER33827.1| N-carbamoyl-L-amino acid hydrolase AmaB [Pantoea ananatis PA13]
 emb|CCF10835.1| N-carbamyl-L-amino acid amidohydrolase [Pantoea ananatis LMG 
5342]
Length=417

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            QI     ++R   L ++S++D  L R + SP  +RA   +  WM+ AG+  W D++GN+ 
Sbjct  9    QIAARRVMARCDALAEISESDQGLTRVYLSPEHLRANARVGEWMQAAGMTVWQDEVGNIC  68

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR E   P   ALL+GSHLDTV +AG +DG LG+++AI  ++ L    R  +L   +EVI
Sbjct  69   GRYEAAQPGAPALLLGSHLDTVRNAGRYDGMLGVLSAIETVQWLHD--RQRRLPLAIEVI  126

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  127  GFGDEEGTRFGITLLGS  143



>ref|WP_040033069.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KHS79139.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
carotovorum]
Length=420

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LGI+TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGRYDGMLGILTAIEVVRAFHQQGM--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_022622715.1| allantoate amidohydrolase [Pantoea ananatis]
 gb|ERM14314.1| allantoate amidohydrolase [Pantoea ananatis BRT175]
Length=417

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            QI     ++R   L ++S++D  L R + SP  +RA   +  WM+ AG+  W D++GN+ 
Sbjct  9    QIAARRVMARCDALAEISESDQGLTRVYLSPEHLRANARVGEWMQAAGMTVWQDEVGNIC  68

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR E   P   ALL+GSHLDTV +AG +DG LG+++AI  ++ L    R  +L   +EVI
Sbjct  69   GRYEAAQPGAPALLLGSHLDTVRNAGRYDGMLGVLSAIETVQWLHD--RQRRLPLAIEVI  126

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  127  GFGDEEGTRFGITLLGS  143



>ref|WP_033071895.1| allantoate amidohydrolase [Pectobacterium wasabiae]
Length=429

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            E+ +SR   L ++S+    L R + S   +RA  L+  WM +AG+  W D +GN+ GR E
Sbjct  16   EQIMSRCDALAEISETPGQLTRVYLSLEHLRANRLVGEWMREAGMNVWQDSVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++  +  G   +L   +E+I F D
Sbjct  76   GLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFQQQGI--RLPVALEIIGFGD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_035995577.1| allantoate amidohydrolase [Bradyrhizobium sp. WSM1253]
Length=419

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V  + EL  +S+  + L R + +    +A +LI SWM DAG+   +D +GNV GR
Sbjct  12   LGEEIVRGINELAAISEEGDKLTRVYLTSELRKAADLILSWMRDAGMSARLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E++ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEIVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_015731068.1| allantoate amidohydrolase [Pectobacterium wasabiae]
 gb|ACX89201.1| amidase, hydantoinase/carbamoylase family [Pectobacterium wasabiae 
WPP163]
Length=429

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            E+ +SR   L ++S+    L R + S   +RA  L+  WM +AG+  W D +GN+ GR E
Sbjct  16   EQIMSRCDALAEISETPGQLTRVYLSLEHLRANRLVGEWMREAGMNVWQDSVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++  +  G   +L   +E+I F D
Sbjct  76   GLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFQQQGI--RLPVALEIIGFGD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_032434558.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|KDL93715.1| hypothetical protein AE00_01608 [Klebsiella pneumoniae MGH 74]
 gb|KGT64032.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
MRSN 1319]
 gb|KGY34232.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 86/141 (61%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+     +L   S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADQLAAFSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_008105230.1| allantoate amidohydrolase [Pantoea sp. YR343]
 gb|EJM98564.1| amidase, hydantoinase/carbamoylase family [Pantoea sp. YR343]
Length=421

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 86/137 (63%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            QI     ++R   L ++S++++ L R + SP  +RA   +  WM+ AG+ TW D +GN+ 
Sbjct  12   QIAAARVMARCDALAEISESEDGLTRVYLSPEQLRANARVGDWMQAAGMTTWQDAVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR E   P  +ALL+GSHLDTV +AG +DG LG+++AI  ++ L    R ++L   +E++
Sbjct  72   GRYEAAQPGAQALLLGSHLDTVRNAGRYDGMLGVLSAIETVQWLHD--RQQRLPLAIEIV  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>gb|EIG62038.1| amidase, hydantoinase/carbamoylase family [Bradyrhizobium sp. 
WSM1253]
Length=459

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V  + EL  +S+  + L R + +    +A +LI SWM DAG+   +D +GNV GR
Sbjct  52   LGEEIVRGINELAAISEEGDKLTRVYLTSELRKAADLILSWMRDAGMSARLDAIGNVCGR  111

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E++ F
Sbjct  112  YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEIVGF  169

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  170  ADEEGVRFASTLLGS  184



>ref|WP_021440158.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|ERI58939.1| allantoate amidohydrolase [Klebsiella pneumoniae KP-1]
 gb|ESL52754.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 24]
 gb|ESM00044.1| allantoate deiminase [Klebsiella pneumoniae UCICRE 7]
 gb|ESN52092.1| allantoate deiminase [Klebsiella pneumoniae MGH 18]
 gb|EWE41581.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 35]
 gb|EZR11963.1| allantoate deiminase [Klebsiella pneumoniae UCI 60]
 gb|EZR13118.1| allantoate deiminase [Klebsiella pneumoniae UCI 64]
 gb|KDH36786.1| hypothetical protein AE44_00632 [Klebsiella pneumoniae BIDMC 
69]
 gb|KDH57625.1| hypothetical protein AE56_01653 [Klebsiella pneumoniae BWH 48]
 gb|KDL35817.1| hypothetical protein AF46_01635 [Klebsiella pneumoniae MGH 60]
 gb|KDL71049.1| hypothetical protein AD96_01698 [Klebsiella pneumoniae MGH 70]
 gb|AIW99660.1| allantoate amidohydrolase [Klebsiella pneumoniae]
Length=419

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 86/141 (61%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_004179943.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|EKB76130.1| hydantoinase/carbamoylase family amidase [Klebsiella pneumoniae 
subsp. pneumoniae WGLW2]
 gb|EMH90161.1| amidase, hydantoinase/carbamoylase family protein [Klebsiella 
pneumoniae JHCK1]
 gb|EOY65078.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
KP-7]
 gb|EOZ57566.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
KP-11]
 gb|EPA87198.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC57]
 gb|EPO87793.1| amidase, hydantoinase/carbamoylase family [Klebsiella pneumoniae 
UHKPC179]
 gb|ERN61089.1| allantoate amidohydrolase [Klebsiella pneumoniae 303K]
 gb|ESM19001.1| allantoate deiminase [Klebsiella pneumoniae UCICRE 4]
 gb|ESM75005.1| allantoate deiminase [Klebsiella pneumoniae MGH 46]
 gb|EWD82463.1| allantoate deiminase [Klebsiella pneumoniae UCI 20]
 gb|EWE04471.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 51]
 gb|EWE95545.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 11]
 gb|EZQ78988.1| allantoate deiminase [Klebsiella pneumoniae MGH 63]
 gb|EZR24453.1| allantoate deiminase [Klebsiella pneumoniae MGH 75]
 gb|KDK66759.1| hypothetical protein AF22_01517 [Klebsiella pneumoniae CHS 66]
 gb|KDL46718.1| hypothetical protein AF51_01709 [Klebsiella pneumoniae MGH 65]
 gb|KEF25024.1| allantoate deiminase [Klebsiella pneumoniae BIDMC 33B]
 gb|AIG82005.1| allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
PittNDM01]
 gb|AIT03542.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae]
 gb|KGK54015.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 emb|CED75687.1| Hydantoinase/carbamoylase family amidase [Klebsiella pneumoniae]
 gb|KHF61758.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 emb|CEO84205.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae]
Length=419

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 86/141 (61%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_027519320.1| allantoate amidohydrolase [Bradyrhizobium sp. WSM1417]
Length=419

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V  + EL  +S+  + L R + +    +A +LI SWM DAG+   +D +GNV GR
Sbjct  12   LGEEIVRGINELAAISEEGDKLTRIYLTSELRKAADLILSWMRDAGMSARLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E++ F
Sbjct  72   YEGEQPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEIVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_014701136.1| Amidase, hydantoinase/carbamoylase family [Pectobacterium sp. 
SCC3193]
 gb|AFI91669.1| Amidase, hydantoinase/carbamoylase family [Pectobacterium sp. 
SCC3193]
Length=429

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            E+ +SR   L ++S+    L R + S   +RA  L+  WM +AG+  W D +GN+ GR E
Sbjct  16   EQIMSRCDALAEISETPGQLTRVYLSLEHLRANRLVGEWMREAGMNVWQDSVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++  +  G   +L   +E+I F D
Sbjct  76   GLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFQQQGI--RLPVALEIIGFGD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_039530217.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KHS63934.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
Length=420

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGCYDGMLGVLTAIEVVRAFHQQGM--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_042940569.1| allantoate amidohydrolase, partial [Klebsiella pneumoniae]
Length=182

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L   S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLAAFSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG      A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGQQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_039463139.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KFF70385.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
 gb|KHS69332.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
 gb|KHT02601.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
 gb|KHT03661.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
 gb|KHT14845.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
carotovorum]
Length=420

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGCYDGMLGVLTAIEVVRAFHQQGM--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_038966724.1| allantoate amidohydrolase [Bradyrhizobium sp. CCBAU 41267]
Length=424

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+  LG +S+  + L R + S     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGEEIVRRINVLGAISEETDKLTRIYLSKELRAAADLILGWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_026202134.1| allantoate amidohydrolase [Bradyrhizobium sp. WSM2793]
Length=419

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+ +L  +S+A + L R + +    +A +L+ SWM  AG+   +D +GNV GR
Sbjct  12   LGEEIVRRINDLAAISEAGDNLTRIYLTKELRKAADLLLSWMRGAGMSARLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E++ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEIVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_038971995.1| allantoate amidohydrolase [Bradyrhizobium sp. CCBAU 15635]
Length=419

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V  + +L  +S+A + L R + +    +A +L+ SWM DAG+   +D +GNV GR
Sbjct  12   LGEEIVRGINDLAAISEAGDNLTRIYLTKELRKAADLLLSWMRDAGMSARLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E++ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEIVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_039499620.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KHT38411.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
carotovorum]
Length=427

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGCYDGMLGVLTAIEVVRAFHQQGM--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_039186028.1| allantoate amidohydrolase [Bradyrhizobium diazoefficiens]
Length=424

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+  LG +S+  + L R + S     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGEEIVRRINVLGAISEETDKLTRIYLSKELRAAADLILGWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_004224897.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|AEJ98237.1| allantoate amidohydrolase [Klebsiella pneumoniae KCTC 2242]
 emb|CCN29820.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae subsp. 
pneumoniae Ecl8]
 emb|CDI12824.1| Allantoate amidohydrolase [Klebsiella pneumoniae subsp. pneumoniae 
T69]
 gb|AJC04662.1| N-carbamoyl-L-amino acid hydrolase [Klebsiella pneumoniae subsp. 
pneumoniae 1158]
Length=419

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 7/146 (5%)
 Frame = +2

Query  239  DLFPQILKEEA-----VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRT  403
            D   Q+ + EA     ++R   L  +S+  + L R + SP  ++A  L+  WM+ AG+  
Sbjct  3    DTVRQLAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMV  62

Query  404  WIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLE  583
            W D +GN+ GR EG+     A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  
Sbjct  63   WQDSVGNICGRYEGVQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQHGR--  120

Query  584  KLSKPVEVIAFSDEEGVRFQSTFLGS  661
            +L+K +E++ F DEEG RF  T LGS
Sbjct  121  RLAKAIEIVGFGDEEGTRFGITLLGS  146



>ref|WP_028178899.1| MULTISPECIES: allantoate amidohydrolase [Bradyrhizobium]
Length=424

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L E  V R+ +L  +S+  + L R + +     A +LI SWM +AG+   ID +GNV GR
Sbjct  12   LGEVIVRRINDLAAISEEGDKLTRIYLTKELRDAADLILSWMREAGMSARIDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAIS +  L   GR  +L   +EV+ F
Sbjct  72   YEGDRPGAPCLMLGSHYDTVRDAGKWDGPLGVITAISCVADLNRRGR--RLPFAIEVVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_018644804.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=418

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 88/147 (60%), Gaps = 5/147 (3%)
 Frame = +2

Query  221  GVGTKYDLFPQILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLR  400
            G GT +D     L +E V R+ EL  +S+  + L R + S     A +LI  WM DAG+ 
Sbjct  2    GAGTVHDAS---LGKEIVRRINELAAISEEPDKLTRVYLSKELRTAADLILGWMRDAGMS  58

Query  401  TWIDQMGNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRL  580
              +D +GNV GR EG       L++GSH DTV DAG +DG LG+ITAI+ +  L   G+ 
Sbjct  59   AHLDAIGNVCGRYEGERQGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK-  117

Query  581  EKLSKPVEVIAFSDEEGVRFQSTFLGS  661
             +L   +EVI F+DEEGVRF ST LGS
Sbjct  118  -RLPFAIEVIGFADEEGVRFASTLLGS  143



>ref|WP_039317881.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KGA31425.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
Length=420

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRTFHQQGM--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_027531888.1| allantoate amidohydrolase [Bradyrhizobium sp. WSM3983]
Length=419

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 83/135 (61%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+ EL  +S+ D  L R + +     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGEEIVRRINELAAISEEDGKLTRIYLTKELRTASDLILGWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G   +L   +E++ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVAELNRRG--TRLPFAIEIVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_039518013.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KHS64205.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
Length=420

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFHQQGM--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_032427248.1| allantoate amidohydrolase, partial [Klebsiella pneumoniae]
Length=261

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 85/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG      A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGQQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_039277036.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KFF69507.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
Length=420

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            E+ +SR   L ++S+    L R + S   +RA  L+  WM +AG+  W D +GN+ GR E
Sbjct  16   EQIMSRCDALAEISETPGQLTRVYLSLEHLRANALVGEWMREAGMNVWQDSVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I F D
Sbjct  76   GLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFHQQGM--RLPVALEIIGFGD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_028174413.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
 gb|KGJ66607.1| putative N-carbamoyl-L-amino acid hydrolase [Bradyrhizobium diazoefficiens 
SEMIA 5080]
Length=430

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+  LG +S+  + L R + S     A +LI  WM +AG+   +D +GNV GR
Sbjct  18   LGEEIVRRINVLGAISEETDKLTRIYLSKELRAAADLILGWMREAGMSAHLDAIGNVCGR  77

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  78   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVIGF  135

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  136  ADEEGVRFASTLLGS  150



>ref|WP_038949186.1| allantoate amidohydrolase [Bradyrhizobium sp. CCBAU 15544]
Length=419

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V  + +L  +S+A + L R + +    +A +L+ SWM DAG+   +D +GNV GR
Sbjct  12   LGEEIVRGINDLAAISEAGDNLTRIYLTKELRKAADLLLSWMRDAGMSARLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +E++ F
Sbjct  72   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEIVGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>ref|WP_039504761.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KHS97675.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
Length=420

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEISETPGQLTRVYLSLEHLRANARVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFHQQGM--RLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_011088888.1| allantoate amidohydrolase [Bradyrhizobium diazoefficiens]
 ref|NP_772787.1| allantoate amidohydrolase [Bradyrhizobium diazoefficiens USDA 
110]
 dbj|BAC51412.1| bll6147 [Bradyrhizobium diazoefficiens USDA 110]
Length=430

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+  LG +S+  + L R + S     A +LI  WM +AG+   +D +GNV GR
Sbjct  18   LGEEIVRRINVLGAISEETDKLTRIYLSKELRAAADLILGWMREAGMSAHLDAIGNVCGR  77

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  78   YEGERPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVIGF  135

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  136  ADEEGVRFASTLLGS  150



>gb|EPF45025.1| allantoate amidohydrolase, partial [Klebsiella pneumoniae subsp. 
pneumoniae B5055]
Length=199

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L   S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLAAFSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG      A+L+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGQQEGAPAVLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_045585323.1| allantoate amidohydrolase [Azospirillum thiophilum]
 gb|KJR62598.1| allantoate amidohydrolase [Azospirillum thiophilum]
Length=423

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 80/130 (62%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            + R+  L  +S  D  L R + +P   RA +L+  WM +AG+    D +GN+ GR EG  
Sbjct  22   LDRIDALAAISAEDGRLSRLYLTPEHRRANDLVAGWMREAGMAVREDAVGNIVGRYEGDR  81

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P   ALL+GSHLDTV DAG +DG LG++T I+ +  L   GR  +L   VEVI F DEEG
Sbjct  82   PGLPALLMGSHLDTVRDAGRYDGMLGVLTGIAVVADLNARGR--RLPFAVEVIGFGDEEG  139

Query  632  VRFQSTFLGS  661
             RFQST +GS
Sbjct  140  TRFQSTLIGS  149



>ref|WP_038648815.1| allantoate amidohydrolase [Pantoea rwandensis]
 gb|AIR87294.1| allantoate amidohydrolase [Pantoea rwandensis]
Length=419

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  272  VSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIEGIN  451
            ++R   L ++S++++ L R + SP  VRA   +  WM+ AG+ TW D +GN+ GR E   
Sbjct  19   MARCDALAEISESEDGLTRVYLSPEQVRANARVAEWMQAAGMTTWQDAVGNICGRYESAE  78

Query  452  PSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSDEEG  631
            P  +ALL+GSHLDTV +AG +DG LG+++AI  ++ L    R ++L   +E++ F DEEG
Sbjct  79   PGAQALLLGSHLDTVRNAGRYDGMLGVLSAIETVQWLHD--RQQRLPLAIEIVGFGDEEG  136

Query  632  VRFQSTFLGS  661
             RF  T LGS
Sbjct  137  TRFGITLLGS  146



>ref|WP_024050150.1| allantoate amidohydrolase [Meiothermus ruber]
Length=415

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 4/135 (3%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +EA+ R   LG++S+    L RTF SP       L+ +WM++ G+   +D +GN+ GR
Sbjct  11   LAQEALERCLALGRLSEEAGRLTRTFLSPPMREVHRLLTAWMQELGMAVRVDAVGNLIGR  70

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
              G  P   ALL+GSH+DTV DAG FDG LG+  A++ +K L   GR  +LS  +EVIAF
Sbjct  71   YPGQTPDAPALLMGSHVDTVRDAGRFDGLLGVTLALAVVKALG--GR--RLSLAIEVIAF  126

Query  617  SDEEGVRFQSTFLGS  661
            S+EEGVRF   FLGS
Sbjct  127  SEEEGVRFGVPFLGS  141



>ref|WP_013013670.1| allantoate amidohydrolase [Meiothermus ruber]
 gb|ADD28151.1| amidase, hydantoinase/carbamoylase family [Meiothermus ruber 
DSM 1279]
 gb|AGK04621.1| allantoate amidohydrolase [Meiothermus ruber DSM 1279]
Length=415

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 4/135 (3%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L +EA+ R   LG++S+    L RTF SP       L+ +WM++ G+   +D +GN+ GR
Sbjct  11   LAQEALERCLALGRLSEEAGRLTRTFLSPPMREVHRLLTAWMQELGMAVRVDAVGNLIGR  70

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
              G  P   ALL+GSH+DTV DAG FDG LG+  A++ +K L   GR  +LS  +EVIAF
Sbjct  71   YPGQTPDAPALLMGSHVDTVRDAGRFDGLLGVTLALAVVKALG--GR--RLSLAIEVIAF  126

Query  617  SDEEGVRFQSTFLGS  661
            S+EEGVRF   FLGS
Sbjct  127  SEEEGVRFGVPFLGS  141



>ref|WP_020456676.1| hypothetical protein [Enterobacter sp. R4-368]
 gb|AGN87328.1| hypothetical protein H650_20085 [Enterobacter sp. R4-368]
Length=416

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 84/136 (62%), Gaps = 6/136 (4%)
 Frame = +2

Query  266  EAVSRLYE----LGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHG  433
            +A SR+ +    L ++S+    L R + SP  ++A  L+  WM+ AG+RTW D +GN+ G
Sbjct  9    QAASRVMQRCDALAQISETPGQLTRVYLSPQHLQANALVAGWMQQAGMRTWQDAVGNIFG  68

Query  434  RIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIA  613
            R EGI   G+ALL+GSHLDTV DAG +DG LG++ AI  +  L       +  + +E++ 
Sbjct  69   RYEGIEAGGQALLLGSHLDTVRDAGRYDGMLGVLAAIEVVDGLNRANL--RGRQAIEIVG  126

Query  614  FSDEEGVRFQSTFLGS  661
            F+DEEG RF    LGS
Sbjct  127  FADEEGTRFNIALLGS  142



>ref|WP_038027632.1| allantoate amidohydrolase [Tatumella saanichensis]
Length=425

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q   E A++R   L  +S+    L R + S   +RA   +  WME AG+R W DQ+GN+ 
Sbjct  14   QQAGERAMARCETLASISETPGQLTRVYLSAEHLRANQQVAQWMEQAGMRVWQDQVGNIC  73

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+     A+L+GSHLD+V +AG +DG LG++TAI  +  L    + ++L   +E++
Sbjct  74   GRYEGLTAGAPAILLGSHLDSVRNAGKYDGPLGVLTAIETVSWLNQ--QQKRLPVAIEIV  131

Query  611  AFSDEEGVRFQSTFLGS  661
             F+DEEG RF  T LGS
Sbjct  132  GFADEEGTRFGITLLGS  148



>ref|WP_045513267.1| allantoate amidohydrolase [Kosakonia oryzae]
Length=416

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 84/136 (62%), Gaps = 6/136 (4%)
 Frame = +2

Query  266  EAVSRLYE----LGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHG  433
            +A SR+ +    L ++S+    L R + SP  ++A  L+  WM+ AG+RTW D +GN+ G
Sbjct  9    QAASRVMQRCDALAQISETPGQLTRVYLSPQHLQANALVAGWMQQAGMRTWQDAVGNIFG  68

Query  434  RIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIA  613
            R EGI   G+ALL+GSHLDTV DAG +DG LG++ AI  +  L       +  + +E++ 
Sbjct  69   RYEGIEAGGQALLLGSHLDTVRDAGRYDGMLGVLAAIEVVDGLNRANL--RGRQAIEIVG  126

Query  614  FSDEEGVRFQSTFLGS  661
            F+DEEG RF    LGS
Sbjct  127  FADEEGTRFNIALLGS  142



>ref|WP_015958434.1| allantoate amidohydrolase [Klebsiella pneumoniae]
 gb|ABR77192.1| putative peptidase [Klebsiella pneumoniae subsp. pneumoniae MGH 
78578]
Length=419

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  QILKEEAVSRLY----ELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQM  418
            Q  +E A SR+      L  +S+  + L R + SP  ++A  L+  WM+ AG+  W D +
Sbjct  8    QAEREAAASRVMARADRLAALSETADALTRVYLSPEHLQANQLVGQWMQAAGMMVWQDSV  67

Query  419  GNVHGRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKP  598
            GN+ GR EG      ALL+GSHLDTV +AG +DG LG++ AI  ++ L   GR  +L+K 
Sbjct  68   GNICGRYEGQQEGAPALLLGSHLDTVRNAGRYDGMLGVLAAIEVVQRLHQQGR--RLAKA  125

Query  599  VEVIAFSDEEGVRFQSTFLGS  661
            +E++ F DEEG RF  T LGS
Sbjct  126  IEIVGFGDEEGTRFGITLLGS  146



>ref|WP_039157600.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=425

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  257  LKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGR  436
            L EE V R+ EL  +S+  + L R + +     A +LI  WM +AG+   +D +GNV GR
Sbjct  12   LGEEIVRRIDELAAISEDGDRLTRIYLTNELRSAADLILGWMREAGMSAHLDAIGNVCGR  71

Query  437  IEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAF  616
             EG  P    L++GSH DTV DAG +DG LG+ITAI+ +  L   G+  +L   +EVI F
Sbjct  72   YEGEQPGAPCLMLGSHYDTVRDAGKWDGPLGVITAIACVADLNRRGK--RLPFAIEVIGF  129

Query  617  SDEEGVRFQSTFLGS  661
            +DEEGVRF ST LGS
Sbjct  130  ADEEGVRFASTLLGS  144



>gb|AIU89518.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
odoriferum]
Length=417

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  251  QILKEEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVH  430
            Q+  E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ 
Sbjct  12   QVAAEQIMSRCDALAEMSETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNIC  71

Query  431  GRIEGINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVI  610
            GR EG+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++     G   +L   +E+I
Sbjct  72   GRYEGLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRAFHQQG--TRLPVALEII  129

Query  611  AFSDEEGVRFQSTFLGS  661
             F DEEG RF  T LGS
Sbjct  130  GFGDEEGTRFGITLLGS  146



>ref|WP_004860345.1| MULTISPECIES: allantoate amidohydrolase [Enterobacteriaceae]
 gb|EHT10928.1| hydantoinase/carbamoylase family amidase [Klebsiella oxytoca 
10-5246]
Length=420

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            E  ++R  EL  +S+    L R + SP  ++A   +  WM  AG+  W D +GN+ GR E
Sbjct  16   ERVMARADELAAISETAEGLTRVYLSPQHLQANQQVARWMTQAGMTVWQDSVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G      A+L+GSHLDTV +AG +DG LG++TAI  ++ L   GR  +L+K +E++ F D
Sbjct  76   GEQEGAPAILLGSHLDTVRNAGRYDGMLGVLTAIDVVENLHQQGR--RLAKAIEIVGFCD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



>ref|WP_010282609.1| allantoate amidohydrolase [Pectobacterium carotovorum]
 gb|KGA22375.1| allantoate amidohydrolase [Pectobacterium carotovorum subsp. 
brasiliense]
Length=420

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = +2

Query  263  EEAVSRLYELGKVSDADNYLERTFQSPASVRAGNLIRSWMEDAGLRTWIDQMGNVHGRIE  442
            E+ +SR   L ++S+    L R + S   +RA   +  WM +AG+  W D +GN+ GR E
Sbjct  16   EQIMSRCDALAEISETPGQLTRVYLSLEHLRANAQVGEWMREAGMNVWQDSVGNICGRYE  75

Query  443  GINPSGKALLIGSHLDTVIDAGYFDGSLGIITAISALKVLKTTGRLEKLSKPVEVIAFSD  622
            G+ P   ALL+GSHLDTV +AG +DG LG++TAI  ++ L   G   +L   +E+I F D
Sbjct  76   GLTPDAPALLLGSHLDTVRNAGRYDGMLGVLTAIEVVRALHQQGM--RLPVALEIIGFGD  133

Query  623  EEGVRFQSTFLGS  661
            EEG RF  T LGS
Sbjct  134  EEGTRFGITLLGS  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077441081409