BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1633

Length=901
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010109124.1|  hypothetical protein L484_000282                   154   9e-43   
ref|XP_011101030.1|  PREDICTED: probable polygalacturonase              159   2e-41   Sesamum indicum [beniseed]
gb|KDO76504.1|  hypothetical protein CISIN_1g0134021mg                  149   9e-41   Citrus sinensis [apfelsine]
emb|CDP12145.1|  unnamed protein product                                154   2e-39   Coffea canephora [robusta coffee]
ref|XP_008239046.1|  PREDICTED: probable polygalacturonase              150   3e-38   Prunus mume [ume]
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             150   4e-38   Prunus persica
ref|XP_002304552.2|  glycoside hydrolase family 28 family protein       149   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              148   3e-37   Sesamum indicum [beniseed]
ref|XP_011022514.1|  PREDICTED: probable polygalacturonase              148   3e-37   Populus euphratica
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    148   4e-37   Solanum lycopersicum
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    148   4e-37   Solanum lycopersicum
ref|XP_002509949.1|  Polygalacturonase precursor, putative              146   1e-36   Ricinus communis
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              146   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    146   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_010541551.1|  PREDICTED: probable polygalacturonase isofor...    146   2e-36   Tarenaya hassleriana [spider flower]
gb|AIU50408.1|  pectin lyase-like superfamily protein                   145   2e-36   Citrus clementina [clementine]
ref|XP_009603675.1|  PREDICTED: probable polygalacturonase              146   2e-36   
ref|XP_008437386.1|  PREDICTED: probable polygalacturonase              145   2e-36   Cucumis melo [Oriental melon]
ref|XP_006439367.1|  hypothetical protein CICLE_v10020162mg             145   2e-36   Citrus clementina [clementine]
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         145   3e-36   Solanum tuberosum [potatoes]
gb|AIU50410.1|  pectin lyase-like superfamily protein                   144   4e-36   Carica papaya [mamon]
ref|XP_004143871.1|  PREDICTED: probable polygalacturonase              145   4e-36   Cucumis sativus [cucumbers]
ref|XP_004298894.1|  PREDICTED: probable polygalacturonase              144   6e-36   Fragaria vesca subsp. vesca
ref|XP_010053124.1|  PREDICTED: probable polygalacturonase              144   8e-36   
gb|AIU50405.1|  pectin lyase-like superfamily protein                   143   9e-36   Theobroma cacao [chocolate]
gb|AIU50431.1|  pectin lyase-like superfamily protein                   143   1e-35   Prunus persica
ref|XP_012086739.1|  PREDICTED: probable polygalacturonase              144   1e-35   Jatropha curcas
gb|KHG27846.1|  putative polygalacturonase                              143   1e-35   Gossypium arboreum [tree cotton]
gb|AIU50409.1|  pectin lyase-like superfamily protein                   143   2e-35   Gossypium raimondii
ref|XP_010266478.1|  PREDICTED: probable polygalacturonase              143   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              143   2e-35   Theobroma cacao [chocolate]
gb|EYU40022.1|  hypothetical protein MIMGU_mgv1a006305mg                143   2e-35   Erythranthe guttata [common monkey flower]
gb|AIU50435.1|  pectin lyase-like superfamily protein                   142   2e-35   Ricinus communis
gb|AIU50430.1|  pectin lyase-like superfamily protein                   142   2e-35   Populus trichocarpa [western balsam poplar]
gb|KJB39697.1|  hypothetical protein B456_007G026000                    142   3e-35   Gossypium raimondii
ref|XP_009767931.1|  PREDICTED: probable polygalacturonase              142   3e-35   Nicotiana sylvestris
ref|XP_006283738.1|  hypothetical protein CARUB_v10004811mg             142   3e-35   Capsella rubella
gb|KJB39694.1|  hypothetical protein B456_007G026000                    142   4e-35   Gossypium raimondii
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         142   6e-35   
gb|AIU50397.1|  pectin lyase-like superfamily protein                   141   7e-35   Aquilegia coerulea [Rocky Mountain columbine]
gb|ACU23264.1|  unknown                                                 134   7e-35   Glycine max [soybeans]
ref|XP_006413510.1|  hypothetical protein EUTSA_v10025189mg             141   8e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              141   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              141   9e-35   Camelina sativa [gold-of-pleasure]
gb|AIU50439.1|  pectin lyase-like superfamily protein                   140   9e-35   Solanum lycopersicum
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              141   1e-34   Camelina sativa [gold-of-pleasure]
emb|CDX94222.1|  BnaC07g38560D                                          140   2e-34   
gb|AIU50426.1|  pectin lyase-like superfamily protein                   140   2e-34   Manihot esculenta [manioc]
emb|CDY10970.1|  BnaA03g46290D                                          140   2e-34   Brassica napus [oilseed rape]
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    140   2e-34   Arabis alpina [alpine rockcress]
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    140   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              140   2e-34   Brassica rapa
emb|CDY47619.1|  BnaA01g13460D                                          140   2e-34   Brassica napus [oilseed rape]
gb|AIU50443.1|  pectin lyase-like superfamily protein                   139   2e-34   Lactuca sativa [cultivated lettuce]
gb|AIU50411.1|  pectin lyase-like superfamily protein                   139   3e-34   Capsella rubella
gb|AIN44009.1|  polygalacturonase-like protein                          139   4e-34   Brassica juncea var. tumida [zha cai]
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              139   6e-34   Vitis vinifera
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              139   6e-34   Brassica rapa
gb|AIU50429.1|  pectin lyase-like superfamily protein                   138   7e-34   Solanum tuberosum [potatoes]
gb|KHG21610.1|  putative polygalacturonase                              138   1e-33   Gossypium arboreum [tree cotton]
gb|AIU50442.1|  pectin lyase-like superfamily protein                   137   2e-33   Vitis vinifera
gb|AIU50446.1|  pectin lyase-like superfamily protein                   137   2e-33   Platanus x hispanica [London plane tree]
gb|AIU50427.1|  pectin lyase-like superfamily protein                   137   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              137   2e-33   
gb|KJB24231.1|  hypothetical protein B456_004G134000                    135   3e-33   Gossypium raimondii
emb|CDY03516.1|  BnaC01g15660D                                          137   3e-33   
gb|AIU50416.1|  pectin lyase-like superfamily protein                   136   4e-33   Buxus sinica
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   136   4e-33   Arabidopsis halleri
gb|AIU50400.1|  pectin lyase-like superfamily protein                   135   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676306.1|  PREDICTED: probable polygalacturonase              136   7e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB24232.1|  hypothetical protein B456_004G134000                    134   1e-32   Gossypium raimondii
gb|KJB24230.1|  hypothetical protein B456_004G134000                    135   1e-32   Gossypium raimondii
gb|AIU50441.1|  pectin lyase-like superfamily protein                   134   1e-32   Schrenkiella parvula
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         134   2e-32   Glycine max [soybeans]
gb|KHN28527.1|  Putative polygalacturonase                              134   2e-32   Glycine soja [wild soybean]
gb|AIU50399.1|  pectin lyase-like superfamily protein                   133   5e-32   Arabidopsis lyrata [lyrate rockcress]
ref|XP_004491304.1|  PREDICTED: probable polygalacturonase-like         133   7e-32   Cicer arietinum [garbanzo]
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         132   2e-31   Glycine max [soybeans]
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    132   2e-31   Medicago truncatula
ref|XP_010055855.1|  PREDICTED: probable polygalacturonase              131   3e-31   Eucalyptus grandis [rose gum]
gb|AIU50413.1|  pectin lyase-like superfamily protein                   131   3e-31   Eucalyptus grandis [rose gum]
gb|KHN12010.1|  Putative polygalacturonase                              131   3e-31   Glycine soja [wild soybean]
ref|XP_003545367.1|  PREDICTED: probable polygalacturonase              131   3e-31   Glycine max [soybeans]
gb|AIU50424.1|  pectin lyase-like superfamily protein                   130   4e-31   Medicago truncatula
ref|XP_006837459.1|  PREDICTED: probable polygalacturonase              131   4e-31   Amborella trichopoda
gb|AIU50404.1|  pectin lyase-like superfamily protein                   130   4e-31   Pinellia ternata
gb|AIU50418.1|  pectin lyase-like superfamily protein                   130   5e-31   Chloranthus japonicus
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         130   6e-31   Cicer arietinum [garbanzo]
gb|AIU50437.1|  pectin lyase-like superfamily protein                   129   1e-30   Yucca filamentosa [Adam's-needle]
gb|AIU50423.1|  pectin lyase-like superfamily protein                   129   2e-30   Aristolochia tagala
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             129   2e-30   Phaseolus vulgaris [French bean]
gb|AIU50414.1|  pectin lyase-like superfamily protein                   128   3e-30   Glycine max [soybeans]
ref|XP_009380525.1|  PREDICTED: probable polygalacturonase              128   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU50451.1|  pectin lyase-like superfamily protein                   127   5e-30   Cabomba caroliniana
gb|AIU50407.1|  pectin lyase-like superfamily protein                   127   5e-30   Sarcandra glabra
gb|EPS61079.1|  hypothetical protein M569_13719                         127   6e-30   Genlisea aurea
gb|AIU50433.1|  pectin lyase-like superfamily protein                   127   8e-30   Phaseolus vulgaris [French bean]
gb|AIU50436.1|  pectin lyase-like superfamily protein                   126   1e-29   Dioscorea oppositifolia
ref|XP_003617307.1|  Glycoside hydrolase family 28 protein              127   1e-29   Medicago truncatula
gb|AIU50422.1|  pectin lyase-like superfamily protein                   125   2e-29   Asparagus officinalis
gb|AIU50421.1|  pectin lyase-like superfamily protein                   124   5e-29   Pandanus utilis
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             125   5e-29   Phaseolus vulgaris [French bean]
gb|AIU50420.1|  pectin lyase-like superfamily protein                   124   9e-29   Chimonanthus praecox [wintersweet]
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              123   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU50450.1|  pectin lyase-like superfamily protein                   122   4e-28   Alisma plantago-aquatica
ref|XP_008790157.1|  PREDICTED: probable polygalacturonase              122   5e-28   Phoenix dactylifera
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              121   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              121   1e-27   Elaeis guineensis
gb|AIU50401.1|  pectin lyase-like superfamily protein                   120   1e-27   Lilium brownii [Hong Kong lily]
ref|XP_010925748.1|  PREDICTED: probable polygalacturonase              120   2e-27   
gb|AIU50406.1|  pectin lyase-like superfamily protein                   118   4e-27   Acorus calamus [flagroot]
gb|AIU50417.1|  pectin lyase-like superfamily protein                   117   2e-26   Iris japonica
ref|XP_002451891.1|  hypothetical protein SORBIDRAFT_04g009310          116   6e-26   Sorghum bicolor [broomcorn]
gb|AIU50440.1|  pectin lyase-like superfamily protein                   115   7e-26   Sorghum bicolor [broomcorn]
gb|AIU50445.1|  pectin lyase-like superfamily protein                   115   9e-26   Cinnamomum camphora
gb|AFW65882.1|  hypothetical protein ZEAMMB73_311601                    110   9e-26   
gb|AIU50449.1|  pectin lyase-like superfamily protein                   114   2e-25   Zea mays [maize]
gb|AIU50425.1|  pectin lyase-like superfamily protein                   114   2e-25   Canna indica [canna]
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              114   3e-25   Phoenix dactylifera
gb|AFW65881.1|  hypothetical protein ZEAMMB73_311601                    110   3e-25   
gb|AIU50415.1|  pectin lyase-like superfamily protein                   113   4e-25   Illicium henryi
gb|AIU50447.1|  pectin lyase-like superfamily protein                   112   9e-25   Ginkgo biloba [ginkgo]
ref|XP_004951285.1|  PREDICTED: probable polygalacturonase-like         112   1e-24   Setaria italica
gb|AIU50438.1|  pectin lyase-like superfamily protein                   112   1e-24   Setaria italica
gb|AIU50448.1|  pectin lyase-like superfamily protein                   111   1e-24   Houttuynia cordata [chameleon-plant]
gb|AIU50403.1|  pectin lyase-like superfamily protein                   111   2e-24   Musa acuminata [banana]
gb|AIU50432.1|  pectin lyase-like superfamily protein                   110   3e-24   Panicum virgatum
ref|NP_001046468.1|  Os02g0256100                                       110   5e-24   
gb|EAY85246.1|  hypothetical protein OsI_06620                          110   6e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001170283.1|  uncharacterized protein LOC100384246 precursor     110   7e-24   Zea mays [maize]
ref|XP_010448059.1|  PREDICTED: probable polygalacturonase              109   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009395761.1|  PREDICTED: probable polygalacturonase              108   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY13383.1|  BnaC06g13740D                                          108   2e-23   Brassica napus [oilseed rape]
ref|XP_010533998.1|  PREDICTED: probable polygalacturonase              106   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_010441363.1|  PREDICTED: probable polygalacturonase              107   5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    107   7e-23   Elaeis guineensis
gb|AIU50402.1|  pectin lyase-like superfamily protein                   106   9e-23   Magnolia denudata [haku-mokuren]
ref|NP_199002.1|  pectin lyase-like superfamily protein                 105   2e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67513.1|  BnaA07g15530D                                          105   2e-22   
ref|XP_009125202.1|  PREDICTED: probable polygalacturonase              105   2e-22   Brassica rapa
ref|XP_004961056.1|  PREDICTED: probable polygalacturonase-like         105   3e-22   Setaria italica
ref|XP_002868572.1|  glycoside hydrolase family 28 protein              104   7e-22   Arabidopsis lyrata subsp. lyrata
emb|CDM83426.1|  unnamed protein product                                103   8e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006405300.1|  hypothetical protein EUTSA_v10027765mg             103   9e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006283728.1|  hypothetical protein CARUB_v10004799mg             102   4e-21   Capsella rubella
ref|XP_002441600.1|  hypothetical protein SORBIDRAFT_09g030140          101   8e-21   Sorghum bicolor [broomcorn]
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              101   9e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT32528.1|  Putative polygalacturonase                              101   9e-21   
gb|AIU50444.1|  pectin lyase-like superfamily protein                   100   2e-20   Ceratophyllum platyacanthum subsp. oryzetorum
ref|XP_004969187.1|  PREDICTED: probable polygalacturonase-like         100   2e-20   Setaria italica
gb|EAY99223.1|  hypothetical protein OsI_21181                        99.4    4e-20   Oryza sativa Indica Group [Indian rice]
ref|NP_001056466.1|  Os05g0587000                                     97.8    1e-19   
gb|AAT44156.1|  putative polygalacturonase                            98.2    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KFK32989.1|  hypothetical protein AALP_AA6G314900                  96.7    3e-19   Arabis alpina [alpine rockcress]
ref|XP_003569374.1|  PREDICTED: probable polygalacturonase            96.7    3e-19   Brachypodium distachyon [annual false brome]
ref|NP_001141464.1|  uncharacterized protein LOC100273574 precursor   96.3    6e-19   Zea mays [maize]
ref|XP_002455965.1|  hypothetical protein SORBIDRAFT_03g028140        95.5    1e-18   Sorghum bicolor [broomcorn]
gb|AIU50419.1|  pectin lyase-like superfamily protein                 93.6    2e-18   Ceratophyllum demersum [hornwort]
ref|XP_003570492.1|  PREDICTED: probable polygalacturonase            94.4    3e-18   Brachypodium distachyon [annual false brome]
ref|XP_008792847.1|  PREDICTED: probable polygalacturonase            94.0    4e-18   Phoenix dactylifera
ref|XP_008784337.1|  PREDICTED: probable polygalacturonase            92.8    1e-17   
dbj|BAJ94032.1|  predicted protein                                    87.4    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94644.1|  predicted protein                                    91.3    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89948.1|  predicted protein                                    90.9    4e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO73853.1|  hypothetical protein CISIN_1g0214491mg                88.2    5e-17   Citrus sinensis [apfelsine]
ref|XP_002883030.1|  hypothetical protein ARALYDRAFT_318449           90.5    5e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_008340766.1|  PREDICTED: probable polygalacturonase            89.4    1e-16   Malus domestica [apple tree]
dbj|BAA95779.1|  polygalacturonase-like protein                       89.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009346202.1|  PREDICTED: probable polygalacturonase            89.0    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_006474701.1|  PREDICTED: probable polygalacturonase-like       89.0    2e-16   Citrus sinensis [apfelsine]
gb|KEH37170.1|  polygalacturonase/glycoside hydrolase family protein  88.6    3e-16   Medicago truncatula
ref|NP_188308.1|  pectin lyase-like superfamily protein               88.2    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487815.1|  PREDICTED: probable polygalacturonase-like       88.2    3e-16   Cicer arietinum [garbanzo]
ref|XP_006297662.1|  hypothetical protein CARUB_v10013686mg           88.2    3e-16   Capsella rubella
gb|AAM62920.1|  polygalacturonase, putative                           88.2    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004245570.1|  PREDICTED: probable polygalacturonase            88.2    3e-16   Solanum lycopersicum
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase            88.2    3e-16   Nicotiana sylvestris
ref|XP_008223260.1|  PREDICTED: probable polygalacturonase            88.2    4e-16   Prunus mume [ume]
ref|XP_006646109.1|  PREDICTED: probable polygalacturonase-like       87.8    4e-16   
ref|XP_007223360.1|  hypothetical protein PRUPE_ppa005599mg           88.2    4e-16   Prunus persica
ref|XP_006452841.1|  hypothetical protein CICLE_v10008093mg           88.2    4e-16   Citrus clementina [clementine]
ref|XP_010487555.1|  PREDICTED: probable polygalacturonase            87.4    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010504717.1|  PREDICTED: probable polygalacturonase            87.4    5e-16   Camelina sativa [gold-of-pleasure]
dbj|BAK03831.1|  predicted protein                                    87.4    7e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002273305.1|  PREDICTED: probable polygalacturonase            87.0    7e-16   
emb|CBI22951.3|  unnamed protein product                              87.4    8e-16   Vitis vinifera
ref|XP_007138953.1|  hypothetical protein PHAVU_009G252200g           87.0    8e-16   Phaseolus vulgaris [French bean]
ref|XP_010917443.1|  PREDICTED: probable polygalacturonase            87.0    1e-15   Elaeis guineensis
gb|ABR18040.1|  unknown                                               86.7    1e-15   Picea sitchensis
gb|KHM99685.1|  Putative polygalacturonase                            86.3    1e-15   Glycine soja [wild soybean]
ref|XP_012084001.1|  PREDICTED: probable polygalacturonase            86.7    1e-15   Jatropha curcas
gb|KDP27854.1|  hypothetical protein JCGZ_18934                       86.7    1e-15   Jatropha curcas
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like       86.7    1e-15   Solanum tuberosum [potatoes]
ref|XP_011011880.1|  PREDICTED: probable polygalacturonase isofor...  86.3    2e-15   Populus euphratica
ref|XP_010465709.1|  PREDICTED: probable polygalacturonase            86.3    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_011651065.1|  PREDICTED: probable polygalacturonase isofor...  85.9    2e-15   Cucumis sativus [cucumbers]
ref|XP_008438913.1|  PREDICTED: probable polygalacturonase isofor...  85.9    2e-15   Cucumis melo [Oriental melon]
ref|XP_006345257.1|  PREDICTED: probable polygalacturonase-like       86.3    2e-15   Solanum tuberosum [potatoes]
ref|XP_012086833.1|  PREDICTED: probable polygalacturonase            85.9    2e-15   Jatropha curcas
ref|XP_010558428.1|  PREDICTED: probable polygalacturonase            85.9    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_010048020.1|  PREDICTED: probable polygalacturonase isofor...  85.9    2e-15   Eucalyptus grandis [rose gum]
gb|KHG18940.1|  putative polygalacturonase                            85.9    2e-15   Gossypium arboreum [tree cotton]
ref|XP_010048025.1|  PREDICTED: probable polygalacturonase isofor...  85.5    2e-15   Eucalyptus grandis [rose gum]
gb|AFK48190.1|  unknown                                               85.9    2e-15   Lotus japonicus
ref|XP_003533248.1|  PREDICTED: probable polygalacturonase isofor...  85.5    3e-15   Glycine max [soybeans]
ref|XP_004251701.1|  PREDICTED: probable polygalacturonase            85.5    3e-15   Solanum lycopersicum
ref|XP_008345224.1|  PREDICTED: probable polygalacturonase isofor...  85.5    3e-15   
emb|CDX95899.1|  BnaC05g36500D                                        85.5    3e-15   
emb|CDP20376.1|  unnamed protein product                              85.5    3e-15   Coffea canephora [robusta coffee]
ref|XP_011458751.1|  PREDICTED: probable polygalacturonase isofor...  85.5    3e-15   Fragaria vesca subsp. vesca
ref|XP_006406800.1|  hypothetical protein EUTSA_v10020710mg           85.5    3e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010670927.1|  PREDICTED: probable polygalacturonase            85.5    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006586911.1|  PREDICTED: probable polygalacturonase isofor...  85.5    3e-15   Glycine max [soybeans]
gb|KJB34665.1|  hypothetical protein B456_006G077400                  85.1    3e-15   Gossypium raimondii
gb|KHG14610.1|  putative polygalacturonase                            85.1    3e-15   Gossypium arboreum [tree cotton]
gb|KHN26517.1|  Putative polygalacturonase                            85.5    3e-15   Glycine soja [wild soybean]
ref|XP_012077081.1|  PREDICTED: probable polygalacturonase            85.5    3e-15   Jatropha curcas
ref|XP_010245458.1|  PREDICTED: probable polygalacturonase isofor...  85.1    3e-15   
gb|KHG12205.1|  putative polygalacturonase                            85.1    4e-15   Gossypium arboreum [tree cotton]
ref|XP_007035679.1|  Pectin lyase-like superfamily protein            85.5    4e-15   
gb|KJB72747.1|  hypothetical protein B456_011G194200                  85.1    4e-15   Gossypium raimondii
emb|CDX82390.1|  BnaA03g34310D                                        85.1    4e-15   
emb|CDY05885.1|  BnaC08g20620D                                        85.1    4e-15   
ref|XP_006380233.1|  glycoside hydrolase family 28 family protein     84.7    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011078124.1|  PREDICTED: probable polygalacturonase            85.1    4e-15   Sesamum indicum [beniseed]
gb|KJB38842.1|  hypothetical protein B456_006G260100                  84.7    4e-15   Gossypium raimondii
gb|KJB38840.1|  hypothetical protein B456_006G260100                  84.7    4e-15   Gossypium raimondii
emb|CDX92101.1|  BnaA05g23060D                                        84.7    5e-15   
gb|EYU25832.1|  hypothetical protein MIMGU_mgv1a004737mg              84.7    5e-15   Erythranthe guttata [common monkey flower]
ref|XP_002884608.1|  glycoside hydrolase family 28 protein            84.7    5e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_010245459.1|  PREDICTED: probable polygalacturonase isofor...  84.3    6e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006597720.1|  PREDICTED: probable polygalacturonase-like i...  84.3    6e-15   Glycine max [soybeans]
ref|XP_010548972.1|  PREDICTED: probable polygalacturonase            84.3    6e-15   Tarenaya hassleriana [spider flower]
ref|XP_007151453.1|  hypothetical protein PHAVU_004G047800g           84.3    6e-15   Phaseolus vulgaris [French bean]
gb|AFK44529.1|  unknown                                               84.3    7e-15   Lotus japonicus
ref|XP_009135501.1|  PREDICTED: probable polygalacturonase isofor...  84.3    7e-15   Brassica rapa
emb|CBI36899.3|  unnamed protein product                              84.3    7e-15   Vitis vinifera
ref|XP_010259446.1|  PREDICTED: probable polygalacturonase            84.3    7e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006597719.1|  PREDICTED: probable polygalacturonase-like i...  84.3    8e-15   Glycine max [soybeans]
ref|XP_009418007.1|  PREDICTED: probable polygalacturonase            84.3    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010047459.1|  PREDICTED: probable polygalacturonase            84.3    8e-15   Eucalyptus grandis [rose gum]
ref|XP_010652214.1|  PREDICTED: probable polygalacturonase            84.0    8e-15   Vitis vinifera
gb|KDO35850.1|  hypothetical protein CISIN_1g044614mg                 79.7    8e-15   Citrus sinensis [apfelsine]
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...  84.0    9e-15   Eucalyptus grandis [rose gum]
ref|XP_004508182.1|  PREDICTED: probable polygalacturonase-like       84.0    9e-15   Cicer arietinum [garbanzo]
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...  84.0    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004954128.1|  PREDICTED: probable polygalacturonase-like       84.0    1e-14   Setaria italica
ref|XP_010914507.1|  PREDICTED: probable polygalacturonase            83.6    1e-14   Elaeis guineensis
ref|XP_002314352.2|  hypothetical protein POPTR_0010s00770g           83.6    1e-14   
ref|XP_003528627.1|  PREDICTED: probable polygalacturonase-like i...  83.6    1e-14   Glycine max [soybeans]
gb|KHN02933.1|  Putative polygalacturonase                            83.6    1e-14   Glycine soja [wild soybean]
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...  83.6    1e-14   
ref|XP_010486207.1|  PREDICTED: probable polygalacturonase isofor...  83.6    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase            83.6    1e-14   Nicotiana tomentosiformis
ref|XP_010464263.1|  PREDICTED: probable polygalacturonase            83.6    1e-14   
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...  83.6    1e-14   Nicotiana tomentosiformis
ref|XP_007201026.1|  hypothetical protein PRUPE_ppa006130mg           83.2    1e-14   Prunus persica
ref|XP_003609706.1|  hypothetical protein MTR_4g120730                83.6    1e-14   Medicago truncatula
ref|XP_010931696.1|  PREDICTED: probable polygalacturonase            83.6    1e-14   Elaeis guineensis
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase            83.6    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_009346610.1|  PREDICTED: probable polygalacturonase isofor...  83.2    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_008235135.1|  PREDICTED: probable polygalacturonase            83.2    1e-14   
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase            83.6    1e-14   Populus euphratica
gb|KFK39027.1|  hypothetical protein AALP_AA3G191200                  83.2    1e-14   Arabis alpina [alpine rockcress]
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...  83.6    1e-14   Eucalyptus grandis [rose gum]
gb|EAZ12715.1|  hypothetical protein OsJ_02632                        83.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CDY56436.1|  BnaC07g49290D                                        83.2    2e-14   Brassica napus [oilseed rape]
gb|EAY74990.1|  hypothetical protein OsI_02888                        83.2    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_009149779.1|  PREDICTED: probable polygalacturonase            83.2    2e-14   Brassica rapa
ref|XP_009146055.1|  PREDICTED: probable polygalacturonase            83.2    2e-14   Brassica rapa
ref|XP_009369994.1|  PREDICTED: probable polygalacturonase isofor...  83.2    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_002516982.1|  Polygalacturonase, putative                      83.2    2e-14   
ref|XP_009346609.1|  PREDICTED: probable polygalacturonase isofor...  83.2    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_011011881.1|  PREDICTED: probable polygalacturonase isofor...  82.8    2e-14   Populus euphratica
ref|XP_009391724.1|  PREDICTED: probable polygalacturonase            83.2    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010444882.1|  PREDICTED: probable polygalacturonase isofor...  82.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|NP_850525.1|  polygalacturonase-like protein                      82.8    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009369995.1|  PREDICTED: probable polygalacturonase isofor...  82.8    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_007163148.1|  hypothetical protein PHAVU_001G210300g           82.8    2e-14   Phaseolus vulgaris [French bean]
ref|XP_008390626.1|  PREDICTED: probable polygalacturonase            83.2    2e-14   
emb|CDY08095.1|  BnaA06g16310D                                        82.8    2e-14   
ref|XP_008386709.1|  PREDICTED: probable polygalacturonase            82.8    2e-14   
ref|XP_008438914.1|  PREDICTED: probable polygalacturonase isofor...  82.8    2e-14   
ref|XP_011093863.1|  PREDICTED: probable polygalacturonase            82.8    2e-14   
gb|EYU28314.1|  hypothetical protein MIMGU_mgv1a005053mg              82.8    3e-14   
ref|XP_004979886.1|  PREDICTED: probable polygalacturonase-like       82.4    3e-14   
ref|XP_011462745.1|  PREDICTED: probable polygalacturonase            82.4    3e-14   
ref|XP_006367436.1|  PREDICTED: probable polygalacturonase-like       82.8    3e-14   
ref|XP_004134229.1|  PREDICTED: probable polygalacturonase isofor...  82.4    3e-14   
ref|NP_001032043.1|  pectin lyase-like superfamily protein            82.4    3e-14   
ref|XP_003550546.2|  PREDICTED: probable polygalacturonase-like       82.4    3e-14   
ref|NP_680409.1|  pectin lyase-like superfamily protein               82.4    3e-14   
gb|KHN03332.1|  Putative polygalacturonase                            82.4    3e-14   
ref|XP_009382969.1|  PREDICTED: probable polygalacturonase isofor...  82.4    3e-14   
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...  82.4    3e-14   
ref|XP_002509850.1|  polygalacturonase, putative                      82.4    3e-14   
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...  82.4    3e-14   
ref|XP_009382971.1|  PREDICTED: probable polygalacturonase isofor...  82.4    3e-14   
ref|XP_010273863.1|  PREDICTED: probable polygalacturonase            82.4    3e-14   
ref|XP_009597275.1|  PREDICTED: probable polygalacturonase            82.4    3e-14   
ref|XP_009378738.1|  PREDICTED: probable polygalacturonase isofor...  82.4    3e-14   
ref|XP_009382970.1|  PREDICTED: probable polygalacturonase isofor...  82.4    3e-14   
ref|XP_007154320.1|  hypothetical protein PHAVU_003G108700g           82.0    3e-14   
gb|AFK37962.1|  unknown                                               82.4    4e-14   
ref|XP_008345223.1|  PREDICTED: probable polygalacturonase isofor...  82.0    4e-14   
ref|XP_009378739.1|  PREDICTED: probable polygalacturonase isofor...  82.0    4e-14   
ref|XP_006419481.1|  hypothetical protein CICLE_v10004942mg           82.0    4e-14   
ref|XP_002875935.1|  predicted protein                                82.0    4e-14   
ref|XP_002324728.1|  glycoside hydrolase family 28 family protein     82.4    4e-14   
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g           82.0    4e-14   
ref|XP_006601494.1|  PREDICTED: uncharacterized protein LOC100795272  79.7    4e-14   
ref|XP_002989426.1|  hypothetical protein SELMODRAFT_129742           82.0    4e-14   
gb|KDO71782.1|  hypothetical protein CISIN_1g012788mg                 82.0    4e-14   
ref|XP_009414006.1|  PREDICTED: probable polygalacturonase            82.0    4e-14   
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...  82.0    4e-14   
ref|XP_003595343.1|  Polygalacturonase                                82.0    5e-14   
ref|XP_011007067.1|  PREDICTED: probable polygalacturonase            81.6    5e-14   
ref|XP_010937309.1|  PREDICTED: probable polygalacturonase            81.3    5e-14   
ref|XP_009151722.1|  PREDICTED: probable polygalacturonase isofor...  81.6    5e-14   
gb|EMT11866.1|  Putative polygalacturonase                            81.6    5e-14   
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...  82.0    5e-14   
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...  82.0    5e-14   
gb|AFW56470.1|  polygalacturonase                                     81.6    5e-14   
ref|XP_010094123.1|  putative polygalacturonase                       81.6    5e-14   
ref|XP_006297459.1|  hypothetical protein CARUB_v10013478mg           81.6    5e-14   
ref|XP_007209970.1|  hypothetical protein PRUPE_ppa004996mg           81.6    5e-14   
ref|XP_008390608.1|  PREDICTED: probable polygalacturonase            81.6    6e-14   
ref|XP_009135502.1|  PREDICTED: probable polygalacturonase isofor...  81.3    6e-14   
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g           81.6    6e-14   
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...  81.6    6e-14   
ref|XP_009151721.1|  PREDICTED: probable polygalacturonase isofor...  81.6    6e-14   
ref|XP_006297458.1|  hypothetical protein CARUB_v10013478mg           81.6    6e-14   
emb|CDY54633.1|  BnaCnng27510D                                        81.3    6e-14   
ref|XP_003519755.1|  PREDICTED: probable polygalacturonase            81.6    6e-14   
ref|XP_009151720.1|  PREDICTED: probable polygalacturonase isofor...  81.3    6e-14   
emb|CDY33922.1|  BnaA02g30650D                                        81.3    6e-14   
ref|XP_009779805.1|  PREDICTED: probable polygalacturonase            81.6    6e-14   
ref|XP_009151719.1|  PREDICTED: probable polygalacturonase isofor...  81.6    6e-14   
gb|KDO86268.1|  hypothetical protein CISIN_1g0090752mg                79.7    6e-14   
ref|XP_007145183.1|  hypothetical protein PHAVU_007G217500g           81.3    6e-14   
ref|XP_008807372.1|  PREDICTED: probable polygalacturonase            81.3    6e-14   
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g           81.6    7e-14   
emb|CDX86247.1|  BnaA06g29640D                                        81.6    7e-14   
ref|XP_006381596.1|  glycoside hydrolase family 28 family protein     81.3    7e-14   
ref|XP_007154563.1|  hypothetical protein PHAVU_003G129300g           81.3    7e-14   
gb|KHN16795.1|  Putative polygalacturonase                            81.3    7e-14   
ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...  81.3    7e-14   
ref|XP_009129767.1|  PREDICTED: probable polygalacturonase            81.3    7e-14   
ref|XP_004240097.1|  PREDICTED: probable polygalacturonase            81.3    7e-14   
gb|KHM99951.1|  Putative polygalacturonase                            81.3    7e-14   
ref|XP_002876665.1|  hypothetical protein ARALYDRAFT_907788           76.6    8e-14   
ref|XP_008810198.1|  PREDICTED: probable polygalacturonase isofor...  81.3    8e-14   
ref|XP_009134926.1|  PREDICTED: probable polygalacturonase            81.3    8e-14   
ref|XP_006395083.1|  hypothetical protein EUTSA_v10004215mg           81.3    8e-14   
ref|XP_004243697.1|  PREDICTED: probable polygalacturonase            81.3    8e-14   
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...  81.3    8e-14   
ref|XP_008810195.1|  PREDICTED: probable polygalacturonase isofor...  81.3    8e-14   
ref|XP_008679595.1|  PREDICTED: polygalacturonase isoform X1          81.3    8e-14   
emb|CDY05643.1|  BnaC02g38940D                                        81.3    8e-14   
ref|XP_008810197.1|  PREDICTED: probable polygalacturonase isofor...  81.3    8e-14   
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase            81.3    8e-14   
gb|AAZ32910.1|  polygalacturonase-like protein                        78.2    8e-14   
ref|XP_008810196.1|  PREDICTED: probable polygalacturonase isofor...  81.3    8e-14   
ref|XP_002863973.1|  polygalacturonase                                80.9    8e-14   
ref|XP_007012596.1|  Pectin lyase-like superfamily protein isoform 2  80.1    8e-14   
ref|XP_011458753.1|  PREDICTED: probable polygalacturonase isofor...  80.9    9e-14   
gb|ACR34461.1|  unknown                                               77.8    9e-14   
ref|XP_008238946.1|  PREDICTED: probable polygalacturonase            80.9    9e-14   
ref|NP_001140630.1|  uncharacterized protein LOC100272705             80.9    9e-14   
gb|KHN30667.1|  Putative polygalacturonase                            80.9    1e-13   
ref|XP_011092828.1|  PREDICTED: probable polygalacturonase            80.9    1e-13   
ref|XP_006588584.1|  PREDICTED: probable polygalacturonase-like       80.9    1e-13   
ref|XP_010550764.1|  PREDICTED: probable polygalacturonase            80.9    1e-13   
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like       80.9    1e-13   
ref|XP_002452925.1|  hypothetical protein SORBIDRAFT_04g035020        80.9    1e-13   
emb|CBI22657.3|  unnamed protein product                              79.7    1e-13   
ref|XP_006604728.1|  PREDICTED: probable polygalacturonase-like       80.9    1e-13   
ref|XP_011039956.1|  PREDICTED: probable polygalacturonase            80.9    1e-13   
ref|XP_006649098.1|  PREDICTED: probable polygalacturonase-like       80.9    1e-13   
ref|XP_006407904.1|  hypothetical protein EUTSA_v10020733mg           80.5    1e-13   
gb|KFK26573.1|  hypothetical protein AALP_AA8G266400                  80.1    1e-13   
ref|XP_003592200.1|  Polygalacturonase-like protein                   80.5    1e-13   
gb|ABM30197.2|  polygalacturonase                                     78.6    1e-13   
ref|XP_009767883.1|  PREDICTED: probable polygalacturonase            80.5    1e-13   
ref|NP_189881.1|  pectin lyase-like protein                           80.5    1e-13   
gb|AAN28906.1|  At3g42950/F18P9_110                                   80.5    1e-13   
gb|ABE66001.1|  glycoside hydrolase family 28 protein/polygalactu...  80.1    1e-13   
ref|XP_002962842.1|  hypothetical protein SELMODRAFT_78556            80.1    1e-13   
ref|XP_008676433.1|  PREDICTED: hypothetical protein isoform X2       79.3    1e-13   
gb|EYU35105.1|  hypothetical protein MIMGU_mgv1a005694mg              80.5    2e-13   
gb|KHN07886.1|  Putative polygalacturonase                            80.5    2e-13   
ref|XP_003542367.1|  PREDICTED: probable polygalacturonase            80.5    2e-13   
ref|NP_190464.1|  pectin lyase-like superfamily protein               80.1    2e-13   
ref|XP_006404169.1|  hypothetical protein EUTSA_v10010343mg           80.1    2e-13   
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...  80.1    2e-13   
ref|XP_010687547.1|  PREDICTED: probable polygalacturonase            80.1    2e-13   
ref|XP_006290991.1|  hypothetical protein CARUB_v10017105mg           80.1    2e-13   
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase            80.1    2e-13   
ref|XP_009389852.1|  PREDICTED: probable polygalacturonase            80.1    2e-13   
ref|NP_001130359.1|  hypothetical protein precursor                   80.1    2e-13   
emb|CDY08113.1|  BnaA06g16130D                                        80.1    2e-13   
gb|EPS72197.1|  hypothetical protein M569_02558                       80.1    2e-13   
ref|XP_002451220.1|  hypothetical protein SORBIDRAFT_05g025980        79.7    2e-13   
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...  80.1    2e-13   
ref|XP_008676432.1|  PREDICTED: hypothetical protein isoform X1       79.3    2e-13   
ref|XP_003533980.1|  PREDICTED: probable polygalacturonase-like       80.1    2e-13   
ref|XP_009149760.1|  PREDICTED: probable polygalacturonase            79.7    2e-13   
gb|KHN42438.1|  Putative polygalacturonase                            79.7    2e-13   
ref|XP_010089055.1|  putative polygalacturonase                       79.7    2e-13   
ref|NP_001240215.1|  uncharacterized protein LOC100785005 precursor   79.7    2e-13   
ref|XP_009363435.1|  PREDICTED: probable polygalacturonase            79.7    2e-13   
emb|CDP17099.1|  unnamed protein product                              79.7    2e-13   
gb|EMT06204.1|  Putative polygalacturonase                            80.1    2e-13   
gb|KHN09300.1|  Putative polygalacturonase                            79.3    2e-13   
gb|KFK33836.1|  glycoside hydrolase family 28 protein                 79.7    2e-13   
gb|ACJ85030.1|  unknown                                               75.5    2e-13   
gb|KJB65329.1|  hypothetical protein B456_010G090400                  79.7    2e-13   
gb|KHG16630.1|  putative polygalacturonase                            79.7    2e-13   
emb|CDY05907.1|  BnaC08g20840D                                        79.7    2e-13   
gb|ACR33948.1|  unknown                                               77.4    2e-13   
ref|XP_002273669.1|  PREDICTED: probable polygalacturonase            79.7    3e-13   
ref|XP_009385370.1|  PREDICTED: probable polygalacturonase            75.1    3e-13   
ref|XP_007012595.1|  Pectin lyase-like superfamily protein isoform 1  79.7    3e-13   
ref|XP_010426397.1|  PREDICTED: probable polygalacturonase            79.7    3e-13   
ref|XP_003551102.1|  PREDICTED: probable polygalacturonase-like i...  79.7    3e-13   
gb|EYU46763.1|  hypothetical protein MIMGU_mgv1a0060622mg             75.5    3e-13   
gb|KHN17737.1|  Putative polygalacturonase                            79.7    3e-13   
ref|XP_009401531.1|  PREDICTED: probable polygalacturonase            79.3    3e-13   
ref|XP_004496830.1|  PREDICTED: probable polygalacturonase-like       79.3    3e-13   
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase            79.3    3e-13   
gb|KJB41376.1|  hypothetical protein B456_007G102200                  79.3    3e-13   
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like       79.3    3e-13   
ref|XP_009359717.1|  PREDICTED: probable polygalacturonase            79.3    3e-13   
ref|NP_001148987.1|  polygalacturonase precursor                      79.3    4e-13   
gb|KJB41374.1|  hypothetical protein B456_007G102200                  79.3    4e-13   
ref|XP_008337834.1|  PREDICTED: probable polygalacturonase            79.3    4e-13   
gb|ACN35154.1|  unknown                                               79.0    4e-13   
gb|EMS65348.1|  putative polygalacturonase                            79.7    4e-13   
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg           79.3    4e-13   
gb|AFW04075.1|  polygalacturonase                                     79.3    4e-13   
ref|XP_006829063.1|  PREDICTED: probable polygalacturonase            79.0    4e-13   
ref|XP_010523770.1|  PREDICTED: probable polygalacturonase isofor...  79.0    4e-13   
ref|XP_010523769.1|  PREDICTED: probable polygalacturonase isofor...  79.0    4e-13   
ref|XP_008242267.1|  PREDICTED: probable polygalacturonase            79.0    4e-13   
ref|XP_003520745.2|  PREDICTED: probable polygalacturonase-like       79.0    4e-13   
ref|XP_002960960.1|  hypothetical protein SELMODRAFT_33152            78.6    4e-13   
ref|XP_003602622.1|  Germin-like protein                              79.3    4e-13   
ref|XP_002877258.1|  glycoside hydrolase family 28 protein            79.0    4e-13   
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg              79.0    4e-13   
ref|NP_001151479.1|  polygalacturonase precursor                      79.0    4e-13   
gb|KHN21786.1|  Putative polygalacturonase                            79.0    4e-13   
ref|XP_006589526.1|  PREDICTED: probable polygalacturonase-like i...  79.0    4e-13   
ref|XP_010413390.1|  PREDICTED: probable polygalacturonase            79.0    5e-13   
ref|XP_006339619.1|  PREDICTED: probable polygalacturonase-like       79.0    5e-13   
ref|XP_003535597.1|  PREDICTED: probable polygalacturonase-like i...  79.0    5e-13   
gb|ACN28107.1|  unknown                                               79.0    5e-13   
ref|XP_011007764.1|  PREDICTED: probable polygalacturonase isofor...  79.0    5e-13   
ref|XP_011007765.1|  PREDICTED: probable polygalacturonase isofor...  79.0    5e-13   
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470        79.0    5e-13   
ref|XP_004488101.1|  PREDICTED: probable polygalacturonase-like       79.0    5e-13   
ref|XP_010089056.1|  putative polygalacturonase                       78.6    5e-13   
gb|KHG15710.1|  hypothetical protein F383_10492                       79.0    5e-13   
gb|KJB06855.1|  hypothetical protein B456_001G016500                  79.0    5e-13   
gb|KHG19046.1|  putative polygalacturonase                            76.6    5e-13   
ref|XP_010450744.1|  PREDICTED: probable polygalacturonase            78.6    5e-13   
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                 78.6    6e-13   
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like       78.6    6e-13   
ref|XP_002967047.1|  hypothetical protein SELMODRAFT_408393           78.6    6e-13   
ref|XP_010535803.1|  PREDICTED: probable polygalacturonase            78.6    6e-13   
emb|CBI34379.3|  unnamed protein product                              78.6    6e-13   
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...  78.6    6e-13   
ref|XP_003535598.1|  PREDICTED: probable polygalacturonase-like       78.6    6e-13   
gb|KHG15709.1|  hypothetical protein F383_10492                       78.6    6e-13   
emb|CDY41934.1|  BnaC05g46700D                                        78.6    6e-13   
ref|XP_004503678.1|  PREDICTED: probable polygalacturonase-like i...  78.6    6e-13   
ref|XP_008661941.1|  PREDICTED: polygalacturonase isoform X1          78.6    6e-13   
gb|EPS58404.1|  hypothetical protein M569_16410                       78.6    7e-13   
ref|XP_003622464.1|  Polygalacturonase-like protein                   78.6    7e-13   
gb|KHN21784.1|  Putative polygalacturonase                            78.2    7e-13   
gb|KFK34205.1|  hypothetical protein AALP_AA5G114700                  79.0    7e-13   
gb|KFK34204.1|  hypothetical protein AALP_AA5G114700                  79.0    7e-13   
ref|XP_008343414.1|  PREDICTED: probable polygalacturonase            78.6    7e-13   
ref|XP_008660018.1|  PREDICTED: probable polygalacturonase            77.0    7e-13   
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase            78.2    7e-13   
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase            78.2    7e-13   
ref|XP_002468601.1|  hypothetical protein SORBIDRAFT_01g048880        78.2    7e-13   
ref|XP_006291035.1|  hypothetical protein CARUB_v10017147mg           78.2    7e-13   
ref|XP_007138636.1|  hypothetical protein PHAVU_009G225400g           78.2    7e-13   
ref|XP_003592197.1|  Endo-polygalacturonase-like protein              78.2    8e-13   
ref|XP_010503541.1|  PREDICTED: probable polygalacturonase            78.2    8e-13   
ref|XP_009624373.1|  PREDICTED: probable polygalacturonase            78.2    8e-13   
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase            78.2    8e-13   
ref|XP_009759849.1|  PREDICTED: probable polygalacturonase            78.2    8e-13   
gb|AES92177.2|  pectin lyase superfamily protein                      78.2    8e-13   
gb|KHF98838.1|  putative polygalacturonase                            76.3    8e-13   
emb|CBI40426.3|  unnamed protein product                              77.8    8e-13   
ref|XP_004234221.1|  PREDICTED: probable polygalacturonase            78.2    8e-13   
ref|XP_006419138.1|  hypothetical protein EUTSA_v10002498mg           78.2    9e-13   
ref|XP_002516244.1|  polygalacturonase, putative                      78.2    9e-13   
ref|XP_003609980.1|  Polygalacturonase-like protein                   78.2    9e-13   



>ref|XP_010109124.1| hypothetical protein L484_000282 [Morus notabilis]
 gb|EXC55735.1| hypothetical protein L484_000282 [Morus notabilis]
Length=116

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +3

Query  576  MSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            M  F  ++ L+  AVV     + +A E  TCS IVPM YR+DKISI DFGGVGDGRTLNT
Sbjct  1    MLRFATSVLLFLSAVV---APSLSAEELVTCSGIVPMRYRDDKISITDFGGVGDGRTLNT  57

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AFREAIYRIEHLRRRGGTLLYIPPGVYLT  FNLTSHMTLYLARGA
Sbjct  58   KAFREAIYRIEHLRRRGGTLLYIPPGVYLTESFNLTSHMTLYLARGA  104



>ref|XP_011101030.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=447

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            F  + L  + V+ LL    A  EWETCSWIVPM  R DKISI DFGGVGDG TLNT AFR
Sbjct  4    FDYLILLRIGVILLLSINYANAEWETCSWIVPMRNRYDKISITDFGGVGDGVTLNTKAFR  63

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AIYRIEHLRRRGGTLLYIPPG YLTGPFNLTSHMTLYLARGA
Sbjct  64   AAIYRIEHLRRRGGTLLYIPPGEYLTGPFNLTSHMTLYLARGA  106



>gb|KDO76504.1| hypothetical protein CISIN_1g0134021mg, partial [Citrus sinensis]
Length=108

 Score =   149 bits (375),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDG+TLNT AFREAIYRI+HLRR GGTLLY+PPGVYL
Sbjct  25   TCSGIVPMRYRNDKISITDFGGVGDGKTLNTKAFREAIYRIQHLRRSGGTLLYVPPGVYL  84

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  85   TGSFNLTSHMTLYLAKGA  102



>emb|CDP12145.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  639  AAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLL  818
              AA EW TCS IVPM YRNDKISI DFGGVGDGRTLNT AFREAIYRIEHLRRRGGTLL
Sbjct  21   CKAAAEWVTCSGIVPMRYRNDKISITDFGGVGDGRTLNTKAFREAIYRIEHLRRRGGTLL  80

Query  819  YIPPGVYLTGPFNLTSHMTLYLARGA  896
            Y+PPGVYLT  FNLTSHMTLYLARGA
Sbjct  81   YMPPGVYLTESFNLTSHMTLYLARGA  106



>ref|XP_008239046.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=442

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            LW    +FL  S  +  E  TCS IVPM YRNDKISI DFGGVGDG TLNT AFREAIYR
Sbjct  4    LWFSLSIFLCLSYFSVAEVVTCSGIVPMRYRNDKISITDFGGVGDGVTLNTKAFREAIYR  63

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            IEHL+RRGGTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  64   IEHLKRRGGTLLYIPPGVYLTESFNLTSHMTLYLAKGA  101



>ref|XP_007209143.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
 gb|EMJ10342.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
Length=442

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            LW    +FL  S  +  E  TCS IVPM YRNDKISI DFGGVGDG TLNT AFREAIYR
Sbjct  4    LWFSLSIFLCLSYFSVAEVVTCSGIVPMRYRNDKISITDFGGVGDGVTLNTKAFREAIYR  63

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            IEHL+RRGGTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  64   IEHLKRRGGTLLYIPPGVYLTESFNLTSHMTLYLAKGA  101



>ref|XP_002304552.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE79531.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=447

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +++++V FL  S    GE  TCS IVPM  RNDKISI DFGGVGDG+TLNT AFREA+YR
Sbjct  11   VFTISVSFL--SCITVGEVVTCSGIVPMRLRNDKISIADFGGVGDGKTLNTKAFREAVYR  68

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            I+HLRRRGGTLLYIPPGVYLT  FNLTSHMTLYLARGA
Sbjct  69   IQHLRRRGGTLLYIPPGVYLTESFNLTSHMTLYLARGA  106



>ref|XP_011073737.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
 ref|XP_011073743.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=449

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            F     + + V+ +   A A  E  TCS IVPM YR+DKISI DFGGVGDG TLNT AF+
Sbjct  6    FSIFVCFGIIVLLINCLALANAEEVTCSGIVPMRYRDDKISITDFGGVGDGVTLNTKAFK  65

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            EAIYRIEHL RRGGTLLY+PPG YLTGPFNLTSHMTLYLARGA
Sbjct  66   EAIYRIEHLHRRGGTLLYVPPGEYLTGPFNLTSHMTLYLARGA  108



>ref|XP_011022514.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=447

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +++++  FL  S    GE  TCS IVPM  RNDKISI DFGGVGDG+TLNT AFREAIYR
Sbjct  11   VFTISASFL--SCVTVGEVVTCSGIVPMRIRNDKISIADFGGVGDGKTLNTKAFREAIYR  68

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            I+HLRRRGGTLLYIPPGVYLT  FNLTSHMTLYLARGA
Sbjct  69   IQHLRRRGGTLLYIPPGVYLTESFNLTSHMTLYLARGA  106



>ref|XP_004245522.1| PREDICTED: probable polygalacturonase isoform X2 [Solanum lycopersicum]
Length=466

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  570  KIMSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTL  749
            +IM+ +  +I L  ++   LL S   A E ETCS IVPM YRNDKISI DFGGVGDGRTL
Sbjct  8    EIMNRWVGSIFLCIIST-LLLTSWLVAAEGETCSGIVPMQYRNDKISILDFGGVGDGRTL  66

Query  750  NTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            NT AF+EAI+RI+HL+R+GGTLLYIP GVYLTGPF+LTS MTLYLARGA
Sbjct  67   NTKAFKEAIFRIQHLKRKGGTLLYIPAGVYLTGPFDLTSRMTLYLARGA  115



>ref|XP_010325363.1| PREDICTED: probable polygalacturonase isoform X1 [Solanum lycopersicum]
Length=476

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  570  KIMSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTL  749
            +IM+ +  +I L  ++   LL S   A E ETCS IVPM YRNDKISI DFGGVGDGRTL
Sbjct  8    EIMNRWVGSIFLCIIST-LLLTSWLVAAEGETCSGIVPMQYRNDKISILDFGGVGDGRTL  66

Query  750  NTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            NT AF+EAI+RI+HL+R+GGTLLYIP GVYLTGPF+LTS MTLYLARGA
Sbjct  67   NTKAFKEAIFRIQHLKRKGGTLLYIPAGVYLTGPFDLTSRMTLYLARGA  115



>ref|XP_002509949.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF51336.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=446

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 1/92 (1%)
 Frame = +3

Query  621  VFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRR  800
            + ++ S  A G  ETCS IVPM YRNDKISI DFGGVGDG+T+NT AFR AIYRI+HL+R
Sbjct  15   ILMIYSTVAHGV-ETCSGIVPMRYRNDKISIADFGGVGDGKTVNTKAFRAAIYRIQHLKR  73

Query  801  RGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            RGGTLLYIPPGV+LTG FNLTSHMTLYLARGA
Sbjct  74   RGGTLLYIPPGVFLTGSFNLTSHMTLYLARGA  105



>ref|XP_010261531.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
 ref|XP_010261532.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=447

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  618  VVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLR  797
            +V  L+S +AAG+  TCS  VPM YR+DKISI DFGGVGDG TLNT AFR AIYRI+HLR
Sbjct  14   IVPFLKSTSAAGDVITCSGTVPMRYRSDKISITDFGGVGDGNTLNTQAFRAAIYRIQHLR  73

Query  798  RRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            RRGGTLLYIPPGVYLT  FNLTSHMTLYLAR A
Sbjct  74   RRGGTLLYIPPGVYLTESFNLTSHMTLYLARDA  106



>ref|XP_010541559.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=446

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 79/91 (87%), Gaps = 2/91 (2%)
 Frame = +3

Query  624  FLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRR  803
            F+  S++A  E ETCS IVP+ YRNDKISI DFGGVGDGRT+NT AFR AIYRI+HLRRR
Sbjct  18   FVFSSSSA--EPETCSGIVPVRYRNDKISITDFGGVGDGRTVNTKAFRAAIYRIQHLRRR  75

Query  804  GGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            GGTLLYIPPGVYLT  FNLTSHMTLYLARGA
Sbjct  76   GGTLLYIPPGVYLTESFNLTSHMTLYLARGA  106



>ref|XP_010541551.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=463

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 79/91 (87%), Gaps = 2/91 (2%)
 Frame = +3

Query  624  FLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRR  803
            F+  S++A  E ETCS IVP+ YRNDKISI DFGGVGDGRT+NT AFR AIYRI+HLRRR
Sbjct  18   FVFSSSSA--EPETCSGIVPVRYRNDKISITDFGGVGDGRTVNTKAFRAAIYRIQHLRRR  75

Query  804  GGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            GGTLLYIPPGVYLT  FNLTSHMTLYLARGA
Sbjct  76   GGTLLYIPPGVYLTESFNLTSHMTLYLARGA  106



>gb|AIU50408.1| pectin lyase-like superfamily protein, partial [Citrus clementina]
 gb|AIU50412.1| pectin lyase-like superfamily protein, partial [Citrus sinensis]
Length=406

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDG+TLNT AFREAIYRI+HLRR GGTLLY+PPGVYL
Sbjct  1    TCSGIVPMRYRNDKISITDFGGVGDGKTLNTKAFREAIYRIQHLRRSGGTLLYVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  61   TGSFNLTSHMTLYLAKGA  78



>ref|XP_009603675.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=448

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  576  MSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            M+ +  ++ L  ++++FL+    AA E ETCS IVPM YR DKISI D+GGVGDGRTLNT
Sbjct  1    MNKWVGSVFLCIVSILFLMNWPVAA-ELETCSGIVPMQYRYDKISILDYGGVGDGRTLNT  59

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AF+EAI+RI+HL+RRGG+LLY+P GVYLTGPFNLTS MTLYLARGA
Sbjct  60   KAFKEAIFRIQHLKRRGGSLLYVPAGVYLTGPFNLTSRMTLYLARGA  106



>ref|XP_008437386.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=445

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  627  LLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRG  806
            L  S  A  +  TCS IVPM YRNDKISI DFGG+GDGRTLNT AFR AIYRI+HLRRRG
Sbjct  15   LFPSPLAVADLITCSGIVPMKYRNDKISIADFGGIGDGRTLNTRAFRAAIYRIQHLRRRG  74

Query  807  GTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            GTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  75   GTLLYIPPGVYLTETFNLTSHMTLYLAKGA  104



>ref|XP_006439367.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
 gb|ESR52607.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
Length=443

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDG+TLNT AFREAIYRI+HLRR GGTLLY+PPGVYL
Sbjct  25   TCSGIVPMRYRNDKISITDFGGVGDGKTLNTKAFREAIYRIQHLRRSGGTLLYVPPGVYL  84

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  85   TGSFNLTSHMTLYLAKGA  102



>ref|XP_006343870.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=447

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  624  FLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRR  803
             LL S +   E ETCS IVPM YRNDKISI DFGGVGDGRTLNT AF+EAI+RI+HL+R+
Sbjct  16   LLLMSWSVVAEGETCSGIVPMQYRNDKISILDFGGVGDGRTLNTKAFKEAIFRIQHLKRK  75

Query  804  GGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            GGTLLYIP GVYLTGPF+LTS MTLYLA GA
Sbjct  76   GGTLLYIPAGVYLTGPFDLTSRMTLYLASGA  106



>gb|AIU50410.1| pectin lyase-like superfamily protein, partial [Carica papaya]
Length=405

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+SYRNDKISI DFGGVGDGRTLNT AFR AIYRI+HLRRRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPLSYRNDKISITDFGGVGDGRTLNTKAFRAAIYRIQHLRRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  61   TESFNLTSHMTLYLARGA  78



>ref|XP_004143871.1| PREDICTED: probable polygalacturonase [Cucumis sativus]
 gb|KGN50025.1| hypothetical protein Csa_5G150430 [Cucumis sativus]
Length=445

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  636  SAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTL  815
            S  A  +  TCS IVPM YRNDKISI DFGG+GDGRTLNT AFR AIYRI+HLRRRGGTL
Sbjct  18   SPLAVADLTTCSGIVPMKYRNDKISIADFGGIGDGRTLNTRAFRAAIYRIQHLRRRGGTL  77

Query  816  LYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  78   LYIPPGVYLTETFNLTSHMTLYLAKGA  104



>ref|XP_004298894.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
 ref|XP_011463978.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  603  LWSMAVVFL-LRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIY  779
            LW    +FL L  ++ A E  TCS IVPM YR DKISIKDFGGVGDG T+NT AFR AIY
Sbjct  4    LWFFLSIFLSLSYSSTATEPVTCSGIVPMKYRYDKISIKDFGGVGDGVTVNTKAFRAAIY  63

Query  780  RIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            RI+HL RRGGTLLYIPPGVYLT  FNLTSHMTLYLARGA
Sbjct  64   RIQHLHRRGGTLLYIPPGVYLTESFNLTSHMTLYLARGA  102



>ref|XP_010053124.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010053125.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77376.1| hypothetical protein EUGRSUZ_D01730 [Eucalyptus grandis]
Length=449

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  642  AAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLY  821
              AG   TCS IVPM YRNDKISI DFGGVGDGRT+NT AF EAIYRI+HLRRRGGTLLY
Sbjct  22   GVAGSMITCSGIVPMRYRNDKISITDFGGVGDGRTVNTKAFSEAIYRIQHLRRRGGTLLY  81

Query  822  IPPGVYLTGPFNLTSHMTLYLARGA  896
            IPPGVYLTG F+LTSHMTLYLA GA
Sbjct  82   IPPGVYLTGSFSLTSHMTLYLASGA  106



>gb|AIU50405.1| pectin lyase-like superfamily protein, partial [Theobroma cacao]
Length=406

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDGRTLNT AFR AIYRI+HLRRRGGTLLY+PPGVYL
Sbjct  1    TCSGIVPMRYRNDKISITDFGGVGDGRTLNTKAFRAAIYRIQHLRRRGGTLLYVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  61   TESFNLTSHMTLYLARGA  78



>gb|AIU50431.1| pectin lyase-like superfamily protein, partial [Prunus persica]
Length=406

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDG TLNT AFREAIYRIEHL+RRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPMRYRNDKISITDFGGVGDGVTLNTKAFREAIYRIEHLKRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLA+GA
Sbjct  61   TESFNLTSHMTLYLAKGA  78



>ref|XP_012086739.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 gb|KDP25309.1| hypothetical protein JCGZ_20465 [Jatropha curcas]
Length=448

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 82/105 (78%), Gaps = 5/105 (5%)
 Frame = +3

Query  582  PFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNA  761
            P F   S++    V L R  A +GE  TCS IVP+ YRNDKISI DFGGVGDGRTLNT A
Sbjct  7    PIFLCFSIF----VLLSRPLAVSGE-VTCSGIVPVRYRNDKISITDFGGVGDGRTLNTKA  61

Query  762  FREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            F EAIY+I+HLRRRGGTLLYIP GVYLT  FNLTSHMTLYLARGA
Sbjct  62   FSEAIYQIQHLRRRGGTLLYIPAGVYLTESFNLTSHMTLYLARGA  106



>gb|KHG27846.1| putative polygalacturonase [Gossypium arboreum]
Length=404

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YR DK+SI DFGGVGDG+TLNT AFREAIYRI+HLRRRGGTLLY+PPGVYL
Sbjct  28   TCSGIVPMRYRKDKVSITDFGGVGDGKTLNTKAFREAIYRIQHLRRRGGTLLYVPPGVYL  87

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  88   TESFNLTSHMTLYLARGA  105



>gb|AIU50409.1| pectin lyase-like superfamily protein, partial [Gossypium raimondii]
Length=406

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP  YRNDK+SI DFGGVGDG+TLNT AFREAIYRI+HLRRRGGTLLY+PPGVYL
Sbjct  1    TCSGIVPTRYRNDKVSITDFGGVGDGKTLNTKAFREAIYRIQHLRRRGGTLLYVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  61   TESFNLTSHMTLYLARGA  78



>ref|XP_010266478.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=448

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  615  AVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHL  794
            A+V  L+  +A G+  TCS  VPM YR+DKISI DFGGVGDGRTLNT AFR AIYRI+HL
Sbjct  14   AMVPFLKYTSAIGDVITCSGTVPMRYRSDKISITDFGGVGDGRTLNTKAFRAAIYRIQHL  73

Query  795  RRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            RRRGGTLLYIPPGVYLT  FNLTSHMTLYLA+ A
Sbjct  74   RRRGGTLLYIPPGVYLTESFNLTSHMTLYLAKDA  107



>ref|XP_007040496.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY24997.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=448

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G   TCS IVPM YRNDKISI DFGGVGDGRTLNT AFR AIYRI+HLRRRGGTLLY+PP
Sbjct  26   GNLITCSGIVPMRYRNDKISITDFGGVGDGRTLNTKAFRAAIYRIQHLRRRGGTLLYVPP  85

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT  FNLTSHMTLYLARGA
Sbjct  86   GVYLTESFNLTSHMTLYLARGA  107



>gb|EYU40022.1| hypothetical protein MIMGU_mgv1a006305mg [Erythranthe guttata]
Length=449

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            F   S + + ++ +  SA A  +  TCS IVPM  R D+ISI+DFGGVGDG TLNTNAFR
Sbjct  6    FAIFSCFGVLLLVMNCSAPANADVATCSGIVPMRIREDRISIEDFGGVGDGVTLNTNAFR  65

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            +AIYRIEHL R GGT+LYIPPG YLTGPFNLTSHMTLYLAR A
Sbjct  66   KAIYRIEHLNRTGGTILYIPPGEYLTGPFNLTSHMTLYLARDA  108



>gb|AIU50435.1| pectin lyase-like superfamily protein, partial [Ricinus communis]
Length=406

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDG+T+NT AFR AIYRI+HL+RRGGTLLYIPPGV+L
Sbjct  1    TCSGIVPMRYRNDKISIADFGGVGDGKTVNTKAFRAAIYRIQHLKRRGGTLLYIPPGVFL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLARGA
Sbjct  61   TGSFNLTSHMTLYLARGA  78



>gb|AIU50430.1| pectin lyase-like superfamily protein, partial [Populus trichocarpa]
Length=406

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM  RNDKISI DFGGVGDG+TLNT AFREA+YRI+HLRRRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPMRLRNDKISIADFGGVGDGKTLNTKAFREAVYRIQHLRRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  61   TESFNLTSHMTLYLARGA  78



>gb|KJB39697.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=446

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP  YRNDK+SI DFGGVGDG+TLNT AFREAIYRI+HLRRRGGTLLY+PPGVYL
Sbjct  28   TCSGIVPTRYRNDKVSITDFGGVGDGKTLNTKAFREAIYRIQHLRRRGGTLLYVPPGVYL  87

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  88   TESFNLTSHMTLYLARGA  105



>ref|XP_009767931.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=454

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  621  VFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRR  800
            + LL + +   E ETCS IVPM YR DKIS+ D+GGVGDGRTLNT AF EAI+RI+HL+R
Sbjct  15   MLLLMNGSVVAEVETCSGIVPMQYRYDKISLLDYGGVGDGRTLNTKAFMEAIFRIQHLKR  74

Query  801  RGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            RGGTLLY+P GVYLTGPFNLTS MTLYLARGA
Sbjct  75   RGGTLLYVPAGVYLTGPFNLTSRMTLYLARGA  106



>ref|XP_006283738.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
 gb|EOA16636.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
Length=444

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 1/91 (1%)
 Frame = +3

Query  627  LLRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRR  803
            L+ S+++ G+ E TCS IVP+ YRNDKISI DFGGVGDGRT+NT AFR A+YRI+HL+RR
Sbjct  14   LVLSSSSFGDSEVTCSGIVPLRYRNDKISITDFGGVGDGRTVNTKAFRAAMYRIQHLKRR  73

Query  804  GGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            GGTLLYIPPGVYLT  FNLTSHMTLYLARGA
Sbjct  74   GGTLLYIPPGVYLTESFNLTSHMTLYLARGA  104



>gb|KJB39694.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=427

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP  YRNDK+SI DFGGVGDG+TLNT AFREAIYRI+HLRRRGGTLLY+PPGVYL
Sbjct  28   TCSGIVPTRYRNDKVSITDFGGVGDGKTLNTKAFREAIYRIQHLRRRGGTLLYVPPGVYL  87

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  88   TESFNLTSHMTLYLARGA  105



>ref|XP_006476397.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=443

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDG+TLNT AF EAIYRI+HLRR GGTLL+IPPGVYL
Sbjct  25   TCSGIVPMRYRNDKISITDFGGVGDGKTLNTKAFLEAIYRIQHLRRSGGTLLFIPPGVYL  84

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  85   TGSFNLTSHMTLYLAKGA  102



>gb|AIU50397.1| pectin lyase-like superfamily protein, partial [Aquilegia coerulea]
Length=406

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YR D ISI DFGGVGDG TLNT AFREAIYRIEHL+RRGGT+LYIPPGV+L
Sbjct  1    TCSGIVPMKYRQDTISITDFGGVGDGHTLNTKAFREAIYRIEHLKRRGGTILYIPPGVFL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  61   TGSFNLTSHMTLYLAKGA  78



>gb|ACU23264.1| unknown [Glycine max]
Length=126

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            GE  +CS IV + +R D ISI +FGGVGDGRTLNT AFREAIYR++HL R GGTLLY+PP
Sbjct  25   GETASCSNIVALGHRTDNISITEFGGVGDGRTLNTKAFREAIYRVQHLPREGGTLLYVPP  84

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT PFNLTSHMTLYLA GA
Sbjct  85   GVYLTEPFNLTSHMTLYLAAGA  106



>ref|XP_006413510.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
 gb|ESQ54963.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
Length=449

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +3

Query  618  VVFLLRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHL  794
            V FL  S++A G+ E TCS IVP+ YR DKISI DFGGVGDGR +NT AFR AIYRI+HL
Sbjct  16   VSFLAVSSSAFGDSEATCSGIVPLRYRKDKISITDFGGVGDGRKVNTKAFRAAIYRIQHL  75

Query  795  RRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            +RRGGTLLYIPPGV+LT  FNLTSHMTLYLARGA
Sbjct  76   KRRGGTLLYIPPGVFLTESFNLTSHMTLYLARGA  109



>ref|XP_010433858.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 6/104 (6%)
 Frame = +3

Query  603  LWSMAVVFLLRS-----AAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
            +W +    LL S     +A+ G+ E TCS IVP+ YRNDKISI D+GGVGDGRT+NT AF
Sbjct  1    MWRLLASVLLFSCLFVYSASLGDSEVTCSGIVPLRYRNDKISITDYGGVGDGRTVNTKAF  60

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            R AIYRI+HL+RRGGTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  61   RAAIYRIQHLKRRGGTLLYIPPGVYLTESFNLTSHMTLYLAKGA  104



>ref|XP_010448653.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = +3

Query  627  LLRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRR  803
            L+ S+ + G+ E TCS IVP+ YRNDKISI D+GGVGDGRT+NT AFR AIYRI+HL+RR
Sbjct  14   LIVSSLSLGDSEVTCSGIVPLRYRNDKISITDYGGVGDGRTVNTKAFRAAIYRIQHLKRR  73

Query  804  GGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            GGTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  74   GGTLLYIPPGVYLTESFNLTSHMTLYLAKGA  104



>gb|AIU50439.1| pectin lyase-like superfamily protein, partial [Solanum lycopersicum]
Length=406

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDGRTLNT AF+EAI+RI+HL+R+GGTLLYIP GVYL
Sbjct  1    TCSGIVPMQYRNDKISILDFGGVGDGRTLNTKAFKEAIFRIQHLKRKGGTLLYIPAGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPF+LTS MTLYLARGA
Sbjct  61   TGPFDLTSRMTLYLARGA  78



>ref|XP_010439131.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 84/105 (80%), Gaps = 5/105 (5%)
 Frame = +3

Query  585  FFQTISLWSMAVVFLLRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNA  761
               +I L+S   V+    +++ GE E TCS IVP+ YRNDKISI D+GGVGDGRT+NT A
Sbjct  4    LLASIILFSCLFVY----SSSLGESEVTCSGIVPLRYRNDKISITDYGGVGDGRTVNTKA  59

Query  762  FREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            FR AIYRI+HL+RRGGTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  60   FRAAIYRIQHLKRRGGTLLYIPPGVYLTESFNLTSHMTLYLAKGA  104



>emb|CDX94222.1| BnaC07g38560D [Brassica napus]
Length=451

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 11/107 (10%)
 Frame = +3

Query  609  SMAVVFL----------LRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            S++VVFL          L SA   G+ E TCS IVP+ YRNDKISI DFGGVGDGRT+NT
Sbjct  5    SISVVFLPCFAAFLLTALSSAYGYGDSEATCSGIVPLKYRNDKISITDFGGVGDGRTVNT  64

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AFR AIYRI+HLRRRGGT+LYIPPGV+LT  F+LTSHMTL+LARGA
Sbjct  65   KAFRAAIYRIQHLRRRGGTVLYIPPGVFLTESFSLTSHMTLFLARGA  111



>gb|AIU50426.1| pectin lyase-like superfamily protein, partial [Manihot esculenta]
Length=406

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRND ISI DFGGVGDG TLNT AFREAIYRI+HL R GGTLLYIPPGVYL
Sbjct  1    TCSGIVPMRYRNDNISITDFGGVGDGMTLNTKAFREAIYRIQHLSRSGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  61   TGSFNLTSHMTLYLAKGA  78



>emb|CDY10970.1| BnaA03g46290D [Brassica napus]
Length=451

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 11/107 (10%)
 Frame = +3

Query  609  SMAVVFL----------LRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            S++VVFL          L SA   G+ E TCS IVP+ YRNDKISI DFGGVGDGRT+NT
Sbjct  5    SISVVFLPCIAAFLLTALSSAYGYGDSEATCSGIVPLRYRNDKISITDFGGVGDGRTVNT  64

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AFR AIYRI+HLRRRGGT+LYIPPGV+LT  F+LTSHMTL+LARGA
Sbjct  65   KAFRAAIYRIQHLRRRGGTVLYIPPGVFLTESFSLTSHMTLFLARGA  111



>gb|KFK28938.1| hypothetical protein AALP_AA7G068200 [Arabis alpina]
Length=445

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 4/95 (4%)
 Frame = +3

Query  612  MAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEH  791
            +A +F + S++ A    TCS IVP+ YRNDKISI DFGGVGDG+T+NT AFR AIYRI+H
Sbjct  15   VASIFTVASSSEA----TCSGIVPLRYRNDKISITDFGGVGDGKTVNTKAFRAAIYRIQH  70

Query  792  LRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            L+RRGGT+LYIPPGV+LT  FNLTSHMTLYLARGA
Sbjct  71   LKRRGGTVLYIPPGVFLTESFNLTSHMTLYLARGA  105



>ref|NP_194113.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
 emb|CAA23048.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAB81300.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAL32775.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAM91193.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE84810.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
Length=444

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  594  TISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREA  773
            ++S++  + +F+  S+    E  TCS IVP+ YR DKISI DFGGVGDGRT+NT AFR A
Sbjct  5    SVSIFLFSCLFVSSSSLGDSE-ATCSGIVPLRYRYDKISITDFGGVGDGRTVNTKAFRAA  63

Query  774  IYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            IYRI+HL+RRGGTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  64   IYRIQHLKRRGGTLLYIPPGVYLTESFNLTSHMTLYLAKGA  104



>ref|XP_009137402.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=444

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 6/104 (6%)
 Frame = +3

Query  603  LWSMAVVFLL-----RSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
            +W  +V+ LL      S+++ G+ E TCS IVP+  RND+ISI DFGGVGDGRT+NT AF
Sbjct  1    MWRFSVLILLCSHLAVSSSSLGDSEATCSGIVPLPNRNDRISITDFGGVGDGRTVNTKAF  60

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            REAIYRI+HL+RRGGTLLYIPPGV+LT  FNLTSHMTL+LA+GA
Sbjct  61   REAIYRIQHLKRRGGTLLYIPPGVFLTESFNLTSHMTLFLAKGA  104



>emb|CDY47619.1| BnaA01g13460D [Brassica napus]
Length=444

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 6/104 (6%)
 Frame = +3

Query  603  LWSMAVVFLL-----RSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
            +W  +V+ LL      S+++ G+ E TCS IVP+  RND+ISI DFGGVGDGRT+NT AF
Sbjct  1    MWRFSVLILLFSHLAVSSSSLGDSEATCSGIVPLPNRNDRISITDFGGVGDGRTVNTKAF  60

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            REAIYRI+HL+RRGGTLLYIPPGV+LT  FNLTSHMTL+LA+GA
Sbjct  61   REAIYRIQHLKRRGGTLLYIPPGVFLTESFNLTSHMTLFLAKGA  104



>gb|AIU50443.1| pectin lyase-like superfamily protein, partial [Lactuca sativa]
Length=406

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM+YR+DKISI DFG VGDGRTLNT AFREAIYRIEHL+RRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPMAYRSDKISITDFGAVGDGRTLNTKAFREAIYRIEHLKRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTS MTLYLA+GA
Sbjct  61   TESFNLTSRMTLYLAKGA  78



>gb|AIU50411.1| pectin lyase-like superfamily protein, partial [Capsella rubella]
Length=406

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+ YRNDKISI DFGGVGDGRT+NT AFR A+YRI+HL+RRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPLRYRNDKISITDFGGVGDGRTVNTKAFRAAMYRIQHLKRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  61   TESFNLTSHMTLYLARGA  78



>gb|AIN44009.1| polygalacturonase-like protein [Brassica juncea var. tumida]
Length=451

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 83/107 (78%), Gaps = 11/107 (10%)
 Frame = +3

Query  609  SMAVVFL----------LRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            S++VVFL          L SA   G  E TCS IVP+ YRNDKISI DFGGVGDGRT+NT
Sbjct  5    SLSVVFLPCLAAFLLTALSSAYGYGNSEATCSGIVPLRYRNDKISITDFGGVGDGRTVNT  64

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AFR AIYRI+HLRRRGGT+LYIPPGV+LT  F+LTSHMTL+LARGA
Sbjct  65   KAFRAAIYRIQHLRRRGGTVLYIPPGVFLTESFSLTSHMTLFLARGA  111



>ref|XP_010659126.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 emb|CBI34471.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +3

Query  576  MSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            M  F   I L   A    L     AG+  TCS IVPM +RND ISIKDFGGVGDG+TLNT
Sbjct  1    MCRFVVWIFLCFAATALFLTRLVLAGD-VTCSGIVPMRHRNDVISIKDFGGVGDGKTLNT  59

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AFR AIYRIEHLRRRGGTLLYIPPGVYLT  FNLTSHMTLYL++ A
Sbjct  60   KAFRAAIYRIEHLRRRGGTLLYIPPGVYLTESFNLTSHMTLYLSKDA  106



>ref|XP_009137393.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=451

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 11/107 (10%)
 Frame = +3

Query  609  SMAVVFL----------LRSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            S++VVFL          L SA   G+ E TCS IVP+ YRNDKISI DFGGVGDGRT+N+
Sbjct  5    SISVVFLPCIAAFLLTALSSAYGYGDSEATCSGIVPLRYRNDKISITDFGGVGDGRTVNS  64

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AFR AIYRI+HLRRRGGT+LYIPPGV+LT  F+LTSHMTL+LARGA
Sbjct  65   KAFRAAIYRIQHLRRRGGTVLYIPPGVFLTESFSLTSHMTLFLARGA  111



>gb|AIU50429.1| pectin lyase-like superfamily protein, partial [Solanum tuberosum]
Length=406

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YRNDKISI DFGGVGDGRTLNT AF+EAI+RI+HL+R+GGTLLYIP GVYL
Sbjct  1    TCSGIVPMQYRNDKISILDFGGVGDGRTLNTKAFKEAIFRIQHLKRKGGTLLYIPAGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPF+LTS MTLYLA GA
Sbjct  61   TGPFDLTSRMTLYLASGA  78



>gb|KHG21610.1| putative polygalacturonase [Gossypium arboreum]
Length=448

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+  TCS IVPM+ R DKISI DFGGVGDG+TLNT AFR+AIYRI+HLRRRGGTLL++P 
Sbjct  26   GDLTTCSGIVPMTERGDKISITDFGGVGDGQTLNTIAFRKAIYRIQHLRRRGGTLLFVPS  85

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLTG FNLTSHMTLYLARGA
Sbjct  86   GVYLTGSFNLTSHMTLYLARGA  107



>gb|AIU50442.1| pectin lyase-like superfamily protein, partial [Vitis vinifera]
Length=406

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM +RND ISIKDFGGVGDG+TLNT AFR AIYRIEHLRRRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPMRHRNDVISIKDFGGVGDGKTLNTKAFRAAIYRIEHLRRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYL++ A
Sbjct  61   TESFNLTSHMTLYLSKDA  78



>gb|AIU50446.1| pectin lyase-like superfamily protein, partial [Platanus x acerifolia]
Length=406

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS +VPM YR+DKISI DFG VGDGRTLNT +FR AIYRIEHL RRGGTLLYIPPGVYL
Sbjct  1    TCSGMVPMRYRSDKISITDFGAVGDGRTLNTRSFRAAIYRIEHLMRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  61   TGSFNLTSHMTLYLAKGA  78



>gb|AIU50427.1| pectin lyase-like superfamily protein, partial [Erythranthe guttata]
Length=406

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM  R D+ISI+DFGGVGDG TLNTNAFR+AIYRIEHL R GGT+LYIPPG YL
Sbjct  1    TCSGIVPMRIREDRISIEDFGGVGDGVTLNTNAFRKAIYRIEHLNRTGGTILYIPPGEYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTLYLAR A
Sbjct  61   TGPFNLTSHMTLYLARDA  78



>ref|XP_002867688.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43947.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 6/104 (6%)
 Frame = +3

Query  603  LWSMAV-VFLLR----SAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
            +W ++V +FL      S+++ G+ E TCS IVP+ YR DKISI D+GGVGDGRT+NT AF
Sbjct  1    MWRLSVSIFLFSCLAVSSSSYGDSEATCSGIVPLRYRYDKISITDYGGVGDGRTVNTKAF  60

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            R AIYRI+HL+RRGGTLLYIPPGVYLT  FNLTSHMT YLA+GA
Sbjct  61   RAAIYRIQHLKRRGGTLLYIPPGVYLTESFNLTSHMTFYLAKGA  104



>gb|KJB24231.1| hypothetical protein B456_004G134000 [Gossypium raimondii]
Length=308

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+  TCS IVPM+ R DKISI DFGGVGDG+TLNT AFR+AIYRI+HLRRRGGTLL++P 
Sbjct  26   GDLTTCSGIVPMTERGDKISITDFGGVGDGQTLNTIAFRKAIYRIQHLRRRGGTLLFVPS  85

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT  FNLTSHMTLYLARGA
Sbjct  86   GVYLTDSFNLTSHMTLYLARGA  107



>emb|CDY03516.1| BnaC01g15660D [Brassica napus]
Length=444

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 84/104 (81%), Gaps = 6/104 (6%)
 Frame = +3

Query  603  LWSMAVVFLL-----RSAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
            +W  +V+ LL      S+++ G+ E TCS IV +  RND+ISI DFGGVGDGRT+NT AF
Sbjct  1    MWRFSVLILLFSHLAVSSSSLGDSEATCSGIVSLPNRNDRISITDFGGVGDGRTVNTKAF  60

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            REAIYRI+HL+RRGGTLLYIPPGV+LT  FNLTSHMTL+LA+GA
Sbjct  61   REAIYRIQHLKRRGGTLLYIPPGVFLTESFNLTSHMTLFLAKGA  104



>gb|AIU50416.1| pectin lyase-like superfamily protein, partial [Buxus sinica]
Length=406

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS  VPM YR+DKISI DFGGVGDG+TLNT AFR AIYRI+HL+RRGGTLLYIPPGVYL
Sbjct  1    TCSGTVPMRYRHDKISITDFGGVGDGQTLNTKAFRAAIYRIQHLKRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLA+GA
Sbjct  61   TESFNLTSHMTLYLAKGA  78



>gb|ACC91250.1| glycoside hydrolase family 28 protein [Arabidopsis halleri]
Length=444

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 6/104 (6%)
 Frame = +3

Query  603  LWSMAV-VFLLR----SAAAAGEWE-TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
            +W ++V +FL      S+++ G+ E TCS IVP+ YR DKISI ++GGVGDGRT+NT AF
Sbjct  1    MWRLSVSIFLFSCLAVSSSSFGDSEATCSGIVPLRYRYDKISITEYGGVGDGRTVNTKAF  60

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            R AIYRI+HL+RRGGTLLYIPPGVYLT  FNLTSHMTLYLA+GA
Sbjct  61   RAAIYRIQHLKRRGGTLLYIPPGVYLTESFNLTSHMTLYLAKGA  104



>gb|AIU50400.1| pectin lyase-like superfamily protein, partial [Arabidopsis thaliana]
Length=406

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+ YR DKISI DFGGVGDGRT+NT AFR AIYRI+HL+RRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPLRYRYDKISITDFGGVGDGRTVNTKAFRAAIYRIQHLKRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLA+GA
Sbjct  61   TESFNLTSHMTLYLAKGA  78



>ref|XP_010676306.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=441

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +3

Query  609  SMAVVFLLRSA--AAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            SM ++ LL SA  + A +  TCS IVP+  R+D ISI DFGGVGDG+T+NTNAFR AIYR
Sbjct  6    SMIIILLLSSAIFSGADDEVTCSGIVPIRGRSDNISITDFGGVGDGKTVNTNAFRAAIYR  65

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            IEH+RR+ GTLLYIPPGVYLT  FNLTSHMTL+LA GA
Sbjct  66   IEHMRRKEGTLLYIPPGVYLTDRFNLTSHMTLFLATGA  103



>gb|KJB24232.1| hypothetical protein B456_004G134000 [Gossypium raimondii]
Length=389

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+  TCS IVPM+ R DKISI DFGGVGDG+TLNT AFR+AIYRI+HLRRRGGTLL++P 
Sbjct  26   GDLTTCSGIVPMTERGDKISITDFGGVGDGQTLNTIAFRKAIYRIQHLRRRGGTLLFVPS  85

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT  FNLTSHMTLYLARGA
Sbjct  86   GVYLTDSFNLTSHMTLYLARGA  107



>gb|KJB24230.1| hypothetical protein B456_004G134000 [Gossypium raimondii]
Length=448

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+  TCS IVPM+ R DKISI DFGGVGDG+TLNT AFR+AIYRI+HLRRRGGTLL++P 
Sbjct  26   GDLTTCSGIVPMTERGDKISITDFGGVGDGQTLNTIAFRKAIYRIQHLRRRGGTLLFVPS  85

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT  FNLTSHMTLYLARGA
Sbjct  86   GVYLTDSFNLTSHMTLYLARGA  107



>gb|AIU50441.1| pectin lyase-like superfamily protein, partial [Schrenkiella 
parvula]
Length=406

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+ YR DKISI DFGGVGDGR +NT AFR AIYRI+HL+RRGGTLLYIPPGV+L
Sbjct  1    TCSGIVPLRYRKDKISITDFGGVGDGRKVNTKAFRAAIYRIQHLKRRGGTLLYIPPGVFL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLARGA
Sbjct  61   TESFNLTSHMTLYLARGA  78



>ref|XP_003551949.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=442

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+ YR+D+ISI DFGGVGDGRTLNT AFR A+YRI+HLRRRGGT+LY+PPGVYL
Sbjct  27   TCSNIVPLRYRSDRISITDFGGVGDGRTLNTKAFRAAVYRIQHLRRRGGTVLYVPPGVYL  86

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLA GA
Sbjct  87   TESFNLTSHMTLYLAAGA  104



>gb|KHN28527.1| Putative polygalacturonase [Glycine soja]
Length=457

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+ YR+D+ISI DFGGVGDGRTLNT AFR A+YRI+HLRRRGGT+LY+PPGVYL
Sbjct  27   TCSNIVPLRYRSDRISITDFGGVGDGRTLNTKAFRAAVYRIQHLRRRGGTVLYVPPGVYL  86

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLA GA
Sbjct  87   TESFNLTSHMTLYLAAGA  104



>gb|AIU50399.1| pectin lyase-like superfamily protein, partial [Arabidopsis lyrata]
Length=406

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+ YR DKISI D+GGVGDGRT+NT AFR AIYRI+HL+RRGGTLLYIPPGVYL
Sbjct  1    TCSGIVPLRYRYDKISITDYGGVGDGRTVNTKAFRAAIYRIQHLKRRGGTLLYIPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMT YLA+GA
Sbjct  61   TESFNLTSHMTFYLAKGA  78



>ref|XP_004491304.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=452

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 4/100 (4%)
 Frame = +3

Query  609  SMAVVFLLRSA----AAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAI  776
            ++ + +L+ S        GE  TCS IVP+ +R D ISI DFGGVGDG TLNTNAF++AI
Sbjct  9    TLVLFYLITSCYYWFCVGGEVITCSNIVPLKHRTDTISITDFGGVGDGHTLNTNAFKKAI  68

Query  777  YRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            YRI HL R GGT+L+IPPGVYLT PFNLTSHMTLYL+ GA
Sbjct  69   YRISHLHREGGTILHIPPGVYLTEPFNLTSHMTLYLSSGA  108



>ref|XP_006586032.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=443

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  636  SAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTL  815
            S AA     TCS IV + YR+D+IS+ DFGGVGDGRTLNT AFR A+YRI+HLRRRGGT+
Sbjct  19   SVAAIYSTTTCSNIVSLRYRSDRISVTDFGGVGDGRTLNTKAFRAAVYRIQHLRRRGGTV  78

Query  816  LYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LY+PPGVYLT  FNLTSHMTLYLA GA
Sbjct  79   LYVPPGVYLTESFNLTSHMTLYLAAGA  105



>gb|KEH33635.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=451

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 4/103 (4%)
 Frame = +3

Query  600  SLWSMAVVFLLR----SAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            S+ S  ++FL+     S+ +A    TCS IVP  +R D ISI DFGGVGDG+TLN+ AFR
Sbjct  8    SIPSTFILFLIFFSHFSSISASYSTTCSGIVPFRHRADTISITDFGGVGDGKTLNSKAFR  67

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AIYRI+HLRRRGGTLLY+PPGVYLT  FNLTSHMTLYLA GA
Sbjct  68   AAIYRIQHLRRRGGTLLYVPPGVYLTESFNLTSHMTLYLAAGA  110



>ref|XP_010055855.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW72401.1| hypothetical protein EUGRSUZ_E00853 [Eucalyptus grandis]
Length=451

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  654  EWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPG  833
            E  TCS +VPMS R D+ISI DFGGVGDGRTLNT AFREA+YRI+HL R GGTLL++PPG
Sbjct  30   EVVTCSGVVPMSDRVDRISIADFGGVGDGRTLNTKAFREAVYRIQHLARPGGTLLHVPPG  89

Query  834  VYLTGPFNLTSHMTLYLARGA  896
            VYLT  FNLTSHMTLYLA GA
Sbjct  90   VYLTESFNLTSHMTLYLASGA  110



>gb|AIU50413.1| pectin lyase-like superfamily protein, partial [Eucalyptus grandis]
Length=406

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS +VPMS R D+ISI DFGGVGDGRTLNT AFREA+YRI+HL R GGTLL++PPGVYL
Sbjct  1    TCSGVVPMSDRVDRISIADFGGVGDGRTLNTKAFREAVYRIQHLARPGGTLLHVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLA GA
Sbjct  61   TESFNLTSHMTLYLASGA  78



>gb|KHN12010.1| Putative polygalacturonase [Glycine soja]
Length=446

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            GE  +CS IV + +R D ISI +FGGVGDGRTLNT AFREAIYR++HL R GGTLLY+PP
Sbjct  25   GETASCSNIVALGHRTDNISITEFGGVGDGRTLNTKAFREAIYRVQHLPREGGTLLYVPP  84

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT PFNLTSHMTLYLA GA
Sbjct  85   GVYLTEPFNLTSHMTLYLAAGA  106



>ref|XP_003545367.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=446

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            GE  +CS IV + +R D ISI +FGGVGDGRTLNT AFREAIYR++HL R GGTLLY+PP
Sbjct  25   GETASCSNIVALGHRTDNISITEFGGVGDGRTLNTKAFREAIYRVQHLPREGGTLLYVPP  84

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT PFNLTSHMTLYLA GA
Sbjct  85   GVYLTEPFNLTSHMTLYLAAGA  106



>gb|AIU50424.1| pectin lyase-like superfamily protein, partial [Medicago truncatula]
Length=406

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP+ YR D IS+ DFGGVGDG TLNT AFREAIYRI HL R GGT LY+PPGVYL
Sbjct  1    TCSNIVPLKYRTDNISLTDFGGVGDGHTLNTKAFREAIYRINHLSREGGTTLYVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T PFNLTSHMTL+LA GA
Sbjct  61   TEPFNLTSHMTLHLAAGA  78



>ref|XP_006837459.1| PREDICTED: probable polygalacturonase [Amborella trichopoda]
 gb|ERN00313.1| hypothetical protein AMTR_s00107p00122980 [Amborella trichopoda]
Length=447

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +  +  +  + +AG   TCS IV M YR D IS+ DFGG+GDGRTLNT AFR+AIYR
Sbjct  8    VWFVLPLLCILGSTSAGYVTTCSGIVRMRYRRDVISLTDFGGIGDGRTLNTLAFRKAIYR  67

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            IEHL R GGTLLYIPPGV+LTG FNLTSHMTLYLA+ A
Sbjct  68   IEHLSRSGGTLLYIPPGVWLTGSFNLTSHMTLYLAKDA  105



>gb|AIU50404.1| pectin lyase-like superfamily protein, partial [Pinellia ternata]
Length=406

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM  R + ISI DFGGVGDGRTLNT AF +AIYRI+HLRRRGGTLLY+PPGV+L
Sbjct  1    TCSGIVPMKGRAEAISITDFGGVGDGRTLNTWAFHKAIYRIQHLRRRGGTLLYVPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLARGA
Sbjct  61   TGSFNLTSHMTLYLARGA  78



>gb|AIU50418.1| pectin lyase-like superfamily protein, partial [Chloranthus japonicus]
Length=406

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC+ +VPM YR D ISI DFGGVGDGRTLNT AFR AIYRI HL RRGGT+LYIPPGV+L
Sbjct  1    TCADMVPMRYRKDVISITDFGGVGDGRTLNTVAFRRAIYRIRHLNRRGGTVLYIPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  61   TGSFNLTSHMTLYLAKGA  78



>ref|XP_004499965.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=449

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  660  ETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVY  839
            ETCS IVP   R D +SI DFGG+GDG+TLNT AFREAIYRI HL+RRGGTLLY+PPGVY
Sbjct  31   ETCSGIVPFRQRGDTVSITDFGGIGDGKTLNTKAFREAIYRIRHLKRRGGTLLYVPPGVY  90

Query  840  LTGPFNLTSHMTLYLARGA  896
            LT  FN+TSHMTLYLA GA
Sbjct  91   LTESFNVTSHMTLYLAAGA  109



>gb|AIU50437.1| pectin lyase-like superfamily protein, partial [Yucca filamentosa]
Length=406

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YR + ISI DFGGVGDG  LNTNAFREAI+RIEHL   GGT LY+PPGV+L
Sbjct  1    TCSGIVPMKYRPETISIADFGGVGDGWKLNTNAFREAIFRIEHLHHAGGTTLYVPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTL+LA+GA
Sbjct  61   TGPFNLTSHMTLFLAQGA  78



>gb|AIU50423.1| pectin lyase-like superfamily protein, partial [Aristolochia 
tagala]
Length=406

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IV M  R D ISI +FGGVGDGRTLNT AFR AIYRI+HLRRRGGTLLY+PPGV+L
Sbjct  1    TCSGIVRMRNRQDIISITEFGGVGDGRTLNTEAFRAAIYRIQHLRRRGGTLLYVPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTS+MTLYLAR A
Sbjct  61   TGPFNLTSYMTLYLARDA  78



>ref|XP_007141479.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
 gb|ESW13473.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
Length=442

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 2/85 (2%)
 Frame = +3

Query  648  AGEWET--CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLY  821
            +GE ET  CS IVP+ +R   ISI +FGGVGDGRTLNT AFREAIYR++HL R GGTLLY
Sbjct  18   SGEAETVSCSNIVPLGFRTQNISITEFGGVGDGRTLNTRAFREAIYRVQHLPRVGGTLLY  77

Query  822  IPPGVYLTGPFNLTSHMTLYLARGA  896
            +PPGVYLT PFNLTSHMTL+LA GA
Sbjct  78   VPPGVYLTEPFNLTSHMTLFLAAGA  102



>gb|AIU50414.1| pectin lyase-like superfamily protein, partial [Glycine max]
Length=406

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +CS IV + +R D ISI +FGGVGDGRTLNT AFREAIYR++HL R GGTLLY+PPGVYL
Sbjct  1    SCSNIVALGHRTDNISITEFGGVGDGRTLNTKAFREAIYRVQHLPREGGTLLYVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T PFNLTSHMTLYLA GA
Sbjct  61   TEPFNLTSHMTLYLAAGA  78



>ref|XP_009380525.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=446

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +3

Query  576  MSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            M+PF   + + ++ +  LL+ + A  E  +CS IVPM +R + ISI DFG VGDGRTLNT
Sbjct  1    MAPFRALVGVAAL-LPLLLQCSVAVTE-VSCSDIVPMKWRREVISITDFGAVGDGRTLNT  58

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
              F++AIYRI+HLR RGGTLLYIPPGV+LTG F+LTSHMTLYLARGA
Sbjct  59   WPFKKAIYRIQHLRSRGGTLLYIPPGVWLTGSFSLTSHMTLYLARGA  105



>gb|AIU50451.1| pectin lyase-like superfamily protein, partial [Cabomba caroliniana]
Length=406

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +C   VPM  R D IS+ DFGGVGDGRT+NT AFREAIYRI+HLRRRGGTLLY+PPGVYL
Sbjct  1    SCVQSVPMRGRRDVISLTDFGGVGDGRTVNTWAFREAIYRIQHLRRRGGTLLYVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTL+L++ A
Sbjct  61   TGPFNLTSHMTLFLSKDA  78



>gb|AIU50407.1| pectin lyase-like superfamily protein, partial [Sarcandra glabra]
Length=406

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC+  VPM YR D ISI DFGGVGDGRTLNT AFR AIYRI HL RRGGT+LYIPPGV+L
Sbjct  1    TCAGTVPMRYRKDVISITDFGGVGDGRTLNTVAFRRAIYRIRHLNRRGGTVLYIPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+ A
Sbjct  61   TGSFNLTSHMTLYLAKDA  78



>gb|EPS61079.1| hypothetical protein M569_13719, partial [Genlisea aurea]
Length=416

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM YR D+ISI DFGGVGDG TLNT AFR AI+RI+HL RRGGT+LY+P G YL
Sbjct  3    TCSGIVPMRYRTDRISITDFGGVGDGVTLNTRAFRAAIFRIQHLNRRGGTVLYVPAGEYL  62

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTS MTL+LA+GA
Sbjct  63   TGPFNLTSRMTLFLAKGA  80



>gb|AIU50433.1| pectin lyase-like superfamily protein, partial [Phaseolus vulgaris]
Length=406

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +CS IVP+ +R   ISI +FGGVGDGRTLNT AFREAIYR++HL R GGTLLY+PPGVYL
Sbjct  1    SCSNIVPLGFRTQNISITEFGGVGDGRTLNTRAFREAIYRVQHLPRVGGTLLYVPPGVYL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T PFNLTSHMTL+LA GA
Sbjct  61   TEPFNLTSHMTLFLAAGA  78



>gb|AIU50436.1| pectin lyase-like superfamily protein, partial [Dioscorea oppositifolia]
Length=406

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS +VPM  R ++ISI D+GGVGDG  LNTNAFREAIYRIEHL R GGT LY+PPGV+L
Sbjct  1    TCSGVVPMKTRAEEISIVDYGGVGDGEKLNTNAFREAIYRIEHLNRPGGTTLYVPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LA+GA
Sbjct  61   TGSFNLTSHMTLFLAKGA  78



>ref|XP_003617307.1| Glycoside hydrolase family 28 protein [Medicago truncatula]
 gb|AET00266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=450

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHL-RRRGGTLLYIPPGVY  839
            TCS IVP+ YR D IS+ DFGGVGDG TLNT AFREAIYRI HL +R GGT LY+PPGVY
Sbjct  30   TCSNIVPLKYRTDNISLTDFGGVGDGHTLNTKAFREAIYRINHLSQREGGTTLYVPPGVY  89

Query  840  LTGPFNLTSHMTLYLARGA  896
            LT PFNLTSHMTL+LA GA
Sbjct  90   LTEPFNLTSHMTLHLAAGA  108



>gb|AIU50422.1| pectin lyase-like superfamily protein, partial [Asparagus officinalis]
Length=406

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM  R + ISI DFGGVGDGR LNTNAF+EAI+RI+HL   GGT L+IPPGV+L
Sbjct  1    TCSTIVPMKSRPETISIADFGGVGDGRKLNTNAFKEAIFRIQHLHHAGGTTLFIPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTL+L++GA
Sbjct  61   TGPFNLTSHMTLFLSQGA  78



>gb|AIU50421.1| pectin lyase-like superfamily protein, partial [Pandanus utilis]
Length=406

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS  VPM  R ++ISI DFGGVGDG TLNTNAFREAIYRIEHL R GGT L +PPGV+L
Sbjct  1    TCSGAVPMKTRAEEISIVDFGGVGDGETLNTNAFREAIYRIEHLHRPGGTTLRVPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LA+GA
Sbjct  61   TGSFNLTSHMTLFLAKGA  78



>ref|XP_007146299.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
 gb|ESW18293.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
Length=456

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP   R D+ISI D+GGVGDGRTLNT AFREA+YRIEHL+R GGT+LY+P GVY+
Sbjct  41   TCSNIVPFKNRTDRISITDYGGVGDGRTLNTKAFREAVYRIEHLKRPGGTVLYVPQGVYV  100

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTLYLA GA
Sbjct  101  TESFNLTSHMTLYLAAGA  118



>gb|AIU50420.1| pectin lyase-like superfamily protein, partial [Chimonanthus 
praecox]
Length=406

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS  VPM  R+  ISI DFGGVGDG T+NT AFR AIYRI+HLRRRGGT+LYIPPGV+L
Sbjct  1    TCSGTVPMRNRSYVISIVDFGGVGDGVTVNTVAFRRAIYRIQHLRRRGGTMLYIPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMT+YLARGA
Sbjct  61   TGSFNLTSHMTVYLARGA  78



>ref|XP_009404468.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404469.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  615  AVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHL  794
            A++  L    AA    TC+ IVPM +R + +SI +FG VGDG+TLNT +F +AIYRI+HL
Sbjct  12   ALLSSLPHCRAAEAVATCAGIVPMRWRREVVSITEFGAVGDGKTLNTWSFHKAIYRIQHL  71

Query  795  RRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            R+RGGTLLYIPPGV+LTG F+LTSHMTLYLARGA
Sbjct  72   RKRGGTLLYIPPGVWLTGSFDLTSHMTLYLARGA  105



>gb|AIU50450.1| pectin lyase-like superfamily protein, partial [Alisma plantago-aquatica]
Length=406

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS  VPM  R + ISI DFG VGDGRT+NT AFR AIYRIEHL+R GGT+LY+PPGV+L
Sbjct  1    TCSDAVPMKTRGEVISIADFGAVGDGRTVNTWAFRRAIYRIEHLKRPGGTILYVPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTS MTLYLA GA
Sbjct  61   TGPFNLTSQMTLYLANGA  78



>ref|XP_008790157.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008790230.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=442

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  636  SAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTL  815
               AAG   TCS  VPM +R + +SI DFG VGDGRTLNT  F +AIY I+H RRRGGTL
Sbjct  17   QCGAAGTEVTCSGAVPMRWRREVLSITDFGAVGDGRTLNTWPFMKAIYVIQHRRRRGGTL  76

Query  816  LYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LY+PPGV+LTG FNLTSHMTLYLARGA
Sbjct  77   LYVPPGVWLTGSFNLTSHMTLYLARGA  103



>ref|XP_009413832.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413833.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=445

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +CS +VPM  R + ISI DFG VGDG+TLNT  F++AIYRI+HLRRRGGTLLY+PPGV+L
Sbjct  28   SCSDVVPMKQRREVISITDFGAVGDGKTLNTWPFKKAIYRIQHLRRRGGTLLYVPPGVWL  87

Query  843  TGPFNLTSHMTLYLARGA  896
            TG  +LTSHMTLYLARGA
Sbjct  88   TGSVSLTSHMTLYLARGA  105



>ref|XP_010924850.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=448

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  633  RSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGT  812
            R+ AA GE ETCS IVPM  R+  +S+ DFGGV DGRTLNT AF+ A+  IE  R   GT
Sbjct  24   RAVAAEGE-ETCSGIVPMKSRDSAVSVADFGGVADGRTLNTAAFQRAVAEIERRRAANGT  82

Query  813  LLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LLY+PPGV+LTGPFNLTSHMTL+LA+GA
Sbjct  83   LLYVPPGVWLTGPFNLTSHMTLFLAKGA  110



>gb|AIU50401.1| pectin lyase-like superfamily protein, partial [Lilium brownii]
Length=406

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS  VPM  R   ISI DFG VGDG+T+NT AF+EA+Y+I+HL R GGT+LYIP GV+L
Sbjct  1    TCSGAVPMKQRAQTISIADFGAVGDGKTVNTKAFKEAVYQIQHLGRPGGTVLYIPAGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTL+LARGA
Sbjct  61   TGPFNLTSHMTLFLARGA  78



>ref|XP_010925748.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
 ref|XP_010925749.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=441

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS  VPM +R + ISI DFG VGDGRTLNT  F +AIY I+H RRRGGTLLY+PPGV+L
Sbjct  25   TCSGAVPMRWRREVISITDFGAVGDGRTLNTWPFMKAIYVIQHRRRRGGTLLYVPPGVWL  84

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLARGA
Sbjct  85   TGSFNLTSHMTLYLARGA  102



>gb|AIU50406.1| pectin lyase-like superfamily protein, partial [Acorus calamus]
Length=321

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC   V M  R + ISI+DFGGVGDGRT+NT AFREA+YRIEHL R GGTLL++P GV+L
Sbjct  1    TCEGTVAMKERAETISIEDFGGVGDGRTVNTAAFREAVYRIEHLGRPGGTLLHVPAGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  61   TGAFNLTSHMTLYLAQGA  78



>gb|AIU50417.1| pectin lyase-like superfamily protein, partial [Iris japonica]
Length=406

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +C+ IVPM  R + ISI++FGGVGDGRT N+ AFR+A+YRI+H RRRGGTLLY+P GV+L
Sbjct  1    SCAGIVPMRSRREVISIEEFGGVGDGRTDNSWAFRKAMYRIQHQRRRGGTLLYVPGGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FN+TSHMTLYLARGA
Sbjct  61   TGCFNVTSHMTLYLARGA  78



>ref|XP_002451891.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
 gb|EES04867.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
Length=448

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +C+ + P  +R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L++P G +L
Sbjct  31   SCAGVAPAKHRPEAISITDFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTTLHVPAGTWL  90

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LARGA
Sbjct  91   TGSFNLTSHMTLFLARGA  108



>gb|AIU50440.1| pectin lyase-like superfamily protein, partial [Sorghum bicolor]
Length=406

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +C+ + P  +R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L++P G +L
Sbjct  1    SCAGVAPAKHRPEAISITDFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTTLHVPAGTWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LARGA
Sbjct  61   TGSFNLTSHMTLFLARGA  78



>gb|AIU50445.1| pectin lyase-like superfamily protein, partial [Cinnamomum camphora]
Length=406

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM  R D +SI DFGGVGDGRTLNT AFR+AI RIE ++ RGGT LYIP GV+L
Sbjct  1    TCSGIVPMKNRADVVSIVDFGGVGDGRTLNTVAFRKAIGRIEKMKSRGGTQLYIPSGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LA+ A
Sbjct  61   TGCFNLTSHMTLFLAKDA  78



>gb|AFW65882.1| hypothetical protein ZEAMMB73_311601 [Zea mays]
Length=163

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  675  IVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPF  854
            + P  +R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L++P G +L G F
Sbjct  40   LAPAKHRPEVISIADFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTTLHVPAGTWLAGSF  99

Query  855  NLTSHMTLYLARGA  896
            NLTSHMTL+LARGA
Sbjct  100  NLTSHMTLFLARGA  113



>gb|AIU50449.1| pectin lyase-like superfamily protein, partial [Zea mays]
Length=406

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC+ + P  +R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L++P G +L
Sbjct  1    TCAGLAPAKHRPEVISIADFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTTLHVPAGTWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
             G FNLTSHMTL+LARGA
Sbjct  61   AGSFNLTSHMTLFLARGA  78



>gb|AIU50425.1| pectin lyase-like superfamily protein, partial [Canna indica]
Length=406

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +C+ +VPM  R + ISI DFG VGDG+TLNT  F++AIYRI H R RGGTLLYIPPGV+L
Sbjct  1    SCADVVPMKRRREVISITDFGAVGDGKTLNTWPFKKAIYRISHRRHRGGTLLYIPPGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG F+LT HMTL+LARGA
Sbjct  61   TGSFSLTGHMTLFLARGA  78



>ref|XP_008810829.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810830.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810831.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=450

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  636  SAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTL  815
            SAAA    ETCS IVPM  R   +S+ DFGGVGDG+TLNT AF++A+  IE      GTL
Sbjct  24   SAAAPEGEETCSGIVPMKERGTAMSVADFGGVGDGQTLNTAAFQKAVAEIERRGPASGTL  83

Query  816  LYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LY+PPGV+LTG FNLTSHMTL+LARGA
Sbjct  84   LYVPPGVWLTGAFNLTSHMTLFLARGA  110



>gb|AFW65881.1| hypothetical protein ZEAMMB73_311601 [Zea mays]
Length=213

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  675  IVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPF  854
            + P  +R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L++P G +L G F
Sbjct  40   LAPAKHRPEVISIADFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTTLHVPAGTWLAGSF  99

Query  855  NLTSHMTLYLARGA  896
            NLTSHMTL+LARGA
Sbjct  100  NLTSHMTLFLARGA  113



>gb|AIU50415.1| pectin lyase-like superfamily protein, partial [Illicium henryi]
Length=406

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC+ IV M  R + +SI  FG VGDG+TLNT AFR AIYRI+ LR  GGTLLY+PPGV+L
Sbjct  1    TCAGIVQMKDRREFLSITSFGAVGDGQTLNTAAFRRAIYRIQRLRSSGGTLLYVPPGVFL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTLYLA+GA
Sbjct  61   TGSFNLTSHMTLYLAKGA  78



>gb|AIU50447.1| pectin lyase-like superfamily protein, partial [Ginkgo biloba]
Length=401

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            +C+ IV M +R + +SI+DFG VGDG+TLNT AFR AI+RI+ LRRR GTLLYIP GV+L
Sbjct  1    SCAGIVRMKHRGEILSIRDFGAVGDGKTLNTKAFRAAIFRIQKLRRRHGTLLYIPSGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LA+ A
Sbjct  61   TGSFNLTSHMTLFLAKNA  78



>ref|XP_004951285.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=447

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC  + P   R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L +P G +L
Sbjct  32   TCVGVAPAKRRPEVISITDFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTELRVPAGTWL  91

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LARGA
Sbjct  92   TGSFNLTSHMTLFLARGA  109



>gb|AIU50438.1| pectin lyase-like superfamily protein, partial [Setaria italica]
Length=406

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC  + P   R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L +P G +L
Sbjct  1    TCVGVAPAKRRPEVISITDFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTELRVPAGTWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LARGA
Sbjct  61   TGSFNLTSHMTLFLARGA  78



>gb|AIU50448.1| pectin lyase-like superfamily protein, partial [Houttuynia cordata]
Length=406

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS  V M  R + ISI DFGGVGDGRTLNT AFR AIY I+HL R+GGTLLYIP GV+L
Sbjct  1    TCSGTVRMKNRRNVISITDFGGVGDGRTLNTKAFRAAIYWIQHLNRKGGTLLYIPNGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTL+LA+ A
Sbjct  61   TESFNLTSHMTLFLAKDA  78



>gb|AIU50403.1| pectin lyase-like superfamily protein, partial [Musa acuminata]
Length=396

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R + ISI DFG VGDGRTLNT  F++AIYRI+HLR RGGTLLYIPPGV+LTG F+LTSHM
Sbjct  1    RREVISITDFGAVGDGRTLNTWPFKKAIYRIQHLRSRGGTLLYIPPGVWLTGSFSLTSHM  60

Query  873  TLYLARGA  896
            TLYLARGA
Sbjct  61   TLYLARGA  68



>gb|AIU50432.1| pectin lyase-like superfamily protein, partial [Panicum virgatum]
Length=406

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC  + P   R + +SI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L +P G +L
Sbjct  1    TCVGVAPAKRRPEVVSIADFGGVGDGRTLNTWAFRKAVYRIQHRRRRGGTELRVPAGTWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            TG FNLTSHMTL+LARGA
Sbjct  61   TGSFNLTSHMTLFLARGA  78



>ref|NP_001046468.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAD29699.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAD27952.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAF08382.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAG87758.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87044.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56682.1| hypothetical protein OsJ_06128 [Oryza sativa Japonica Group]
Length=443

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  648  AGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIP  827
            A E  TC+  VP   R + +SI +FGGVGDGRT+NT AF +A+YRI+H RRRGGT L +P
Sbjct  24   AAEATTCAGAVPARPRPETVSIAEFGGVGDGRTVNTWAFHKAVYRIQHQRRRGGTTLLVP  83

Query  828  PGVYLTGPFNLTSHMTLYLARGA  896
             G +LTG FNLTSHMTL+LARGA
Sbjct  84   AGTWLTGSFNLTSHMTLFLARGA  106



>gb|EAY85246.1| hypothetical protein OsI_06620 [Oryza sativa Indica Group]
Length=443

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  648  AGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIP  827
            A E  TC+  VP   R + +SI +FGGVGDGRT+NT AF +A+YRI+H RRRGGT L +P
Sbjct  24   AAETTTCAGAVPARPRPETVSIAEFGGVGDGRTVNTWAFHKAVYRIQHQRRRGGTTLLVP  83

Query  828  PGVYLTGPFNLTSHMTLYLARGA  896
             G +LTG FNLTSHMTL+LARGA
Sbjct  84   AGTWLTGSFNLTSHMTLFLARGA  106



>ref|NP_001170283.1| uncharacterized protein LOC100384246 precursor [Zea mays]
 gb|ACN33336.1| unknown [Zea mays]
 gb|AFW65883.1| hypothetical protein ZEAMMB73_311601 [Zea mays]
Length=451

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  675  IVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPF  854
            + P  +R + ISI DFGGVGDGRTLNT AFR+A+YRI+H RRRGGT L++P G +L G F
Sbjct  40   LAPAKHRPEVISIADFGGVGDGRTLNTWAFRKAVYRIQHQRRRGGTTLHVPAGTWLAGSF  99

Query  855  NLTSHMTLYLARGA  896
            NLTSHMTL+LARGA
Sbjct  100  NLTSHMTLFLARGA  113



>ref|XP_010448059.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = +3

Query  570  KIMSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTL  749
            KI  P      L+ ++ V  LR   + G   TCS IVPM +R   +SI DFG VGDG+TL
Sbjct  2    KISRPPISVFVLFFLSAV--LRHHLSLGTPITCSGIVPMKHRTAMLSISDFGAVGDGKTL  59

Query  750  NTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            NTNAF  AI RI +     GTL+Y+P GVYLT  FNLTSHMTLYLA GA
Sbjct  60   NTNAFNAAIDRIRNSNSSNGTLVYVPRGVYLTQSFNLTSHMTLYLADGA  108



>ref|XP_009395761.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  648  AGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIP  827
            A E +TCS IVPM  R + +SI DFGGVGDGRTLNT AF+ A++ IE  +   G+LLYIP
Sbjct  27   AEEEQTCSGIVPMKNRGEVVSITDFGGVGDGRTLNTAAFKSAVFHIEQRKVPEGSLLYIP  86

Query  828  PGVYLTGPFNLTSHMTLYLARGA  896
             GV+LT  FNLTSHMTL+LA GA
Sbjct  87   AGVWLTEAFNLTSHMTLFLAEGA  109



>emb|CDY13383.1| BnaC06g13740D [Brassica napus]
Length=445

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +3

Query  621  VFLLRSA--AAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHL  794
            VF L SA   + G+  TCS IVPM +R+  +SI DFG VGDG TLNTNAF  AI RI + 
Sbjct  12   VFFLLSARHLSLGDPITCSGIVPMKHRSQMLSISDFGAVGDGTTLNTNAFNAAIDRIRNA  71

Query  795  RRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
                GTLLY+P GVYLT  FNLTSHMTLYLA GA
Sbjct  72   SSSEGTLLYVPRGVYLTQSFNLTSHMTLYLADGA  105



>ref|XP_010533998.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=266

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            GE  TCS IVP+ +R ++ SI +FG VGDG T+NT AF  AI RIE     GGTLLY+PP
Sbjct  25   GEPTTCSGIVPLRHRENRFSITEFGAVGDGTTVNTKAFAAAIDRIERSGGGGGTLLYVPP  84

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            GVYLT  FNLTSHMTLYLA GA
Sbjct  85   GVYLTESFNLTSHMTLYLAGGA  106



>ref|XP_010441363.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010441364.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  627  LLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRG  806
            +LR   + G   TCS IVP+ +R   +SI DFG VGDG+TLNTNAF  AI RI +     
Sbjct  19   VLRHHLSLGAPITCSGIVPLKHRTAMLSISDFGAVGDGKTLNTNAFNAAIDRIRNSNSSN  78

Query  807  GTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            GTLLY+P GVYLT  FNLTSHMTLYLA GA
Sbjct  79   GTLLYVPRGVYLTQSFNLTSHMTLYLADGA  108



>ref|XP_010913831.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913836.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913839.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=450

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  660  ETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVY  839
            ETCS IVPM  R   +S++DFGGVGDGRTLNT AF +A+  IE     GGT LY+PPGV+
Sbjct  33   ETCSGIVPMKERGTAMSVEDFGGVGDGRTLNTAAFEKAVAEIERRGVAGGT-LYVPPGVW  91

Query  840  LTGPFNLTSHMTLYLARGA  896
            LTG FNLTSHMTL+LARGA
Sbjct  92   LTGVFNLTSHMTLFLARGA  110



>gb|AIU50402.1| pectin lyase-like superfamily protein, partial [Magnolia denudata]
Length=392

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  705  ISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYL  884
            ISI DFGGVGDG+TLNT AFR AIYRI H+R+RGGTLLYIP GV+LTG FNLTSHMTLYL
Sbjct  1    ISITDFGGVGDGQTLNTLAFRTAIYRIGHMRKRGGTLLYIPTGVWLTGSFNLTSHMTLYL  60

Query  885  ARGA  896
            A+ A
Sbjct  61   AKDA  64



>ref|NP_199002.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 dbj|BAB10662.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAT85725.1| At5g41870 [Arabidopsis thaliana]
 gb|AED94738.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=449

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = +3

Query  609  SMAVVFLLRSAA----AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAI  776
            S+ V+FLL +      + G   TCS IVPM +RN+ +SI DFG VGDG+TLNT AF  AI
Sbjct  9    SVFVLFLLSTVLPHHLSLGAPITCSGIVPMKHRNEMLSISDFGAVGDGKTLNTKAFNSAI  68

Query  777  YRIEHLRRRG-GTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             RI +      GTLLY+P GVYLT  FNLTSHMTLYLA GA
Sbjct  69   DRIRNSNNSNEGTLLYVPRGVYLTQSFNLTSHMTLYLADGA  109



>emb|CDX67513.1| BnaA07g15530D [Brassica napus]
Length=447

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  621  VFLLRSAA---AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEH  791
            VF L SA    + G+  TCS IVPM +R+  +SI DFG VGDG TLNTNAF  AI RI +
Sbjct  12   VFFLLSAHHHLSLGDPITCSGIVPMKHRSQMLSISDFGAVGDGTTLNTNAFNAAIDRIRN  71

Query  792  LRRRG-GTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             +    GTLLY+P GVYLT  FNLTSHMTLYLA GA
Sbjct  72   AKNVSVGTLLYVPRGVYLTQSFNLTSHMTLYLAHGA  107



>ref|XP_009125202.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=447

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +3

Query  621  VFLLRSAA---AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEH  791
            VF L SA    + G+  TCS IVPM +R+  +SI DFG VGDG TLNTNAF  AI RI +
Sbjct  12   VFFLLSAHHHLSLGDPITCSGIVPMKHRSQMLSISDFGAVGDGTTLNTNAFNAAIDRIRN  71

Query  792  LRRRG-GTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             +    GTLLY+P GVYLT  FNLTSHMTLYLA GA
Sbjct  72   AKNVSVGTLLYVPRGVYLTQSFNLTSHMTLYLAHGA  107



>ref|XP_004961056.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=445

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +3

Query  642  AAAGEWETCSWIVPMSYRNDK-ISIKDFGGVGDGRTLNTNAFREAIYRIEHLR-RRGGTL  815
            + AG  ETCS I P   R    +S+  FGG GDG+TLNT AF  A+ RIE  R  RGGTL
Sbjct  22   SPAGAQETCSGIAPAPRRRGAWMSVASFGGRGDGQTLNTAAFARAVARIESRRGARGGTL  81

Query  816  LYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LY+PPGV+LTGPFNLTSHMTL+LARGA
Sbjct  82   LYVPPGVWLTGPFNLTSHMTLFLARGA  108



>ref|XP_002868572.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44831.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = +3

Query  609  SMAVVFLLRSAA----AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAI  776
            S+ V+FLL +      + G   TCS IVPM +R + +SI DFG VGDG+TLNTNAF  AI
Sbjct  9    SVCVLFLLSTVLPHHLSLGAPITCSGIVPMKHRTEMLSIFDFGAVGDGKTLNTNAFNTAI  68

Query  777  YRIEHLRRRG-GTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             RI +      GTLL++P GVYLT  FNLTSHMTLYLA GA
Sbjct  69   DRIRNSNNSSQGTLLHVPRGVYLTQSFNLTSHMTLYLADGA  109



>emb|CDM83426.1| unnamed protein product [Triticum aestivum]
Length=450

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = +3

Query  642  AAAGEWETCSWIVPMS-YRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLL  818
              AG  ETCS  VP    R   +SI  FGG GDGRTLNT AF  A+  I+  R RGG LL
Sbjct  26   GGAGAQETCSGAVPAPPKRGAWMSIASFGGAGDGRTLNTAAFAAAVSSIQRRRARGGALL  85

Query  819  YIPPGVYLTGPFNLTSHMTLYLARGA  896
            Y+PPGV+LTGPF+LTSHMTL+LARGA
Sbjct  86   YVPPGVWLTGPFSLTSHMTLFLARGA  111



>ref|XP_006405300.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 ref|XP_006405301.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46753.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46754.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
Length=447

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 68/108 (63%), Gaps = 2/108 (2%)
 Frame = +3

Query  579  SPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTN  758
            +P    + L+ ++ VF    +       TCS IVP  +R++ +SI DFG VGDGRT NTN
Sbjct  6    APISVCVMLFLLSAVFPHHLSLGGDPINTCSGIVPTRHRSEMLSISDFGAVGDGRTSNTN  65

Query  759  AFREAIYRIEHLRRRG--GTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            AF  AI RI    R G  G LLY+P GVYLT  FNLTSHMTLYLA GA
Sbjct  66   AFNAAIDRIRTGNRSGGDGALLYVPRGVYLTESFNLTSHMTLYLADGA  113



>ref|XP_006283728.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
 gb|EOA16626.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
Length=448

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVPM +R   +S+ DFG VGDG+TLNT AF  AI RI +     GTLLY+P GVYL
Sbjct  31   TCSGIVPMKHRTKMLSVSDFGAVGDGKTLNTKAFNAAIDRIRNSNSIDGTLLYVPRGVYL  90

Query  843  TGPFNLTSHMTLYLARGA  896
            +  FNLTSHMTLYLA GA
Sbjct  91   SQSFNLTSHMTLYLADGA  108



>ref|XP_002441600.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
 gb|EES20030.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
Length=439

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +3

Query  639  AAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLR-RRGGTL  815
            +++AG  ++C W  P   R   +S+  FG  GDG+TLNT AF  A+ RIE  R  RGGTL
Sbjct  17   SSSAGAQDSC-WSGPAPLRGAWMSVASFGARGDGQTLNTGAFARAVARIERRRGARGGTL  75

Query  816  LYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LY+PPGV+LTGPFNLTSHMTL+LARGA
Sbjct  76   LYVPPGVWLTGPFNLTSHMTLFLARGA  102



>ref|XP_009396562.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +3

Query  645  AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYI  824
            A GE  TCS IVPM  R   +SI DFGGVGDG+TLNT AF  AI  I      GGT L+I
Sbjct  27   AEGE-ATCSGIVPMKSREKMVSIADFGGVGDGKTLNTAAFESAISHIVQQNAPGGTHLHI  85

Query  825  PPGVYLTGPFNLTSHMTLYLARGA  896
            P GV+LTG FNLTSHMTL+LA+ A
Sbjct  86   PAGVWLTGAFNLTSHMTLFLAKDA  109



>gb|EMT32528.1| Putative polygalacturonase [Aegilops tauschii]
Length=443

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +3

Query  612  MAVVFLLRSAAAAGEWETCSWIVPMSYRNDK-ISIKDFGGVGDGRTLNTNAFREAIYRIE  788
            MA+  +L +A  AG  ETCS  VP   +    +SI  FGG GDGRTLNT AF  A+  I+
Sbjct  1    MAIAAVLSAAGGAGAQETCSGAVPPPPKRGAWMSIASFGGAGDGRTLNTAAFAAAVASIQ  60

Query  789  HLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
              R RGG LLY+PPGV+LTGPF+LTSHMTL+LA GA
Sbjct  61   RRRARGGALLYVPPGVWLTGPFSLTSHMTLFLACGA  96



>gb|AIU50444.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=406

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS +VPM  R   +SI  FGG+GDG+TLNT+AF+ AI  I H RR GGT LYIP GV+L
Sbjct  1    TCSDMVPMKSRPQLVSITVFGGIGDGKTLNTDAFKRAIKWIAHHRRGGGTQLYIPAGVWL  60

Query  843  TGPFNLTSHMTLYLARGA  896
            T  FNLTSHMTL+LA+ A
Sbjct  61   TESFNLTSHMTLFLAKDA  78



>ref|XP_004969187.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=444

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  660  ETCSWIVPMS-YRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGV  836
            ETCS  VP    R  ++S+  FGG GDGRTLNT AF  A+  I+ LR  GG  LY+PPGV
Sbjct  26   ETCSGAVPAPPRRGARVSVASFGGAGDGRTLNTGAFARAVASIDRLRAPGGAELYVPPGV  85

Query  837  YLTGPFNLTSHMTLYLARGA  896
            +LTGPFNLTS MTL+LARGA
Sbjct  86   WLTGPFNLTSRMTLFLARGA  105



>gb|EAY99223.1| hypothetical protein OsI_21181 [Oryza sativa Indica Group]
Length=448

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC   VP   R   IS+  FGGVGDGR LNT AF  A+ RIE  R RGG LLY+P GV+L
Sbjct  36   TCPADVPR--RGAWISVASFGGVGDGRALNTAAFARAVARIERRRARGGALLYVPAGVWL  93

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTL+LARGA
Sbjct  94   TGPFNLTSHMTLFLARGA  111



>ref|NP_001056466.1| Os05g0587000 [Oryza sativa Japonica Group]
 dbj|BAF18380.1| Os05g0587000 [Oryza sativa Japonica Group]
 gb|EAZ10399.1| hypothetical protein OsJ_00232 [Oryza sativa Japonica Group]
Length=448

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC   VP   R   +S+  FGGVGDGR LNT AF  A+ RIE  R RGG LLY+P GV+L
Sbjct  36   TCPADVPP--RGAWMSVASFGGVGDGRALNTAAFARAVARIERRRARGGALLYVPAGVWL  93

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTL+LARGA
Sbjct  94   TGPFNLTSHMTLFLARGA  111



>gb|AAT44156.1| putative polygalacturonase [Oryza sativa Japonica Group]
Length=474

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TC   VP   R   +S+  FGGVGDGR LNT AF  A+ RIE  R RGG LLY+P GV+L
Sbjct  36   TCPADVPP--RGAWMSVASFGGVGDGRALNTAAFARAVARIERRRARGGALLYVPAGVWL  93

Query  843  TGPFNLTSHMTLYLARGA  896
            TGPFNLTSHMTL+LARGA
Sbjct  94   TGPFNLTSHMTLFLARGA  111



>gb|KFK32989.1| hypothetical protein AALP_AA6G314900 [Arabis alpina]
Length=443

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  663  TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYL  842
            TCS IVP  +R+  +SI DFG VGDG+TLNTNAF  AI  I       GTLLY+P GVYL
Sbjct  26   TCSGIVPRKHRSKMLSISDFGAVGDGKTLNTNAFNSAIDWIRKTNTSDGTLLYVPRGVYL  85

Query  843  TGPFNLTSHMTLYLARGA  896
            T  F LTSHMTLYLA G 
Sbjct  86   TESFKLTSHMTLYLANGV  103



>ref|XP_003569374.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=448

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = +3

Query  642  AAAGEWETCSWIVPMS-YRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLL  818
              AG  ETCS  VP    R + +S+  FGG GDGRTLNT AF  A+  IE  R  GG LL
Sbjct  24   GGAGAQETCSGAVPAPPKRGEWVSVASFGGAGDGRTLNTAAFAAAVASIERRRAPGGGLL  83

Query  819  YIPPGVYLTGPFNLTSHMTLYLARGA  896
            Y+PPGV+LTGPFNLTSHMTL+L+RGA
Sbjct  84   YVPPGVWLTGPFNLTSHMTLFLSRGA  109



>ref|NP_001141464.1| uncharacterized protein LOC100273574 precursor [Zea mays]
 ref|XP_008654580.1| PREDICTED: uncharacterized protein LOC100273574 isoform X1 [Zea 
mays]
 gb|ACF86427.1| unknown [Zea mays]
 gb|ACN28939.1| unknown [Zea mays]
 gb|AFW83292.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
 gb|AFW83293.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
Length=446

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  660  ETCSWIVPMS-YRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGV  836
            ETCS  VP    R  ++S+  FGG GDGRTLNT AF  A+  IE     GG  LY+PPGV
Sbjct  28   ETCSGTVPAPPRRGARVSVASFGGAGDGRTLNTAAFARAVASIERRAAPGGAELYVPPGV  87

Query  837  YLTGPFNLTSHMTLYLARGA  896
            +LTGPFNLTS MTL+LARGA
Sbjct  88   WLTGPFNLTSRMTLFLARGA  107



>ref|XP_002455965.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
 gb|EES01085.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
Length=447

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  660  ETCSWIVPMS-YRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGV  836
            ETCS  VP    R  ++S+  FGG GDGRTLNT AF  A+  IE     GG  LY+PPGV
Sbjct  29   ETCSGAVPAPPRRGARVSVASFGGAGDGRTLNTAAFARAVATIERRAVPGGAELYVPPGV  88

Query  837  YLTGPFNLTSHMTLYLARGA  896
            +LTGPFNLTS MTL+LARGA
Sbjct  89   WLTGPFNLTSRMTLFLARGA  108



>gb|AIU50419.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
demersum]
Length=368

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  678  VPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFN  857
            VPM  R   +SI  FGG+GDG+TLNT+AF+ AI  I H RR GGT LYIP GV+LTG FN
Sbjct  1    VPMKSRPQLVSITVFGGIGDGKTLNTDAFKRAIKWIAHHRRGGGTQLYIPAGVWLTGSFN  60

Query  858  LTSHMTLYLARGA  896
            LTS MTL+LA+ A
Sbjct  61   LTSRMTLFLAKDA  73



>ref|XP_003570492.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=496

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            F  + LW    V L+R  A  G   + SW  P   R    ++ DFGGVGDGRTLNT AF 
Sbjct  41   FTLVFLWQSTSV-LVRGGAGLG-LRSASWRPPPRLRPGAYNLTDFGGVGDGRTLNTQAFE  98

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             A+  I  L  RGG  L +PPG +LT PFNLTSHMTL+LA GA
Sbjct  99   RAVEAIAALADRGGGQLNVPPGRWLTAPFNLTSHMTLFLAEGA  141



>ref|XP_008792847.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=487

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 65/107 (61%), Gaps = 3/107 (3%)
 Frame = +3

Query  585  FFQTISLWSMAVVFLLRSAAAAGEW---ETCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
             F  I +   A VFL +S++  G          +   S R    +I DFGGVGDG TLNT
Sbjct  26   LFLVIWVVGFATVFLWQSSSIDGLLFFRRALPEMAAPSLRPFAYNITDFGGVGDGVTLNT  85

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AF  A+ +I  LRRRGG  L +PPGV+LT PFNLTSHMTL+LA GA
Sbjct  86   KAFERAVAKIARLRRRGGGQLNVPPGVWLTAPFNLTSHMTLFLAEGA  132



>ref|XP_008784337.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008784338.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=482

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 63/103 (61%), Gaps = 5/103 (5%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            F T+ LW  + V  +R    A        + P+SY     +I DFGGVGDG TLNT AF 
Sbjct  30   FATVFLWQSSSVDGIRFFRRALPVVAAPKLRPVSY-----NITDFGGVGDGVTLNTEAFE  84

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             A+  I  L RRGG  L +PPGV+LT PFNLTSHMTL+LA GA
Sbjct  85   RAVAAIARLGRRGGGQLNVPPGVWLTAPFNLTSHMTLFLAEGA  127



>dbj|BAJ94032.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=158

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 9/107 (8%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAA----AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            F  + LW  A +F+  +      A         + PM+Y     ++ DFGGVGDGRT+NT
Sbjct  39   FTLVFLWQSASMFVAGAGGGPRPALPPSRPAPRLRPMAY-----NLTDFGGVGDGRTVNT  93

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AF  A+  I     RGG  L +PPG +LTGPFNLTSHMTL+LA GA
Sbjct  94   RAFERAVETITAFADRGGAQLNVPPGRWLTGPFNLTSHMTLFLAEGA  140



>dbj|BAJ94644.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91541.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query  642  AAAGEWETCSWIVPMS-YRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLL  818
              AG  ETCS   P    R   +SI  FGG GDGRTLNT AF  A+  I   R RGG LL
Sbjct  26   GGAGAQETCSGAAPAPPKRGAWMSIASFGGAGDGRTLNTAAFAAAVASIARRRARGGALL  85

Query  819  YIPPGVYLTGPFNLTSHMTLYLARGA  896
            Y+PPGV+LTGPF+LTSHMTL+LARGA
Sbjct  86   YVPPGVWLTGPFSLTSHMTLFLARGA  111



>dbj|BAJ89948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query  642  AAAGEWETCSWIVPMS-YRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLL  818
              AG  ETCS   P    R   +S+  FGG GDGRTLNT AF  A+  I   R RGG LL
Sbjct  26   GGAGAQETCSGAAPAPPKRGAWMSVASFGGAGDGRTLNTAAFAAAVASIARRRARGGALL  85

Query  819  YIPPGVYLTGPFNLTSHMTLYLARGA  896
            Y+PPGV+LTGPF+LTSHMTL+LARGA
Sbjct  86   YVPPGVWLTGPFSLTSHMTLFLARGA  111



>gb|KDO73853.1| hypothetical protein CISIN_1g0214491mg, partial [Citrus sinensis]
Length=251

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = +3

Query  585  FFQTISLWSMAVVFLLRSAAAAG-----EWETCSWIVPMSYRNDKISIKDFGGVGDGRTL  749
             F  + L + A VF+ +  A  G      W   S  +P   R    ++ DFGGVGDG TL
Sbjct  33   LFTVLWLAAFASVFIWQRNAVVGGFSFLRWGVASRPIP-RLRPAAFNLTDFGGVGDGVTL  91

Query  750  NTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            NT AF+ A+Y I  L ++GG  L +PPG +LT PFNLTSHMTL+LA  A
Sbjct  92   NTEAFQRAVYAISKLGKKGGGQLNVPPGRWLTAPFNLTSHMTLFLADDA  140



>ref|XP_002883030.1| hypothetical protein ARALYDRAFT_318449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59289.1| hypothetical protein ARALYDRAFT_318449 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
             Q   +W +A   LL      G    C  I  +  R   +SI +FG VGDG+TLNT AF+
Sbjct  1    MQVALVWLLAFTILL--IRGEGNNAICKEIFKLDPRPHSVSILEFGAVGDGKTLNTLAFQ  58

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AI+ ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  59   NAIFYLKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  101



>ref|XP_008340766.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=456

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  654  EWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPG  833
            + + C   + +  R   +SI +FG VGDG+TLNT+AF+ AI+ ++    +GG  LY+PPG
Sbjct  24   DEKPCDSKLTLEQRPHSVSISEFGAVGDGKTLNTHAFQNAIFYLKSFADKGGAQLYVPPG  83

Query  834  VYLTGPFNLTSHMTLYLARGA  896
             +LTG FNLTSH+TL+L +GA
Sbjct  84   RWLTGSFNLTSHLTLFLEKGA  104



>dbj|BAA95779.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=453

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
             Q   +W +A   LL S    G    C     +  R   +SI +FG VGDG+TLNT AF+
Sbjct  1    MQVALVWLLAFTILLISGE--GNNAICKENFKLDPRPHSVSILEFGAVGDGKTLNTIAFQ  58

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             A++ ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  59   NAVFYLKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  101



>ref|XP_009346202.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=456

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C   + +  R   +SI +FG VGDG+TLNT+AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  28   CDSKLTLKQRPHSVSISEFGAVGDGKTLNTHAFQNAIFYLKSFADKGGAQLYVPPGRWLT  87

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L +GA
Sbjct  88   GSFNLTSHLTLFLEKGA  104



>ref|XP_006474701.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=495

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = +3

Query  585  FFQTISLWSMAVVFLLRSAAAAG-----EWETCSWIVPMSYRNDKISIKDFGGVGDGRTL  749
             F  + L + A VF+ +  A  G      W   S  +P   R    ++ DFGGVGDG TL
Sbjct  33   LFTVLWLAAFASVFIWQRNAVVGGFLFLRWGVASRPIP-RLRPAAFNLTDFGGVGDGVTL  91

Query  750  NTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            NT AF+ A+Y I  L ++GG  L +PPG +LT PFNLTSHMTL+LA  A
Sbjct  92   NTEAFQRAVYAISKLGKKGGGQLNVPPGRWLTAPFNLTSHMTLFLAEDA  140



>gb|KEH37170.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=452

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+ E C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  19   GDVEICRLNPKLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPP  78

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  79   GNWLTGSFNLTSHLTLFLEKGA  100



>ref|NP_188308.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AAK59579.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAM44924.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE75873.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=455

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A   LL S    G    C     +  R   +SI +FG VGDG+TLNT AF+ A++ 
Sbjct  8    VWLLAFTILLISGE--GNNAICKENFKLDPRPHSVSILEFGAVGDGKTLNTIAFQNAVFY  65

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  66   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  103



>ref|XP_004487815.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=454

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+ E C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  19   GDVEQCGLNPKLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYLPP  78

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  79   GQWLTGSFNLTSHLTLFLEKGA  100



>ref|XP_006297662.1| hypothetical protein CARUB_v10013686mg [Capsella rubella]
 gb|EOA30560.1| hypothetical protein CARUB_v10013686mg [Capsella rubella]
Length=451

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A + LL      G    C     +  R   +SI +FG VGDG+TLNT AF+ AI+ 
Sbjct  8    VWLLAFIILL--IRGEGNNAICKKSFKLDPRPHSVSILEFGAVGDGKTLNTLAFQNAIFY  65

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  66   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  103



>gb|AAM62920.1| polygalacturonase, putative [Arabidopsis thaliana]
Length=453

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A   LL S    G    C     +  R   +SI +FG VGDG+TLNT AF+ A++ 
Sbjct  6    VWLLAFTILLISGE--GNNAICKENFKLDPRPHSVSILEFGAVGDGKTLNTIAFQNAVFY  63

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  64   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  101



>ref|XP_004245570.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=483

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  654  EWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPG  833
            +WET  +   +S R    S+ DFGGVGDG+TLNT+AFR A+  +   +  GG++LY+P G
Sbjct  39   KWETVEYPA-ISCRAHTASLTDFGGVGDGKTLNTDAFRTAVDHLSQFQSDGGSMLYVPAG  97

Query  834  VYLTGPFNLTSHMTLYLARGA  896
             +LTG FNLTSH TLYL + A
Sbjct  98   KWLTGSFNLTSHFTLYLDKDA  118



>ref|XP_009793070.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=482

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 6/100 (6%)
 Frame = +3

Query  612  MAVVFLLRSAAAAG-----EWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAI  776
            +AVV L       G     +WET  +   +S R    S+ DFGGVGDG TLNTNAF+ A+
Sbjct  20   LAVVILTALGNVHGRHKVHKWETVEYSA-ISCRAHTASLTDFGGVGDGTTLNTNAFKSAV  78

Query  777  YRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
              +   +  GG++LY+P G +LTG FNLTSH TLYL + A
Sbjct  79   DHLSQFQSDGGSMLYVPAGKWLTGSFNLTSHFTLYLDKDA  118



>ref|XP_008223260.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=452

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  654  EWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPG  833
            + + C + + +  R   +SI +FG VGDGRTLNT AF+ AI+ ++    +GG  LY+PPG
Sbjct  24   DEKPCDYNLTLEPRPHSVSILEFGAVGDGRTLNTLAFQNAIFYLKSFADKGGAQLYVPPG  83

Query  834  VYLTGPFNLTSHMTLYLARGA  896
             +LTG FNLTSH+TL+L +GA
Sbjct  84   RWLTGSFNLTSHLTLFLEKGA  104



>ref|XP_006646109.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=444

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDK-ISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIP  827
            G  ETCS IVP   R    +S+         RTL+T AF+ A+  IE  R  GG LLY+P
Sbjct  23   GAQETCSGIVPAPPRRGAWVSVASXXXXXXXRTLSTAAFQAAVASIERRRAPGGALLYVP  82

Query  828  PGVYLTGPFNLTSHMTLYLARGA  896
            PGV+LTGPFNLTSHMTL+LARGA
Sbjct  83   PGVWLTGPFNLTSHMTLFLARGA  105



>ref|XP_007223360.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
 gb|EMJ24559.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
Length=452

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  654  EWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPG  833
            + + C + + +  R   +SI +FG VGDGRTLNT AF+ AI+ ++    +GG  LY+PPG
Sbjct  24   DEKPCDYNLTLEPRPHSVSILEFGAVGDGRTLNTLAFQNAIFYLKSFADKGGAQLYVPPG  83

Query  834  VYLTGPFNLTSHMTLYLARGA  896
             +LTG FNLTSH+TL+L +GA
Sbjct  84   RWLTGSFNLTSHLTLFLEKGA  104



>ref|XP_006452841.1| hypothetical protein CICLE_v10008093mg [Citrus clementina]
 gb|ESR66081.1| hypothetical protein CICLE_v10008093mg [Citrus clementina]
Length=495

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = +3

Query  585  FFQTISLWSMAVVFLLRSAAAAG-----EWETCSWIVPMSYRNDKISIKDFGGVGDGRTL  749
             F  + L + A VF+ +  A  G      W   S  +P   R    ++ DFGGVGDG TL
Sbjct  33   LFTVLWLAAFASVFIWQRNAVVGGFSFLRWGVASRPIP-RLRPVAFNLTDFGGVGDGVTL  91

Query  750  NTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            NT AF+ A+Y I  L ++GG  L +PPG +LT PFNLTSHMTL+LA  A
Sbjct  92   NTEAFQRAVYAISKLGKKGGGQLNVPPGRWLTAPFNLTSHMTLFLADDA  140



>ref|XP_010487555.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=452

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A   LL      G    C     +  R   +SI +FG VGDG+TLNT AF+ AI+ 
Sbjct  8    VWLLAFSILL--IGGEGSNAICKESFKLDPRPHSVSILEFGAVGDGKTLNTLAFQNAIFY  65

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  66   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  103



>ref|XP_010504717.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=451

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A   LL      G    C     +  R   +SI +FG VGDG+TLNT AF+ AI+ 
Sbjct  8    VWLLAFSILL--IGGEGSNAICKESFKLDPRPHSVSILEFGAVGDGKTLNTLAFQNAIFY  65

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  66   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  103



>dbj|BAK03831.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07385.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 9/107 (8%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAA----AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNT  755
            F  + LW  A +F+  +      A         + PM+Y     ++ DFGGVGDGRT+NT
Sbjct  39   FTLVFLWQSASMFVAGAGGGPRPALPPSRPAPRLRPMAY-----NLTDFGGVGDGRTVNT  93

Query  756  NAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AF  A+  I     RGG  L +PPG +LTGPFNLTSHMTL+LA GA
Sbjct  94   RAFERAVETITAFADRGGAQLNVPPGRWLTGPFNLTSHMTLFLAEGA  140



>ref|XP_002273305.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 ref|XP_010649564.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=457

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C+  + +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  28   CTNSLTLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGKWLT  87

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L RGA
Sbjct  88   GSFNLTSHLTLFLERGA  104



>emb|CBI22951.3| unnamed protein product [Vitis vinifera]
Length=482

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C+  + +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  26   CTNSLTLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGKWLT  85

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L RGA
Sbjct  86   GSFNLTSHLTLFLERGA  102



>ref|XP_007138953.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
 gb|ESW10947.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
Length=452

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  648  AGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIP  827
            +G+   C     ++ R   +SI +FG VGDGRTLNT AF+ AI+ ++    +GG  LY+P
Sbjct  18   SGDGGQCGSNPTLNPRPHSVSILEFGAVGDGRTLNTIAFQNAIFYLKSFADKGGAQLYVP  77

Query  828  PGVYLTGPFNLTSHMTLYLARGA  896
            PG +LTG FNLTSH+TL+L +GA
Sbjct  78   PGKWLTGSFNLTSHLTLFLEKGA  100



>ref|XP_010917443.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=487

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            F T+ LW  + +  L     A   +    + P +Y     +I DFGGVGDG TLNT AF 
Sbjct  35   FATVFLWQSSSIDGLLFFRRALPDKAAPRLRPFAY-----NITDFGGVGDGVTLNTEAFE  89

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             A+  I   R RGG  L +PPGV+LT PFNLTSHMTL+LA GA
Sbjct  90   RAVAAIARHRGRGGGQLNVPPGVWLTAPFNLTSHMTLFLAEGA  132



>gb|ABR18040.1| unknown [Picea sitchensis]
Length=472

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +3

Query  585  FFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
             FQ + L    +V  ++     G W + S++ P S R   +SI +FGGVGDG T+NT AF
Sbjct  8    LFQVLLLLGCLIVLGVKVECQKGSW-SFSYVAP-SCRAQSVSIAEFGGVGDGTTVNTEAF  65

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            R+AI  +      GG  LYIPPG +LTG FNLT H TLYL + A
Sbjct  66   RKAIEHLSEFSETGGGQLYIPPGRWLTGSFNLTDHFTLYLHKEA  109



>gb|KHM99685.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 54/87 (62%), Gaps = 18/87 (21%)
 Frame = +3

Query  636  SAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTL  815
            S AA     TCS IV + YR+D+IS+ DFGGVGD                  L R GGTL
Sbjct  19   SVAAIYSTTTCSNIVSLRYRSDRISVTDFGGVGD------------------LPRDGGTL  60

Query  816  LYIPPGVYLTGPFNLTSHMTLYLARGA  896
            LY+PPGVYLT  FNLTSHMTLYLA GA
Sbjct  61   LYVPPGVYLTESFNLTSHMTLYLAAGA  87



>ref|XP_012084001.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
Length=455

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  28   CDYKPSIDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGKWLT  87

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L +GA
Sbjct  88   GSFNLTSHLTLFLEKGA  104



>gb|KDP27854.1| hypothetical protein JCGZ_18934 [Jatropha curcas]
Length=453

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  26   CDYKPSIDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGKWLT  85

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L +GA
Sbjct  86   GSFNLTSHLTLFLEKGA  102



>ref|XP_006343936.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=483

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 6/100 (6%)
 Frame = +3

Query  612  MAVVFLLRSAAAAG-----EWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAI  776
            +AVV L       G     +WET  +   +S R    S+ DFGG+GDG TLNT+AFR A+
Sbjct  20   LAVVILTAFGNVHGRHKVHKWETVEYSA-ISCRAHTASLTDFGGIGDGTTLNTDAFRTAV  78

Query  777  YRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
              +   +  GG++LY+P G +LTG FNLTSH TLYL + A
Sbjct  79   DHLSQFQSDGGSMLYVPAGKWLTGSFNLTSHFTLYLDKDA  118



>ref|XP_011011880.1| PREDICTED: probable polygalacturonase isoform X1 [Populus euphratica]
Length=450

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  645  AAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYI  824
            AA   E C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+
Sbjct  21   AAESSEMCGFKPSLKPRPHSVSILEFGAVGDGKTLNTLAFQNAIFYLKSFTDKGGAQLYV  80

Query  825  PPGVYLTGPFNLTSHMTLYLARGA  896
            PPG +LTG F+LTSH+TL++ +GA
Sbjct  81   PPGKWLTGSFSLTSHLTLFVEKGA  104



>ref|XP_010465709.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=452

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A   LL      G    C     +  R   +SI +FG VGDG+ LNT AF+ AI+ 
Sbjct  8    VWLLAFSILL--IGGEGSNAVCKESFKLDPRPHSVSILEFGAVGDGKALNTLAFQNAIFY  65

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  66   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  103



>ref|XP_011651065.1| PREDICTED: probable polygalacturonase isoform X1 [Cucumis sativus]
Length=458

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAA---GEW--ETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
             W +A++  L+ + AA   GE     C     +  R   +SI +FG VGDG+TLNT AF+
Sbjct  4    FWQVALLLFLQLSNAAKIIGEELVGQCDSKPTLDPRPHSVSILEFGAVGDGKTLNTIAFQ  63

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AI+ ++    +GG  LY+PPG +LTG  NLTSH+TL+L +GA
Sbjct  64   NAIFYLKSFADKGGAQLYVPPGKWLTGSINLTSHLTLFLEKGA  106



>ref|XP_008438913.1| PREDICTED: probable polygalacturonase isoform X1 [Cucumis melo]
Length=458

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAA---GEW--ETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
             W +A++  L+ + AA   GE     C     +  R   +SI +FG VGDG+TLNT AF+
Sbjct  4    FWQVALLLFLQLSNAARIIGEELAGQCDSKPTLDPRPHSVSILEFGAVGDGKTLNTIAFQ  63

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AI+ ++    +GG  LY+PPG +LTG  NLTSH+TL+L +GA
Sbjct  64   NAIFYLKSFADKGGAQLYVPPGKWLTGSINLTSHLTLFLEKGA  106



>ref|XP_006345257.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=495

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 70/122 (57%), Gaps = 12/122 (10%)
 Frame = +3

Query  543  VFFSDKAL-NKIMSPFFQTISLWSM---AVVFLLRSAAAAGEWETCSWIVPMSYRNDKIS  710
            VF + KA+   +   F  T+  W +   A + + R    A E       VP  +R    +
Sbjct  27   VFTTHKAIVTAVWIAFLVTVFWWQVDATAGILIFRRVFPAKE-------VP-KFRPVAFN  78

Query  711  IKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLAR  890
            + DFGGVGDG T+NT AF +AI  I  L ++GG  L +PPG +LT PFNLTSHMTL+LA 
Sbjct  79   LTDFGGVGDGVTVNTEAFEKAILAIAKLGKKGGGQLNVPPGYWLTAPFNLTSHMTLFLAE  138

Query  891  GA  896
            GA
Sbjct  139  GA  140



>ref|XP_012086833.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 gb|KDP25392.1| hypothetical protein JCGZ_20548 [Jatropha curcas]
Length=480

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C     +S R  + S++DFGGVGDG+T NTNAF+ AI  +      GG+ LY+PPG +LT
Sbjct  40   CFEYAAISCRAHEASLEDFGGVGDGQTSNTNAFKSAIEHLSQFSSDGGSQLYVPPGKWLT  99

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH TL+L + A
Sbjct  100  GSFNLTSHFTLFLDKDA  116



>ref|XP_010558428.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=443

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +3

Query  639  AAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLL  818
            A  +G    C        R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  L
Sbjct  21   ARDSGAGNVCDLSRRPDTRPHSVSISEFGAVGDGKTLNTLAFQNAIFYLKSFADKGGAQL  80

Query  819  YIPPGVYLTGPFNLTSHMTLYLARGA  896
            Y+PPG +LTG FNLTSH+TL+L +GA
Sbjct  81   YVPPGRWLTGSFNLTSHLTLFLEKGA  106



>ref|XP_010048020.1| PREDICTED: probable polygalacturonase isoform X1 [Eucalyptus 
grandis]
 gb|KCW88986.1| hypothetical protein EUGRSUZ_A01315 [Eucalyptus grandis]
Length=456

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LTG FNLTSH+
Sbjct  37   RPHSVSITEFGAVGDGKTLNTVAFQNAIFYLKSFADKGGAQLYVPPGRWLTGSFNLTSHL  96

Query  873  TLYLARGA  896
            TL+L RGA
Sbjct  97   TLFLERGA  104



>gb|KHG18940.1| putative polygalacturonase [Gossypium arboreum]
Length=457

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G +  C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  23   GNYLQCDHNPTLQPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPP  82

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  83   GRWLTGSFNLTSHLTLFLEKGA  104



>ref|XP_010048025.1| PREDICTED: probable polygalacturonase isoform X2 [Eucalyptus 
grandis]
Length=455

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LTG FNLTSH+
Sbjct  36   RPHSVSITEFGAVGDGKTLNTVAFQNAIFYLKSFADKGGAQLYVPPGRWLTGSFNLTSHL  95

Query  873  TLYLARGA  896
            TL+L RGA
Sbjct  96   TLFLERGA  103



>gb|AFK48190.1| unknown [Lotus japonicus]
Length=482

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 9/105 (9%)
 Frame = +3

Query  588  FQTISLWSMAVV--FLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNA  761
            F ++ LW    +  FL+     +G      W  P+  R    ++ DFGGVGDG TLNT A
Sbjct  30   FASVFLWQGNEINGFLVLGGVVSG------WTPPL-LRPVAFNLTDFGGVGDGVTLNTVA  82

Query  762  FREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            F  A+  I  LR +GG  L +PPG++LT PFNLTSHMTL+LA+ A
Sbjct  83   FERAVSAISKLREKGGGQLNVPPGLWLTAPFNLTSHMTLFLAQDA  127



>ref|XP_003533248.1| PREDICTED: probable polygalacturonase isoform X1 [Glycine max]
Length=452

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+   C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  19   GDGGQCGSNPTLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPP  78

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  79   GKWLTGSFNLTSHLTLFLEKGA  100



>ref|XP_004251701.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=495

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 70/122 (57%), Gaps = 12/122 (10%)
 Frame = +3

Query  543  VFFSDKAL-NKIMSPFFQTISLWSM---AVVFLLRSAAAAGEWETCSWIVPMSYRNDKIS  710
            VF + KA+   +   F  T+  W +   A + + R    A E       VP  +R    +
Sbjct  27   VFTTHKAIITAVWIAFLVTVFWWQVDATAGILIFRRVFPARE-------VP-KFRPVAFN  78

Query  711  IKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLAR  890
            + DFGGVGDG T+NT AF +AI  I  L ++GG  L +PPG +LT PFNLTSHMTL+LA 
Sbjct  79   LTDFGGVGDGVTVNTEAFEKAILAIAKLGKKGGGQLNVPPGYWLTAPFNLTSHMTLFLAE  138

Query  891  GA  896
            GA
Sbjct  139  GA  140



>ref|XP_008345224.1| PREDICTED: probable polygalacturonase isoform X2 [Malus domestica]
Length=453

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 62/101 (61%), Gaps = 2/101 (2%)
 Frame = +3

Query  600  SLWSMAVVFLLRSAAAAGEWET--CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREA  773
            SL ++ ++    SA   GE +   C        R   +S+ +FG VGDG+TLNT AF+ A
Sbjct  3    SLLALVLILAFTSAEYDGEGKDRECEGKKLFDPRPHSVSLLEFGAVGDGKTLNTVAFQNA  62

Query  774  IYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            I+ ++    +GG  LY+PPG +LTG FNLTSH+TL+L  GA
Sbjct  63   IFYVKSFADKGGAQLYVPPGRWLTGSFNLTSHLTLFLEAGA  103



>emb|CDX95899.1| BnaC05g36500D [Brassica napus]
Length=453

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
             Q   +W +A   LL     +     C     +  R   +SI +FG VGDG++LNT AF+
Sbjct  1    MQVALVWLLAFTNLLLIKVESNN-AVCKKTFNLDPRPHSVSILEFGAVGDGKSLNTIAFQ  59

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AI+ ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  60   NAIFYLKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  102



>emb|CDP20376.1| unnamed protein product [Coffea canephora]
Length=484

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  684  MSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLT  863
            +S R    SI++FGGVGDGRTLNT AF+EA+ ++      GG  LY+P G +LTG FNLT
Sbjct  51   ISCRGHSASIEEFGGVGDGRTLNTKAFQEAVNQLSQYASEGGAQLYVPAGKWLTGSFNLT  110

Query  864  SHMTLYLARGA  896
            SH TLYL + A
Sbjct  111  SHFTLYLHKDA  121



>ref|XP_011458751.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458752.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
Length=470

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  573  IMSPFFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLN  752
            ++ PF        +A+V +L  ++A      C     ++ R   +S+ +FG VGDG+TLN
Sbjct  11   VVQPFLLVFCYLQLALVLVLGYSSALQYEGECDNQKALNPRPHSVSLLEFGAVGDGKTLN  70

Query  753  TNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            T AF+ A++ ++    +GG  LY+PPG +LTG F LTSH+TL++  GA
Sbjct  71   TVAFQNAVFYVKSFADKGGAQLYVPPGRWLTGSFYLTSHLTLFIETGA  118



>ref|XP_006406800.1| hypothetical protein EUTSA_v10020710mg [Eutrema salsugineum]
 gb|ESQ48253.1| hypothetical protein EUTSA_v10020710mg [Eutrema salsugineum]
Length=454

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  27   CKKTFNLDPRPHSVSILEFGAVGDGKTLNTLAFQNAIFYLKSFADKGGAQLYVPPGKWLT  86

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L +GA
Sbjct  87   GSFNLTSHLTLFLEKGA  103



>ref|XP_010670927.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=457

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  660  ETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVY  839
            E C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ +     +GG  LY+PPG +
Sbjct  26   EQCRYKPKLDPRPHSVSIVEFGAVGDGKTLNTGAFQNAIFYLNSFADKGGAQLYVPPGKW  85

Query  840  LTGPFNLTSHMTLYLARGA  896
            LTG FNLTSH+TL+L   A
Sbjct  86   LTGSFNLTSHLTLFLEADA  104



>ref|XP_006586911.1| PREDICTED: probable polygalacturonase isoform X2 [Glycine max]
Length=472

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+   C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  39   GDGGQCGSNPTLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPP  98

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  99   GKWLTGSFNLTSHLTLFLEKGA  120



>gb|KJB34665.1| hypothetical protein B456_006G077400 [Gossypium raimondii]
Length=452

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C   +  + R   +SI++FG +GDG+TLNT AFR AI+ ++    +GG  LY+PPG +LT
Sbjct  26   CDHKLKFNPRPHSVSIQEFGAIGDGKTLNTIAFRNAIFYLKSFADKGGAQLYVPPGRWLT  85

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L + A
Sbjct  86   GSFNLTSHLTLFLEKDA  102



>gb|KHG14610.1| putative polygalacturonase [Gossypium arboreum]
Length=452

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C   +  + R   +SI++FG +GDG+TLNT AFR AI+ ++    +GG  LY+PPG +LT
Sbjct  26   CDHKLKFNPRPHSVSIQEFGAIGDGKTLNTIAFRNAIFYLKSFADKGGAQLYVPPGRWLT  85

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L + A
Sbjct  86   GSFNLTSHLTLFLEKDA  102



>gb|KHN26517.1| Putative polygalacturonase [Glycine soja]
Length=473

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G+   C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  40   GDGGQCGSNPTLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPP  99

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  100  GKWLTGSFNLTSHLTLFLEKGA  121



>ref|XP_012077081.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 gb|KDP33939.1| hypothetical protein JCGZ_07510 [Jatropha curcas]
Length=492

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 62/108 (57%), Gaps = 5/108 (5%)
 Frame = +3

Query  585  FFQTISLWSMAVVFLLRSAAAAGEWETCSWIVPM----SYRNDKISIKDFGGVGDGRTLN  752
             F  + + + A VF+ +     G +    W VPM      R    ++ DFGGVGDG TLN
Sbjct  31   LFTVLWIAAFASVFMWQRNVVGGGF-AVFWRVPMRPMPKLRPVAFNLTDFGGVGDGVTLN  89

Query  753  TNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            T AF  AI  I  L ++GG  L +PPG +LT PFNLTSHMTL+LA  A
Sbjct  90   TEAFERAILAISKLGKKGGGQLNVPPGRWLTAPFNLTSHMTLFLAEDA  137



>ref|XP_010245458.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=462

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (63%), Gaps = 5/104 (5%)
 Frame = +3

Query  600  SLWSMAVVFLLRSAAAAGEWE-----TCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAF  764
            S+ S   +FLL   +   E++      C +   +  R   +SI +FG VGDG+TLNT AF
Sbjct  4    SIDSNVTLFLLLFLSNGIEFDGSIEGQCRYKRALDSRPHSVSILEFGAVGDGKTLNTIAF  63

Query  765  REAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            + AI+ ++    +GG  LY+PPG +LTG F+LTSH+TL+L RGA
Sbjct  64   QNAIFYLKSFADKGGAQLYVPPGRWLTGSFSLTSHLTLFLERGA  107



>gb|KHG12205.1| putative polygalacturonase [Gossypium arboreum]
Length=454

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C   + +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  28   CDVNLTLRSRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGRWLT  87

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L +GA
Sbjct  88   GSFNLTSHLTLFLEKGA  104



>ref|XP_007035679.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY06605.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=608

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C+  + +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  182  CNHKLTLDPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGRWLT  241

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L +GA
Sbjct  242  GSFNLTSHLTLFLEKGA  258



>gb|KJB72747.1| hypothetical protein B456_011G194200 [Gossypium raimondii]
Length=454

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C   + +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  28   CDVNLTLRSRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGRWLT  87

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L +GA
Sbjct  88   GSFNLTSHLTLFLEKGA  104



>emb|CDX82390.1| BnaA03g34310D [Brassica napus]
Length=449

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
             Q   +W +A   +L     + +   C     +  R   +SI +FG VGDG+ LNT AF+
Sbjct  1    MQVALVWLLAFTNVLLIRGESNDATICKDHFMLDPRPHSVSILEFGAVGDGKYLNTLAFQ  60

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             AI+ ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  61   NAIFYLKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  103



>emb|CDY05885.1| BnaC08g20620D [Brassica napus]
Length=464

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  684  MSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLT  863
            ++ R  K  I DFGGVGDG+T NT AF+ AI  + HL   GG  L +PPG +LTG FNLT
Sbjct  38   LNCRKHKAVITDFGGVGDGKTSNTKAFKTAISNLSHLASYGGAQLVVPPGKWLTGSFNLT  97

Query  864  SHMTLYLARGA  896
            SH TL++ +GA
Sbjct  98   SHFTLFIQKGA  108



>ref|XP_006380233.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|ERP58030.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=450

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  660  ETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVY  839
            E C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +
Sbjct  26   EVCGFKPSLKPRPHSVSILEFGAVGDGKTLNTLAFQNAIFYLKSFTDKGGAQLYVPPGKW  85

Query  840  LTGPFNLTSHMTLYLARGA  896
            LTG F+LTSH+TL++ +GA
Sbjct  86   LTGSFSLTSHLTLFVEKGA  104



>ref|XP_011078124.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=493

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  708  SIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLA  887
            ++ DFGGVGDG TLNT AF  A+  I  LR++GG  L +PPG +LT PFNLTSHMTL+LA
Sbjct  76   NLTDFGGVGDGVTLNTAAFERAVTAISKLRKKGGGQLNVPPGYWLTAPFNLTSHMTLFLA  135

Query  888  RGA  896
             GA
Sbjct  136  EGA  138



>gb|KJB38842.1| hypothetical protein B456_006G260100 [Gossypium raimondii]
Length=457

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G +  C        R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  23   GNYLQCDHNPTSQPRPHSVSILEFGAVGDGKTLNTMAFQNAIFYLKSFADKGGAQLYVPP  82

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  83   GRWLTGSFNLTSHLTLFLEKGA  104



>gb|KJB38840.1| hypothetical protein B456_006G260100 [Gossypium raimondii]
Length=457

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G +  C        R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  23   GNYLQCDHNPTSQPRPHSVSILEFGAVGDGKTLNTMAFQNAIFYLKSFADKGGAQLYVPP  82

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LTG FNLTSH+TL+L +GA
Sbjct  83   GRWLTGSFNLTSHLTLFLEKGA  104



>emb|CDX92101.1| BnaA05g23060D [Brassica napus]
Length=455

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A   LL     +     C     +  R   +SI +FG VGDG++LNT AF+ AI+ 
Sbjct  8    VWLLAFTNLLFIKVESNN-AVCKKTFKLDPRPHSVSILEFGAVGDGKSLNTIAFQNAIFY  66

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  67   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  104



>gb|EYU25832.1| hypothetical protein MIMGU_mgv1a004737mg [Erythranthe guttata]
Length=512

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R+   ++ DFGGVGDG TLNT AF  A+  I  LR +GG  L +PPG +LT PFNLTSHM
Sbjct  90   RHAAFNLTDFGGVGDGITLNTAAFERAVVAISKLRNKGGGQLNVPPGNWLTAPFNLTSHM  149

Query  873  TLYLARGA  896
            TL+LA GA
Sbjct  150  TLFLAEGA  157



>ref|XP_002884608.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60867.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +3

Query  639  AAAAGEWETCSWI--VPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGT  812
            A   G  + C  +  + +S R   +SI DFG VGDG+TLNT AF+ A++ +     +GG 
Sbjct  19   AKVLGAGKICDELGRISLSTRPHSVSITDFGAVGDGKTLNTLAFQNAVFYLMSFADKGGA  78

Query  813  LLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             LY+PPG +LTG F+LTSH+TL+L  GA
Sbjct  79   QLYVPPGNWLTGSFSLTSHLTLFLENGA  106



>ref|XP_010245459.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=458

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  27   CRYKRALDSRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGRWLT  86

Query  846  GPFNLTSHMTLYLARGA  896
            G F+LTSH+TL+L RGA
Sbjct  87   GSFSLTSHLTLFLERGA  103



>ref|XP_006597720.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=452

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LTG FNLTSH+
Sbjct  33   RPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGKWLTGSFNLTSHL  92

Query  873  TLYLARGA  896
            TL+L +GA
Sbjct  93   TLFLEKGA  100



>ref|XP_010548972.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=457

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R   +SI +FG VGDG+TLNT AF+ A++ ++    +GG  LY+PPG +LTG FNLTSH+
Sbjct  40   RPHSVSISEFGAVGDGKTLNTVAFQNAVFYLKSFADKGGAQLYVPPGKWLTGSFNLTSHL  99

Query  873  TLYLARGA  896
            TL+L +GA
Sbjct  100  TLFLDKGA  107



>ref|XP_007151453.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
 gb|ESW23447.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
Length=476

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  684  MSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLT  863
            ++ R    S+ DFGGVGDG+T NT AF+ AI ++      GG  L +PPG +LTGPFNLT
Sbjct  50   INCRKHSASLTDFGGVGDGKTSNTKAFQSAITKLSQHASDGGATLIVPPGKWLTGPFNLT  109

Query  864  SHMTLYLARGA  896
            SH TL+L +GA
Sbjct  110  SHFTLFLQKGA  120



>gb|AFK44529.1| unknown [Lotus japonicus]
Length=469

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 5/103 (5%)
 Frame = +3

Query  588  FQTISLWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFR  767
            F  + L S+ VV  +R+      +E C+    ++ R    S+ DFGGVGDG TLNT AFR
Sbjct  9    FMMVVLPSLHVVESVRTPVLE-NFEYCA----VNCRAYSASVTDFGGVGDGTTLNTQAFR  63

Query  768  EAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            +AI  +      GG+ LY+PPG +LTG FNLTSH TL++ + A
Sbjct  64   KAIEHLSQYSSNGGSQLYVPPGRWLTGSFNLTSHFTLFIHKDA  106



>ref|XP_009135501.1| PREDICTED: probable polygalacturonase isoform X1 [Brassica rapa]
Length=451

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 0/98 (0%)
 Frame = +3

Query  603  LWSMAVVFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYR  782
            +W +A   +L     + +   C     +  R   +SI +FG VGDG+ LNT AF+ AI+ 
Sbjct  8    VWLLAFTNVLLIRGESNDATICKDHFMLDPRPHSVSILEFGAVGDGKYLNTLAFQNAIFY  67

Query  783  IEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            ++    +GG  LY+PPG +LTG FNLTSH+TL+L +GA
Sbjct  68   LKSFADKGGAQLYVPPGKWLTGSFNLTSHLTLFLEKGA  105



>emb|CBI36899.3| unnamed protein product [Vitis vinifera]
Length=477

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C +   +  R   +SI +FG VGDG+T NT AF  AI+ ++    +GG  LY+PPG +LT
Sbjct  49   CKYKKSLEPRPHSVSILEFGAVGDGKTSNTIAFENAIFYLKSFADKGGAQLYVPPGRWLT  108

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L RGA
Sbjct  109  GSFNLTSHLTLFLERGA  125



>ref|XP_010259446.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
 ref|XP_010259447.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=458

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LTG FNLTSH+
Sbjct  37   RPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGRWLTGSFNLTSHL  96

Query  873  TLYLARGA  896
            TL+L +GA
Sbjct  97   TLFLEKGA  104



>ref|XP_006597719.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=471

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LTG FNLTSH+
Sbjct  52   RPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGKWLTGSFNLTSHL  111

Query  873  TLYLARGA  896
            TL+L +GA
Sbjct  112  TLFLEKGA  119



>ref|XP_009418007.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=491

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  708  SIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLA  887
            ++ DFGGVGDG+TLNT AF  A+  I  L  RGG  L +PPG +LT PFNLTSHMTL+LA
Sbjct  74   NLTDFGGVGDGKTLNTEAFERAVEAISTLGARGGGQLNVPPGFWLTAPFNLTSHMTLFLA  133

Query  888  RGA  896
             GA
Sbjct  134  EGA  136



>ref|XP_010047459.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW79371.1| hypothetical protein EUGRSUZ_C00786 [Eucalyptus grandis]
Length=509

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +3

Query  621  VFLLRSAAAAGEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRR  800
            +F  RSA    EWE     VP   R    ++ DFGGVGDG T+NT AF  A+  I  L +
Sbjct  69   IFRWRSA----EWEAGR-AVP-RLRPVAFNLTDFGGVGDGVTVNTEAFERAVRAISKLGK  122

Query  801  RGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
            RGG  L +PPG +LT PFNLTSHMTL+LA GA
Sbjct  123  RGGGQLNVPPGRWLTAPFNLTSHMTLFLAEGA  154



>ref|XP_010652214.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=456

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C +   +  R   +SI +FG VGDG+T NT AF  AI+ ++    +GG  LY+PPG +LT
Sbjct  28   CKYKKSLEPRPHSVSILEFGAVGDGKTSNTIAFENAIFYLKSFADKGGAQLYVPPGRWLT  87

Query  846  GPFNLTSHMTLYLARGA  896
            G FNLTSH+TL+L RGA
Sbjct  88   GSFNLTSHLTLFLERGA  104



>gb|KDO35850.1| hypothetical protein CISIN_1g044614mg, partial [Citrus sinensis]
Length=151

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  693  RNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHM  872
            R   +SIKDFGGVGDG T NT AFR+A+  ++    +GG  L +P G++LTG FNLTS+ 
Sbjct  78   RKVAMSIKDFGGVGDGTTSNTEAFRKAVRYMQGFGDKGGAQLNVPEGLWLTGSFNLTSNF  137

Query  873  TLYLARGA  896
            TL+L RGA
Sbjct  138  TLFLERGA  145



>ref|XP_010055091.1| PREDICTED: probable polygalacturonase isoform X1 [Eucalyptus 
grandis]
 gb|KCW71568.1| hypothetical protein EUGRSUZ_E00104 [Eucalyptus grandis]
Length=481

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +3

Query  558  KALNKIMSPFFQTISLWSMAVVFLLRSAAAAGE----WETCSWIVPMSYRNDKISIKDFG  725
            K+  K  S     +++W++ V F++ +  A G     + T  +   MS R    S+ +FG
Sbjct  6    KSPMKTQSQGMNRVTIWAVIVAFVVIAGGAEGRNVKTFNTFEYSA-MSCRAHSASVTEFG  64

Query  726  GVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLARGA  896
             +GDG+TLNT AF  AI  +      GG LLY+P G +LTG FNLTSH TLYL R A
Sbjct  65   AIGDGKTLNTKAFEAAIAHLSRYSAVGGGLLYVPAGRWLTGTFNLTSHFTLYLHRHA  121



>ref|XP_004508182.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=461

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  27   CEFNPALKPRPHSVSILEFGAVGDGKTLNTIAFQNAIFYLKSFADKGGAQLYVPPGTWLT  86

Query  846  GPFNLTSHMTLYLARGA  896
              FNLTSH+TL+L +GA
Sbjct  87   QSFNLTSHLTLFLEKGA  103



>ref|XP_010255224.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=489

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 73/122 (60%), Gaps = 7/122 (6%)
 Frame = +3

Query  543  VFFSDKALNKIMSPFFQTISLWSMAVVFLLRSAAA----AGEWETCSWIVPMSYRNDKIS  710
            +FFS+  + KI++   + IS+  + V+ LL +  A    A   ++  +   MS R    S
Sbjct  7    MFFSNLHMVKIINLIMEIISV--LVVLGLLSTKGAECRRARILDSFQYSA-MSCRVHSAS  63

Query  711  IKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLAR  890
            + D+GGVGDG+TLNT AF+ AI  +      GG  L++PPG +LTG FNLTSH TL+L R
Sbjct  64   LTDYGGVGDGQTLNTKAFQSAIDHLSQFASDGGAQLFVPPGRWLTGSFNLTSHFTLFLHR  123

Query  891  GA  896
             A
Sbjct  124  DA  125



>ref|XP_004954128.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=501

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  708  SIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLTGPFNLTSHMTLYLA  887
            ++ DFGGVGDGR LNT AF  A+  I  L  RGG  L +PPG +LT PFNLTSHMTL+LA
Sbjct  84   NLTDFGGVGDGRALNTEAFERAVEAIAALAERGGGQLNVPPGRWLTAPFNLTSHMTLFLA  143

Query  888  RGA  896
             GA
Sbjct  144  EGA  146



>ref|XP_010914507.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=455

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +3

Query  657  WETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGV  836
            +E C +   ++ R   +SI DFG VGDG TLNT AF+ AI+ +     +GG  LY+P G 
Sbjct  24   YENCKYERSLNQRPHSVSITDFGAVGDGVTLNTLAFQNAIFYLRSFADKGGAQLYVPKGR  83

Query  837  YLTGPFNLTSHMTLYLARGA  896
            +LTG FNLTSH+TL+L + A
Sbjct  84   WLTGSFNLTSHLTLFLDKDA  103



>ref|XP_002314352.2| hypothetical protein POPTR_0010s00770g [Populus trichocarpa]
 gb|EEF00523.2| hypothetical protein POPTR_0010s00770g [Populus trichocarpa]
Length=453

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  666  CSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPPGVYLT  845
            C +   +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PPG +LT
Sbjct  26   CDFKPGLKPRPHSVSILEFGAVGDGKTLNTLAFQNAIFYLKSFTDKGGAQLYVPPGKWLT  85

Query  846  GPFNLTSHMTLYLARGA  896
            G F+LTSH+TL+L +GA
Sbjct  86   GSFSLTSHLTLFLEKGA  102



>ref|XP_003528627.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=449

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  651  GEWETCSWIVPMSYRNDKISIKDFGGVGDGRTLNTNAFREAIYRIEHLRRRGGTLLYIPP  830
            G    C     +  R   +SI +FG VGDG+TLNT AF+ AI+ ++    +GG  LY+PP
Sbjct  21   GSGRQCEINPALKPRPHTVSILEFGAVGDGKTLNTMAFQNAIFYLKSFADKGGAQLYVPP  80

Query  831  GVYLTGPFNLTSHMTLYLARGA  896
            G +LT  FNLTSH+TL+L +GA
Sbjct  81   GTWLTQSFNLTSHLTLFLEKGA  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2063602007762