BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1609

Length=1079
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009348751.1|  PREDICTED: serine/threonine-protein kinase S...    353   5e-116   Pyrus x bretschneideri [bai li]
ref|XP_008218556.1|  PREDICTED: serine/threonine-protein kinase S...    352   1e-115   Prunus mume [ume]
emb|CBI29763.3|  unnamed protein product                                351   2e-115   Vitis vinifera
ref|XP_008361703.1|  PREDICTED: serine/threonine-protein kinase S...    351   2e-115   
emb|CAN78793.1|  hypothetical protein VITISV_028464                     352   2e-115   Vitis vinifera
ref|XP_002269221.1|  PREDICTED: serine/threonine-protein kinase S...    352   2e-115   Vitis vinifera
ref|XP_012071302.1|  PREDICTED: serine/threonine-protein kinase S...    351   2e-115   Jatropha curcas
dbj|BAN15745.1|  subfamily 2 of SNF1-related protein kinase             352   2e-115   Dianthus caryophyllus [carnation]
ref|XP_011464827.1|  PREDICTED: serine/threonine-protein kinase S...    351   3e-115   Fragaria vesca subsp. vesca
ref|XP_002530676.1|  Serine/threonine-protein kinase ASK1, putative     351   3e-115   Ricinus communis
gb|KJB47470.1|  hypothetical protein B456_008G027800                    347   4e-115   Gossypium raimondii
gb|KJB79236.1|  hypothetical protein B456_013G038800                    350   6e-115   Gossypium raimondii
gb|KJB47469.1|  hypothetical protein B456_008G027800                    345   1e-114   Gossypium raimondii
gb|ABG81507.1|  serine/threonine protein kinase                         350   1e-114   Camellia sinensis [black tea]
ref|XP_008339496.1|  PREDICTED: serine/threonine-protein kinase S...    349   1e-114   
gb|ACJ84339.1|  unknown                                                 342   2e-114   Medicago truncatula
emb|CDO97575.1|  unnamed protein product                                349   2e-114   Coffea canephora [robusta coffee]
gb|KDO50084.1|  hypothetical protein CISIN_1g0187342mg                  342   2e-114   Citrus sinensis [apfelsine]
gb|KJB47472.1|  hypothetical protein B456_008G027800                    348   2e-114   Gossypium raimondii
ref|XP_011087723.1|  PREDICTED: serine/threonine-protein kinase S...    348   2e-114   Sesamum indicum [beniseed]
ref|XP_007222266.1|  hypothetical protein PRUPE_ppa007946mg             348   3e-114   Prunus persica
ref|XP_011092341.1|  PREDICTED: serine/threonine-protein kinase S...    348   3e-114   Sesamum indicum [beniseed]
ref|XP_010242684.1|  PREDICTED: serine/threonine-protein kinase S...    348   3e-114   Nelumbo nucifera [Indian lotus]
ref|XP_011028282.1|  PREDICTED: serine/threonine-protein kinase S...    347   3e-114   Populus euphratica
ref|XP_010242685.1|  PREDICTED: serine/threonine-protein kinase S...    347   3e-114   
gb|KJB47468.1|  hypothetical protein B456_008G027800                    348   3e-114   Gossypium raimondii
ref|XP_011028283.1|  PREDICTED: serine/threonine-protein kinase S...    348   4e-114   Populus euphratica
gb|EYU35455.1|  hypothetical protein MIMGU_mgv1a008963mg                347   9e-114   Erythranthe guttata [common monkey flower]
ref|XP_006384983.1|  kinase family protein                              347   1e-113   
ref|XP_007042267.1|  SNF1-related protein kinase 2.10 isoform 2         346   2e-113   
ref|XP_006847010.1|  PREDICTED: serine/threonine-protein kinase S...    346   2e-113   
ref|XP_007042266.1|  SNF1-related protein kinase 2.10 isoform 1         348   4e-113   
ref|XP_008781505.1|  PREDICTED: serine/threonine-protein kinase S...    345   4e-113   Phoenix dactylifera
ref|XP_006384982.1|  hypothetical protein POPTR_0004s22790g             346   5e-113   
emb|CAE54588.1|  serin/threonine protein kinase                         344   1e-112   Fagus sylvatica
ref|XP_003531593.1|  PREDICTED: serine/threonine-protein kinase S...    344   1e-112   Glycine max [soybeans]
ref|NP_001274892.1|  serine/threonine-protein kinase SRK2B-like         344   2e-112   Solanum tuberosum [potatoes]
ref|XP_004230475.1|  PREDICTED: serine/threonine-protein kinase S...    344   2e-112   Solanum lycopersicum
ref|XP_006431824.1|  hypothetical protein CICLE_v10001672mg             343   2e-112   Citrus clementina [clementine]
ref|XP_006471015.1|  PREDICTED: serine/threonine-protein kinase S...    343   3e-112   Citrus sinensis [apfelsine]
ref|XP_010101152.1|  Serine/threonine-protein kinase SAPK7              343   3e-112   Morus notabilis
ref|XP_007159914.1|  hypothetical protein PHAVU_002G278200g             343   4e-112   Phaseolus vulgaris [French bean]
ref|XP_002325309.2|  hypothetical protein POPTR_0019s00790g             343   4e-112   Populus trichocarpa [western balsam poplar]
emb|CAA06503.1|  protein kinase                                         343   4e-112   Craterostigma plantagineum
ref|XP_011001254.1|  PREDICTED: serine/threonine-protein kinase S...    342   5e-112   Populus euphratica
ref|XP_010065455.1|  PREDICTED: serine/threonine-protein kinase S...    343   6e-112   Eucalyptus grandis [rose gum]
ref|XP_010533957.1|  PREDICTED: serine/threonine-protein kinase S...    342   6e-112   Tarenaya hassleriana [spider flower]
ref|XP_008347910.1|  PREDICTED: serine/threonine-protein kinase S...    342   6e-112   
gb|AGT16073.1|  serine/threonine-protein kinase                         337   7e-112   Saccharum hybrid cultivar R570
ref|XP_010930862.1|  PREDICTED: serine/threonine-protein kinase S...    342   7e-112   Elaeis guineensis
gb|KHN17430.1|  Serine/threonine-protein kinase SAPK7                   342   8e-112   Glycine soja [wild soybean]
gb|AET04893.2|  sucrose non-fermenting-like kinase 2 family protein     342   8e-112   Medicago truncatula
ref|NP_001242600.1|  uncharacterized protein LOC100804018               342   8e-112   
ref|XP_009776074.1|  PREDICTED: serine/threonine-protein kinase S...    342   8e-112   Nicotiana sylvestris
ref|XP_003630417.1|  Serine/threonine protein kinase                    342   9e-112   
ref|NP_001236743.1|  protein kinase 3                                   342   9e-112   Glycine max [soybeans]
gb|ACN33610.1|  unknown                                                 342   1e-111   Zea mays [maize]
ref|NP_001149107.1|  LOC100282729                                       342   1e-111   Zea mays [maize]
ref|XP_003540159.1|  PREDICTED: serine/threonine-protein kinase S...    342   1e-111   Glycine max [soybeans]
gb|KHN45467.1|  Serine/threonine-protein kinase SRK2B                   342   1e-111   Glycine soja [wild soybean]
ref|XP_002267922.1|  PREDICTED: serine/threonine-protein kinase S...    342   1e-111   Vitis vinifera
ref|XP_009602813.1|  PREDICTED: serine/threonine-protein kinase S...    341   2e-111   Nicotiana tomentosiformis
ref|XP_007148531.1|  hypothetical protein PHAVU_006G216400g             341   2e-111   Phaseolus vulgaris [French bean]
ref|XP_009355252.1|  PREDICTED: serine/threonine-protein kinase S...    341   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_008783426.1|  PREDICTED: serine/threonine-protein kinase S...    337   3e-111   
ref|XP_009104154.1|  PREDICTED: serine/threonine-protein kinase S...    341   3e-111   Brassica rapa
gb|AIZ68211.1|  serine/threonine-protein kinase SAPK7                   341   3e-111   Ornithogalum longebracteatum [sea-onion]
ref|XP_006392094.1|  hypothetical protein EUTSA_v10023544mg             340   4e-111   Eutrema salsugineum [saltwater cress]
gb|KDO58728.1|  hypothetical protein CISIN_1g029037mg                   334   4e-111   Citrus sinensis [apfelsine]
ref|XP_009148434.1|  PREDICTED: serine/threonine-protein kinase S...    340   6e-111   Brassica rapa
ref|XP_002303162.2|  hypothetical protein POPTR_0003s01110g             340   6e-111   Populus trichocarpa [western balsam poplar]
ref|XP_010547458.1|  PREDICTED: serine/threonine-protein kinase S...    340   6e-111   Tarenaya hassleriana [spider flower]
gb|AFK33547.1|  unknown                                                 340   7e-111   Medicago truncatula
ref|XP_003592980.1|  Serine/threonine protein kinase                    340   7e-111   Medicago truncatula
ref|XP_004503865.1|  PREDICTED: serine/threonine-protein kinase S...    340   7e-111   Cicer arietinum [garbanzo]
gb|ACG50011.1|  SnRK2.7                                                 340   7e-111   Zea mays [maize]
ref|XP_006652300.1|  PREDICTED: serine/threonine-protein kinase S...    340   8e-111   Oryza brachyantha
emb|CAE54075.1|  serine/threonine-protein kinase                        340   1e-110   Fagus sylvatica
gb|AFK42326.1|  unknown                                                 339   1e-110   Lotus japonicus
ref|NP_001052827.1|  Os04g0432000                                       339   1e-110   
ref|XP_010030125.1|  PREDICTED: serine/threonine-protein kinase S...    340   1e-110   Eucalyptus grandis [rose gum]
gb|AGT16423.1|  hypothetical protein SHCRBa_145_O09_R_60                339   1e-110   Saccharum hybrid cultivar R570
ref|XP_009804586.1|  PREDICTED: serine/threonine-protein kinase S...    339   2e-110   Nicotiana sylvestris
ref|XP_009621087.1|  PREDICTED: serine/threonine-protein kinase S...    339   2e-110   Nicotiana tomentosiformis
gb|AAA33004.1|  serine/threonine protein kinase                         339   2e-110   Brassica napus [oilseed rape]
gb|ADP24128.1|  serine/threonine protein kinase                         339   2e-110   Brassica napus [oilseed rape]
ref|XP_006305167.1|  hypothetical protein CARUB_v10009533mg             335   2e-110   
ref|XP_003579766.1|  PREDICTED: serine/threonine-protein kinase S...    338   2e-110   
emb|CDY34860.1|  BnaA09g47860D                                          338   2e-110   Brassica napus [oilseed rape]
ref|XP_009118223.1|  PREDICTED: serine/threonine-protein kinase S...    338   2e-110   Brassica rapa
gb|EMS63561.1|  Serine/threonine-protein kinase SAPK7                   340   2e-110   Triticum urartu
ref|XP_011009381.1|  PREDICTED: serine/threonine-protein kinase S...    332   2e-110   Populus euphratica
ref|XP_004975639.1|  PREDICTED: serine/threonine-protein kinase S...    338   2e-110   Setaria italica
gb|AFK42988.1|  unknown                                                 338   2e-110   Lotus japonicus
emb|CDY19332.1|  BnaC05g08410D                                          340   3e-110   Brassica napus [oilseed rape]
gb|KGN54829.1|  hypothetical protein Csa_4G515040                       338   3e-110   Cucumis sativus [cucumbers]
ref|XP_004146378.1|  PREDICTED: serine/threonine-protein kinase S...    338   3e-110   Cucumis sativus [cucumbers]
ref|XP_007049928.1|  Kinase superfamily protein isoform 3               338   3e-110   Theobroma cacao [chocolate]
ref|NP_001047099.1|  Os02g0551100                                       338   3e-110   
ref|XP_006417402.1|  hypothetical protein EUTSA_v10007985mg             338   3e-110   Eutrema salsugineum [saltwater cress]
ref|XP_004952838.1|  PREDICTED: serine/threonine-protein kinase S...    341   4e-110   
gb|AID23890.1|  sucrose non-fermenting 1-related protein kinase 2       338   4e-110   Gossypium hirsutum [American cotton]
gb|EEC73377.1|  hypothetical protein OsI_07615                          338   4e-110   Oryza sativa Indica Group [Indian rice]
gb|AFK36100.1|  unknown                                                 336   4e-110   Medicago truncatula
ref|XP_008442077.1|  PREDICTED: serine/threonine-protein kinase S...    338   4e-110   Cucumis melo [Oriental melon]
ref|NP_172563.1|  serine/threonine-protein kinase SRK2A                 338   4e-110   Arabidopsis thaliana [mouse-ear cress]
gb|EMT04089.1|  Serine/threonine-protein kinase SAPK7                   338   4e-110   
ref|XP_002892611.1|  hypothetical protein ARALYDRAFT_888390             338   4e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_010458473.1|  PREDICTED: serine/threonine-protein kinase S...    338   5e-110   
ref|XP_008783425.1|  PREDICTED: serine/threonine-protein kinase S...    338   5e-110   Phoenix dactylifera
gb|KFK43389.1|  hypothetical protein AALP_AA1G119700                    338   5e-110   Arabis alpina [alpine rockcress]
gb|AFK47198.1|  unknown                                                 337   6e-110   Medicago truncatula
gb|KDO58729.1|  hypothetical protein CISIN_1g029037mg                   332   6e-110   Citrus sinensis [apfelsine]
ref|XP_002453967.1|  hypothetical protein SORBIDRAFT_04g022410          338   6e-110   Sorghum bicolor [broomcorn]
ref|XP_010492159.1|  PREDICTED: serine/threonine-protein kinase S...    338   6e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006305166.1|  hypothetical protein CARUB_v10009533mg             338   6e-110   Capsella rubella
gb|EPS60016.1|  hypothetical protein M569_14789                         337   6e-110   Genlisea aurea
gb|AIO02852.1|  phloem small RNA-binding protein kinase 1               337   7e-110   Cucurbita maxima [Boston marrow]
ref|XP_006300518.1|  hypothetical protein CARUB_v10020517mg             337   8e-110   Capsella rubella
emb|CDY20973.1|  BnaA08g25520D                                          337   8e-110   Brassica napus [oilseed rape]
gb|ACG33803.1|  serine/threonine-protein kinase SAPK6                   337   8e-110   Zea mays [maize]
ref|NP_001136796.1|  uncharacterized LOC100216941                       337   9e-110   Zea mays [maize]
ref|XP_009144406.1|  PREDICTED: serine/threonine-protein kinase S...    337   9e-110   Brassica rapa
ref|XP_011097123.1|  PREDICTED: serine/threonine-protein kinase S...    337   1e-109   Sesamum indicum [beniseed]
gb|AAA33003.1|  serine/threonine protein kinase                         337   1e-109   Brassica napus [oilseed rape]
gb|AFW62592.1|  putative snRK/SAPK family protein kinase                337   1e-109   
gb|KJB71410.1|  hypothetical protein B456_011G121900                    337   1e-109   Gossypium raimondii
gb|KEH35656.1|  sucrose non-fermenting-like kinase 2 family protein     336   2e-109   Medicago truncatula
ref|XP_010418041.1|  PREDICTED: serine/threonine-protein kinase S...    337   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010473290.1|  PREDICTED: serine/threonine-protein kinase S...    336   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_011009382.1|  PREDICTED: serine/threonine-protein kinase S...    336   2e-109   Populus euphratica
ref|XP_007049927.1|  Kinase superfamily protein isoform 2               336   2e-109   
ref|XP_004144354.1|  PREDICTED: serine/threonine-protein kinase S...    336   2e-109   Cucumis sativus [cucumbers]
ref|XP_008449831.1|  PREDICTED: serine/threonine-protein kinase S...    336   2e-109   Cucumis melo [Oriental melon]
ref|XP_006647363.1|  PREDICTED: serine/threonine-protein kinase S...    336   3e-109   Oryza brachyantha
ref|XP_012087257.1|  PREDICTED: serine/threonine-protein kinase S...    335   3e-109   Jatropha curcas
ref|XP_004485476.1|  PREDICTED: serine/threonine-protein kinase S...    335   3e-109   Cicer arietinum [garbanzo]
ref|XP_004503013.1|  PREDICTED: serine/threonine-protein kinase S...    335   4e-109   Cicer arietinum [garbanzo]
ref|XP_010430082.1|  PREDICTED: serine/threonine-protein kinase S...    335   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010475982.1|  PREDICTED: serine/threonine-protein kinase S...    335   5e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010911872.1|  PREDICTED: serine/threonine-protein kinase S...    335   5e-109   Elaeis guineensis
gb|ACN35772.1|  unknown                                                 335   5e-109   Zea mays [maize]
ref|NP_001105274.1|  uncharacterized protein LOC542190                  335   7e-109   Zea mays [maize]
ref|XP_006426422.1|  hypothetical protein CICLE_v10025965mg             334   7e-109   Citrus clementina [clementine]
ref|XP_006466196.1|  PREDICTED: serine/threonine-protein kinase S...    334   8e-109   Citrus sinensis [apfelsine]
ref|XP_009384226.1|  PREDICTED: serine/threonine-protein kinase S...    334   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006384384.1|  kinase SPK-3 family protein                        333   2e-108   
ref|XP_003526896.1|  PREDICTED: serine/threonine-protein kinase S...    333   2e-108   Glycine max [soybeans]
ref|NP_001238298.1|  protein kinase                                     333   2e-108   Glycine max [soybeans]
gb|KHN09673.1|  Serine/threonine-protein kinase SRK2A                   333   3e-108   Glycine soja [wild soybean]
gb|KHN31217.1|  Serine/threonine-protein kinase SRK2A                   333   3e-108   Glycine soja [wild soybean]
ref|XP_010025673.1|  PREDICTED: serine/threonine-protein kinase S...    333   3e-108   Eucalyptus grandis [rose gum]
emb|CDX97923.1|  BnaA06g06740D                                          333   4e-108   
ref|XP_009150418.1|  PREDICTED: serine/threonine-protein kinase S...    332   5e-108   Brassica rapa
ref|XP_007049926.1|  Kinase superfamily protein isoform 1               332   6e-108   
ref|XP_009406104.1|  PREDICTED: serine/threonine-protein kinase S...    332   7e-108   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03768.1|  BnaC01g28850D                                          340   7e-108   
ref|XP_009399177.1|  PREDICTED: serine/threonine-protein kinase S...    332   9e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIZ68209.1|  serine/threonine-protein kinase SAPK7-like protein      332   9e-108   Ornithogalum longebracteatum [sea-onion]
ref|XP_002866567.1|  serine/threonine-protein kinase                    332   9e-108   Arabidopsis lyrata subsp. lyrata
emb|CDY34668.1|  BnaC08g42270D                                          332   1e-107   Brassica napus [oilseed rape]
emb|CDX84430.1|  BnaC03g50700D                                          331   1e-107   
ref|XP_006394252.1|  hypothetical protein EUTSA_v10004481mg             331   1e-107   Eutrema salsugineum [saltwater cress]
gb|AAM67112.1|  putative serine/threonine-protein kinase                331   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176290.1|  SNF1-related protein kinase 2.10                      331   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003575110.1|  PREDICTED: serine/threonine-protein kinase S...    332   2e-107   
dbj|BAH56941.1|  AT5G63650                                              331   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65503.1|  serine/threonine-protein kinase                         331   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484120.1|  PREDICTED: serine/threonine-protein kinase S...    331   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010444281.1|  PREDICTED: serine/threonine-protein kinase S...    331   2e-107   Camelina sativa [gold-of-pleasure]
ref|NP_201170.1|  serine/threonine-protein kinase SRK2H                 331   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25003.1|  unknown                                                 333   2e-107   Picea sitchensis
ref|XP_010460858.1|  PREDICTED: serine/threonine-protein kinase S...    331   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006280694.1|  hypothetical protein CARUB_v10026657mg             330   3e-107   Capsella rubella
ref|XP_010912491.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    330   3e-107   
gb|ACU23651.1|  unknown                                                 330   3e-107   Glycine max [soybeans]
emb|CDP20535.1|  unnamed protein product                                330   4e-107   Coffea canephora [robusta coffee]
ref|XP_010546285.1|  PREDICTED: serine/threonine-protein kinase S...    330   4e-107   
ref|XP_010675155.1|  PREDICTED: serine/threonine-protein kinase S...    330   4e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001031021.2|  serine/threonine-protein kinase SRK2A              330   4e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79237.1|  hypothetical protein B456_013G038800                    330   5e-107   Gossypium raimondii
dbj|BAE99712.1|  serine/threonine-protein kinase                        330   7e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784212.1|  PREDICTED: serine/threonine-protein kinase S...    329   1e-106   Phoenix dactylifera
ref|XP_009602316.1|  PREDICTED: serine/threonine-protein kinase S...    329   1e-106   Nicotiana tomentosiformis
gb|KDO49173.1|  hypothetical protein CISIN_1g017936mg                   323   1e-106   Citrus sinensis [apfelsine]
ref|XP_001777278.1|  predicted protein                                  328   1e-106   
ref|XP_009404984.1|  PREDICTED: serine/threonine-protein kinase S...    328   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001778501.1|  predicted protein                                  328   2e-106   
emb|CEO16426.1|  sucrose non-fermenting 1-related protein kinase ...    328   3e-106   Marchantia polymorpha
gb|KJB32410.1|  hypothetical protein B456_005G239800                    324   3e-106   Gossypium raimondii
gb|ABR16094.1|  unknown                                                 328   3e-106   Picea sitchensis
ref|XP_009420573.1|  PREDICTED: serine/threonine-protein kinase S...    328   3e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002886574.1|  hypothetical protein ARALYDRAFT_475237             328   3e-106   
gb|KDO50085.1|  hypothetical protein CISIN_1g0187342mg                  321   3e-106   Citrus sinensis [apfelsine]
ref|XP_010547692.1|  PREDICTED: serine/threonine-protein kinase S...    328   3e-106   Tarenaya hassleriana [spider flower]
ref|XP_006852955.1|  PREDICTED: serine/threonine-protein kinase S...    328   3e-106   Amborella trichopoda
gb|KJB12210.1|  hypothetical protein B456_002G006900                    328   4e-106   Gossypium raimondii
gb|KJB32411.1|  hypothetical protein B456_005G239800                    327   4e-106   Gossypium raimondii
gb|ACU17547.1|  unknown                                                 320   5e-106   Glycine max [soybeans]
ref|XP_009780712.1|  PREDICTED: serine/threonine-protein kinase S...    327   5e-106   Nicotiana sylvestris
gb|KDO79323.1|  hypothetical protein CISIN_1g0178602mg                  322   8e-106   Citrus sinensis [apfelsine]
gb|KDO49171.1|  hypothetical protein CISIN_1g017936mg                   322   8e-106   Citrus sinensis [apfelsine]
ref|XP_007137814.1|  hypothetical protein PHAVU_009G157800g             327   9e-106   Phaseolus vulgaris [French bean]
gb|KDO49172.1|  hypothetical protein CISIN_1g017936mg                   322   9e-106   Citrus sinensis [apfelsine]
gb|KDO79324.1|  hypothetical protein CISIN_1g0178602mg                  321   9e-106   Citrus sinensis [apfelsine]
gb|AFW71759.1|  putative snRK/SAPK family protein kinase                327   1e-105   
ref|XP_009403694.1|  PREDICTED: serine/threonine-protein kinase S...    327   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009122476.1|  PREDICTED: serine/threonine-protein kinase S...    326   2e-105   Brassica rapa
gb|KDO49170.1|  hypothetical protein CISIN_1g017936mg                   323   2e-105   Citrus sinensis [apfelsine]
gb|KJB32409.1|  hypothetical protein B456_005G239800                    326   2e-105   Gossypium raimondii
ref|XP_003580888.1|  PREDICTED: serine/threonine-protein kinase S...    327   2e-105   
gb|KHG25553.1|  Serine/threonine-protein kinase SRK2E                   326   2e-105   Gossypium arboreum [tree cotton]
ref|XP_006288056.1|  hypothetical protein CARUB_v10001287mg             323   2e-105   
ref|XP_010263754.1|  PREDICTED: serine/threonine-protein kinase S...    326   2e-105   Nelumbo nucifera [Indian lotus]
gb|KDO49168.1|  hypothetical protein CISIN_1g017936mg                   325   3e-105   Citrus sinensis [apfelsine]
emb|CDY72554.1|  BnaAnng41460D                                          323   3e-105   Brassica napus [oilseed rape]
ref|XP_011099217.1|  PREDICTED: serine/threonine-protein kinase S...    325   3e-105   
ref|XP_010255130.1|  PREDICTED: serine/threonine-protein kinase S...    325   3e-105   Nelumbo nucifera [Indian lotus]
ref|XP_010423046.1|  PREDICTED: serine/threonine-protein kinase S...    325   3e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010452877.1|  PREDICTED: serine/threonine-protein kinase S...    325   4e-105   Camelina sativa [gold-of-pleasure]
emb|CDP02466.1|  unnamed protein product                                325   4e-105   Coffea canephora [robusta coffee]
ref|XP_004959953.1|  PREDICTED: serine/threonine-protein kinase S...    326   5e-105   Setaria italica
ref|XP_010526938.1|  PREDICTED: serine/threonine-protein kinase S...    325   5e-105   Tarenaya hassleriana [spider flower]
gb|EYU44364.1|  hypothetical protein MIMGU_mgv1a009037mg                325   5e-105   Erythranthe guttata [common monkey flower]
gb|KFK25224.1|  hypothetical protein AALP_AA8G083600                    325   5e-105   Arabis alpina [alpine rockcress]
ref|XP_004290308.1|  PREDICTED: serine/threonine-protein kinase S...    325   5e-105   Fragaria vesca subsp. vesca
ref|XP_001769324.1|  predicted protein                                  324   5e-105   
ref|XP_009397730.1|  PREDICTED: serine/threonine-protein kinase S...    325   5e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871349.1|  hypothetical protein ARALYDRAFT_908839             324   6e-105   Arabidopsis lyrata subsp. lyrata
ref|NP_196476.1|  serine/threonine-protein kinase SRK2G                 324   6e-105   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49169.1|  hypothetical protein CISIN_1g017936mg                   322   6e-105   Citrus sinensis [apfelsine]
ref|XP_006288057.1|  hypothetical protein CARUB_v10001287mg             324   6e-105   Capsella rubella
ref|XP_006412293.1|  hypothetical protein EUTSA_v10025907mg             322   7e-105   
ref|XP_010109893.1|  Serine/threonine-protein kinase SAPK10             325   8e-105   
ref|XP_006399366.1|  hypothetical protein EUTSA_v10013967mg             324   8e-105   Eutrema salsugineum [saltwater cress]
ref|XP_010491506.1|  PREDICTED: serine/threonine-protein kinase S...    324   8e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006283988.1|  hypothetical protein CARUB_v10005110mg             324   9e-105   Capsella rubella
ref|XP_007042345.1|  Kinase superfamily protein isoform 2               324   9e-105   
gb|KDO49166.1|  hypothetical protein CISIN_1g017936mg                   324   9e-105   Citrus sinensis [apfelsine]
ref|XP_006423077.1|  hypothetical protein CICLE_v10028703mg             323   9e-105   Citrus clementina [clementine]
ref|XP_009774098.1|  PREDICTED: serine/threonine-protein kinase S...    324   1e-104   Nicotiana sylvestris
ref|XP_006480145.1|  PREDICTED: serine/threonine-protein kinase S...    324   1e-104   Citrus sinensis [apfelsine]
ref|XP_002521837.1|  Serine/threonine-protein kinase SAPK10, puta...    324   1e-104   Ricinus communis
ref|XP_007042344.1|  Kinase superfamily protein isoform 1               324   1e-104   Theobroma cacao [chocolate]
ref|XP_009131093.1|  PREDICTED: serine/threonine-protein kinase S...    324   1e-104   Brassica rapa
ref|XP_009383517.1|  PREDICTED: serine/threonine-protein kinase S...    323   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505181.1|  PREDICTED: serine/threonine-protein kinase S...    324   1e-104   Cicer arietinum [garbanzo]
ref|XP_008236629.1|  PREDICTED: serine/threonine-protein kinase S...    324   1e-104   Prunus mume [ume]
ref|XP_010028289.1|  PREDICTED: serine/threonine-protein kinase S...    323   2e-104   Eucalyptus grandis [rose gum]
gb|ACZ13319.1|  serine threonine kinase SAPK-5                          318   2e-104   Oryza sativa Indica Group [Indian rice]
emb|CAE03037.3|  OSJNBa0084A10.12                                       325   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006583766.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-104   
pdb|3UJG|A  Chain A, Crystal Structure Of Snrk2.6 In Complex With...    323   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777005.1|  PREDICTED: serine/threonine-protein kinase S...    323   2e-104   Nicotiana sylvestris
ref|XP_002284959.1|  PREDICTED: serine/threonine-protein kinase S...    323   2e-104   Vitis vinifera
ref|XP_009379612.1|  PREDICTED: serine/threonine-protein kinase S...    323   2e-104   
ref|XP_009388929.1|  PREDICTED: serine/threonine-protein kinase S...    323   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008339244.1|  PREDICTED: serine/threonine-protein kinase S...    323   2e-104   
emb|CAA19877.1|  protein kinase-like protein                            323   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567945.1|  calcium-independent ABA-activated protein kinase      323   3e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KJB25443.1|  hypothetical protein B456_004G191500                    322   3e-104   Gossypium raimondii
ref|XP_010432490.1|  PREDICTED: serine/threonine-protein kinase S...    323   3e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006423078.1|  hypothetical protein CICLE_v10028703mg             323   3e-104   Citrus clementina [clementine]
ref|XP_009601520.1|  PREDICTED: serine/threonine-protein kinase S...    323   3e-104   Nicotiana tomentosiformis
ref|XP_003529248.1|  PREDICTED: serine/threonine-protein kinase S...    323   3e-104   Glycine max [soybeans]
ref|XP_002869183.1|  hypothetical protein ARALYDRAFT_491280             323   4e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_010432492.1|  PREDICTED: serine/threonine-protein kinase S...    323   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_008241542.1|  PREDICTED: serine/threonine-protein kinase S...    323   4e-104   Prunus mume [ume]
ref|XP_011088303.1|  PREDICTED: serine/threonine-protein kinase S...    323   4e-104   Sesamum indicum [beniseed]
gb|KEH30920.1|  sucrose nonfermenting 1(SNF1)-related kinase            323   4e-104   Medicago truncatula
emb|CAA78106.1|  protein kinase                                         322   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838505.1|  PREDICTED: serine/threonine-protein kinase S...    322   4e-104   Amborella trichopoda
gb|AID60113.1|  calcium-independent ABA-activated protein kinase        322   4e-104   Brassica napus [oilseed rape]
ref|XP_006653076.1|  PREDICTED: serine/threonine-protein kinase S...    323   4e-104   Oryza brachyantha
ref|XP_004239628.1|  PREDICTED: serine/threonine-protein kinase S...    322   4e-104   Solanum lycopersicum
ref|XP_007202101.1|  hypothetical protein PRUPE_ppa007584mg             322   5e-104   Prunus persica
ref|XP_009601203.1|  PREDICTED: serine/threonine-protein kinase S...    322   6e-104   
ref|XP_009601198.1|  PREDICTED: serine/threonine-protein kinase S...    322   6e-104   Nicotiana tomentosiformis
ref|XP_003555707.1|  PREDICTED: serine/threonine-protein kinase S...    322   7e-104   Glycine max [soybeans]
ref|XP_006583868.1|  PREDICTED: serine/threonine-protein kinase S...    322   7e-104   
ref|XP_007155960.1|  hypothetical protein PHAVU_003G247000g             322   8e-104   
gb|EMS48966.1|  Serine/threonine-protein kinase SAPK5                   322   8e-104   
ref|XP_009138251.1|  PREDICTED: serine/threonine-protein kinase S...    322   9e-104   
ref|NP_001190047.1|  serine/threonine-protein kinase SRK2D              322   9e-104   
gb|KJB48513.1|  hypothetical protein B456_008G073200                    317   9e-104   
ref|XP_004959952.1|  PREDICTED: serine/threonine-protein kinase S...    322   1e-103   
ref|XP_010484571.1|  PREDICTED: serine/threonine-protein kinase S...    322   1e-103   
gb|AAM13097.1|  putative protein                                        321   1e-103   
ref|XP_009786561.1|  PREDICTED: serine/threonine-protein kinase S...    322   1e-103   
ref|NP_201489.1|  serine/threonine-protein kinase SRK2I                 322   1e-103   
gb|ACG50009.1|  SnRK2.5                                                 322   1e-103   
gb|KHN02037.1|  Serine/threonine-protein kinase SRK2I                   322   1e-103   
ref|XP_006575017.1|  PREDICTED: serine/threonine-protein kinase S...    321   1e-103   
gb|KEH40741.1|  sucrose nonfermenting 1(SNF1)-related kinase            322   1e-103   
emb|CEO16427.1|  sucrose non-fermenting 1-related protein kinase ...    321   1e-103   
ref|XP_009118282.1|  PREDICTED: serine/threonine-protein kinase S...    322   1e-103   
ref|XP_010065453.1|  PREDICTED: serine/threonine-protein kinase S...    321   1e-103   
gb|KCW55250.1|  hypothetical protein EUGRSUZ_I01180                     320   1e-103   
emb|CDO97138.1|  unnamed protein product                                322   1e-103   
dbj|BAJ34451.1|  unnamed protein product                                321   1e-103   
ref|XP_008792700.1|  PREDICTED: serine/threonine-protein kinase S...    321   1e-103   
ref|NP_001132381.1|  LOC100193827                                       321   1e-103   
ref|XP_010028509.1|  PREDICTED: serine/threonine-protein kinase S...    321   1e-103   
ref|NP_001274891.1|  serine/threonine-protein kinase SAPK7-like         321   2e-103   
gb|AIK22403.1|  sucrose non-fermenting-1-related protein kinase 2.1     321   2e-103   
ref|XP_008339769.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
ref|XP_010530874.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
ref|XP_003518861.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
emb|CDX69936.1|  BnaA10g22850D                                          321   2e-103   
gb|AII82268.1|  SnRK2.3                                                 321   2e-103   
gb|EYU37717.1|  hypothetical protein MIMGU_mgv1a008717mg                321   2e-103   
ref|XP_009591903.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
ref|XP_006393885.1|  hypothetical protein EUTSA_v10004469mg             321   2e-103   
gb|KJB48515.1|  hypothetical protein B456_008G073200                    318   2e-103   
ref|XP_004288068.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
ref|XP_010909986.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
dbj|BAJ93234.1|  predicted protein                                      322   2e-103   
ref|XP_010941849.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
emb|CDX69016.1|  BnaC01g04370D                                          321   2e-103   
emb|CDY12785.1|  BnaC07g16480D                                          321   2e-103   
ref|XP_010464758.1|  PREDICTED: serine/threonine-protein kinase S...    321   2e-103   
gb|AIH00106.1|  sucrose nonfermenting 1-related protein kinase 2.3      322   3e-103   
ref|XP_004230794.1|  PREDICTED: serine/threonine-protein kinase S...    320   3e-103   
pdb|3UC3|A  Chain A, The Crystal Structure Of Snf1-Related Kinase...    320   3e-103   
ref|XP_012081020.1|  PREDICTED: serine/threonine-protein kinase S...    317   3e-103   
gb|KJB40238.1|  hypothetical protein B456_007G053000                    315   3e-103   
ref|XP_008454909.1|  PREDICTED: serine/threonine-protein kinase S...    320   3e-103   
gb|KFK28375.1|  hypothetical protein AALP_AA8G507100                    320   3e-103   
gb|KJB48514.1|  hypothetical protein B456_008G073200                    319   3e-103   
ref|XP_009103473.1|  PREDICTED: serine/threonine-protein kinase S...    320   3e-103   
ref|XP_009403693.1|  PREDICTED: serine/threonine-protein kinase S...    320   3e-103   
ref|XP_004498169.1|  PREDICTED: serine/threonine-protein kinase S...    320   3e-103   
ref|XP_002866727.1|  hypothetical protein ARALYDRAFT_920030             320   3e-103   
ref|XP_004136995.1|  PREDICTED: serine/threonine-protein kinase S...    320   3e-103   
ref|XP_009366671.1|  PREDICTED: serine/threonine-protein kinase S...    320   4e-103   
ref|XP_002447377.1|  hypothetical protein SORBIDRAFT_06g033990          321   4e-103   
ref|XP_006425830.1|  hypothetical protein CICLE_v10025916mg             320   4e-103   
ref|XP_001769579.1|  predicted protein                                  320   4e-103   
pdb|3ZUT|A  Chain A, The Structure Of Ost1 (D160a) Kinase               320   4e-103   
ref|XP_010680446.1|  PREDICTED: serine/threonine-protein kinase S...    320   4e-103   
gb|EPS73443.1|  stress kinase                                           319   4e-103   
ref|XP_007156528.1|  hypothetical protein PHAVU_003G293600g             322   5e-103   
ref|NP_001275318.1|  serine/threonine-protein kinase SRK2E-like         320   5e-103   
emb|CAN62745.1|  hypothetical protein VITISV_025025                     320   5e-103   
ref|XP_010444716.1|  PREDICTED: serine/threonine-protein kinase S...    320   5e-103   
ref|XP_008459221.1|  PREDICTED: serine/threonine-protein kinase S...    320   5e-103   
gb|KEH40740.1|  sucrose nonfermenting 1(SNF1)-related kinase            318   5e-103   
ref|XP_006291367.1|  hypothetical protein CARUB_v10017507mg             320   6e-103   
gb|AGW51610.1|  serine/threonine protein kinase                         320   6e-103   
ref|XP_010999823.1|  PREDICTED: serine/threonine-protein kinase S...    320   7e-103   
ref|XP_010503719.1|  PREDICTED: serine/threonine-protein kinase S...    320   7e-103   
ref|XP_002313835.1|  OPEN STOMATA 1 family protein                      320   7e-103   
tpg|DAA56628.1|  TPA: putative snRK/SAPK family protein kinase          314   7e-103   
emb|CEO16429.1|  sucrose non-fermenting 1-related protein kinase ...    319   7e-103   
ref|XP_003632469.1|  PREDICTED: serine/threonine-protein kinase S...    318   7e-103   
ref|XP_002987826.1|  hypothetical protein SELMODRAFT_158991             318   8e-103   
ref|XP_010515422.1|  PREDICTED: serine/threonine-protein kinase S...    319   8e-103   
ref|XP_002992280.1|  hypothetical protein SELMODRAFT_162233             318   8e-103   
gb|AFK33688.1|  unknown                                                 319   8e-103   
ref|XP_004970723.1|  PREDICTED: serine/threonine-protein kinase S...    319   8e-103   
tpg|DAA56625.1|  TPA: putative snRK/SAPK family protein kinase          315   9e-103   
ref|XP_010547508.1|  PREDICTED: serine/threonine-protein kinase S...    319   9e-103   
ref|XP_009366796.1|  PREDICTED: serine/threonine-protein kinase S...    319   9e-103   
ref|XP_002522330.1|  Serine/threonine-protein kinase SAPK10, puta...    319   9e-103   
ref|XP_012081018.1|  PREDICTED: serine/threonine-protein kinase S...    318   1e-102   
ref|XP_010691013.1|  PREDICTED: serine/threonine-protein kinase S...    319   1e-102   
ref|XP_002307247.1|  kinase mRNA family protein                         319   1e-102   
ref|XP_006384459.1|  OPEN STOMATA 1 family protein                      319   1e-102   
ref|NP_001044930.1|  Os01g0869900                                       319   1e-102   
gb|AHE78413.1|  open stomata 1 isoform 1                                319   1e-102   
emb|CBI23285.3|  unnamed protein product                                318   1e-102   
gb|KJB48516.1|  hypothetical protein B456_008G073200                    319   1e-102   
ref|XP_002262726.1|  PREDICTED: serine/threonine-protein kinase S...    318   1e-102   
emb|CAH68097.1|  B0518A01.2                                             319   1e-102   
ref|XP_002262731.2|  PREDICTED: serine/threonine-protein kinase S...    318   1e-102   
ref|XP_010691012.1|  PREDICTED: serine/threonine-protein kinase S...    319   1e-102   
ref|XP_003524577.1|  PREDICTED: serine/threonine-protein kinase S...    318   1e-102   
ref|NP_001054356.1|  Os04g0691100                                       319   2e-102   
ref|NP_001060312.1|  Os07g0622000                                       318   2e-102   
ref|XP_011100039.1|  PREDICTED: serine/threonine-protein kinase S...    318   2e-102   
ref|XP_008244468.1|  PREDICTED: serine/threonine-protein kinase S...    318   2e-102   
gb|AAO65504.1|  abcisic acid-inducible protein kinanase                 318   2e-102   
ref|XP_006338224.1|  PREDICTED: serine/threonine-protein kinase S...    318   2e-102   
ref|XP_004232055.1|  PREDICTED: serine/threonine-protein kinase S...    318   2e-102   
ref|NP_190619.1|  serine/threonine-protein kinase SRK2D                 318   2e-102   
ref|XP_009398292.1|  PREDICTED: serine/threonine-protein kinase S...    318   2e-102   
gb|ABA40436.1|  serine/threonine protein kinase SAPK8-like protein      318   2e-102   
ref|XP_002964718.1|  hypothetical protein SELMODRAFT_167058             317   2e-102   
ref|XP_006385576.1|  hypothetical protein POPTR_0003s08240g             317   2e-102   
pdb|3ZUU|A  Chain A, The Structure Of Ost1 (D160a, S175d) Kinase ...    318   2e-102   
ref|XP_006829915.2|  PREDICTED: serine/threonine-protein kinase S...    317   2e-102   
ref|XP_006404027.1|  hypothetical protein EUTSA_v10010481mg             318   2e-102   
ref|XP_004958353.1|  PREDICTED: serine/threonine-protein kinase S...    317   2e-102   
gb|AGW51607.1|  serine/threonine protein kinase                         318   2e-102   
ref|XP_010558413.1|  PREDICTED: serine/threonine-protein kinase S...    316   2e-102   
gb|KHN23689.1|  Serine/threonine-protein kinase SAPK10                  318   3e-102   
ref|XP_010558405.1|  PREDICTED: serine/threonine-protein kinase S...    318   3e-102   
ref|XP_007047159.1|  Sucrose nonfermenting 1(SNF1)-related protei...    318   3e-102   
ref|NP_001065412.1|  Os10g0564500                                       317   3e-102   
gb|KDO57025.1|  hypothetical protein CISIN_1g019433mg                   315   3e-102   
sp|A2ZAB5.2|SAPK3_ORYSI  RecName: Full=Serine/threonine-protein k...    317   3e-102   
emb|CDY21553.1|  BnaC09g47390D                                          318   3e-102   
gb|ADE77282.1|  unknown                                                 318   3e-102   
gb|ACG50006.1|  SnRK2.2                                                 317   3e-102   
ref|NP_001149243.1|  serine/threonine-protein kinase SAPK2              317   3e-102   
sp|A2YNT8.2|SAPK2_ORYSI  RecName: Full=Serine/threonine-protein k...    317   3e-102   
ref|XP_011001186.1|  PREDICTED: serine/threonine-protein kinase S...    318   3e-102   
gb|ACJ84405.1|  unknown                                                 317   3e-102   
gb|AIY30420.1|  SNF1-type serine-threonine protein kinase               318   3e-102   
dbj|BAJ94902.1|  predicted protein                                      318   3e-102   
gb|AHC00228.1|  SNF1-type serine-threonine protein kinase               318   3e-102   
ref|XP_004143455.1|  PREDICTED: serine/threonine-protein kinase S...    317   3e-102   
ref|XP_010919796.1|  PREDICTED: serine/threonine-protein kinase S...    317   4e-102   
dbj|BAA13608.1|  endosperm kinase                                       317   4e-102   
pdb|3UC4|A  Chain A, The Crystal Structure Of Snf1-Related Kinase...    318   4e-102   
ref|XP_002461041.1|  hypothetical protein SORBIDRAFT_02g039640          317   4e-102   
ref|XP_006583867.1|  PREDICTED: serine/threonine-protein kinase S...    317   4e-102   
ref|XP_002517501.1|  Serine/threonine-protein kinase SAPK3, putative    317   4e-102   
ref|XP_004982436.1|  PREDICTED: serine/threonine-protein kinase S...    317   4e-102   
ref|XP_002464236.1|  hypothetical protein SORBIDRAFT_01g014720          317   4e-102   
ref|XP_003562284.1|  PREDICTED: serine/threonine-protein kinase S...    317   5e-102   
ref|XP_002264172.2|  PREDICTED: serine/threonine-protein kinase S...    318   5e-102   
gb|EMS56487.1|  Serine/threonine-protein kinase SAPK10                  318   5e-102   
gb|EYU39397.1|  hypothetical protein MIMGU_mgv1a008809mg                317   5e-102   
gb|KCW77859.1|  hypothetical protein EUGRSUZ_D02135                     316   5e-102   
ref|XP_008440574.1|  PREDICTED: serine/threonine-protein kinase S...    317   6e-102   
ref|NP_001130868.1|  SnRK2.10                                           317   6e-102   
ref|XP_004145407.1|  PREDICTED: serine/threonine-protein kinase S...    317   6e-102   
ref|XP_006645084.1|  PREDICTED: serine/threonine-protein kinase S...    317   6e-102   
emb|CDX81116.1|  BnaC03g03700D                                          317   6e-102   
dbj|BAD17999.1|  serine/threonine protein kinase SAPK3                  316   6e-102   
ref|XP_002961653.1|  hypothetical protein SELMODRAFT_164978             316   7e-102   
ref|XP_008792595.1|  PREDICTED: serine/threonine-protein kinase S...    317   7e-102   
gb|ACJ84448.1|  unknown                                                 317   7e-102   
ref|XP_010053546.1|  PREDICTED: serine/threonine-protein kinase S...    316   7e-102   
ref|XP_007153165.1|  hypothetical protein PHAVU_003G012300g             317   7e-102   
gb|AGT16857.1|  serine kinase                                           317   8e-102   
ref|XP_006440157.1|  hypothetical protein CICLE_v10020980mg             316   8e-102   
tpg|DAA56626.1|  TPA: putative snRK/SAPK family protein kinase          317   9e-102   
gb|KDO57024.1|  hypothetical protein CISIN_1g019433mg                   316   9e-102   
gb|KJB40237.1|  hypothetical protein B456_007G053000                    313   9e-102   
ref|NP_001168073.1|  uncharacterized protein LOC100381806               316   9e-102   
ref|XP_004983620.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-101   
ref|XP_011016769.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-101   
gb|AGG09694.1|  serine/threonine protein kinase 3                       317   1e-101   
ref|XP_003629567.1|  Serine/threonine protein kinase SAPK3              317   1e-101   
dbj|BAA19573.1|  protein kinase                                         315   1e-101   
ref|XP_009776430.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-101   
gb|KFK34298.1|  hypothetical protein AALP_AA5G126900                    316   1e-101   
ref|XP_008673283.1|  PREDICTED: uncharacterized protein LOC100384...    317   1e-101   
ref|XP_003550077.2|  PREDICTED: serine/threonine-protein kinase S...    321   1e-101   
ref|XP_008794879.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-101   
ref|XP_004148038.1|  PREDICTED: serine/threonine-protein kinase S...    316   1e-101   
ref|XP_002877748.1|  hypothetical protein ARALYDRAFT_485399             316   1e-101   
ref|XP_008457815.1|  PREDICTED: serine/threonine-protein kinase S...    316   1e-101   
emb|CAN62023.1|  hypothetical protein VITISV_005083                     316   1e-101   
gb|EMT29739.1|  Serine/threonine-protein kinase SAPK10                  318   1e-101   
gb|AFW84449.1|  putative snRK/SAPK family protein kinase                311   2e-101   
gb|KJB40240.1|  hypothetical protein B456_007G053000                    316   2e-101   
ref|NP_001136496.1|  SnRK2.3                                            315   2e-101   
gb|ABD72268.1|  serine kinase                                           316   2e-101   
gb|EMS49128.1|  Serine/threonine-protein kinase SAPK8                   315   2e-101   
gb|KJB29269.1|  hypothetical protein B456_005G094500                    310   2e-101   
ref|XP_010274511.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-101   
gb|AHC00227.1|  SNF1-type serine-threonine protein kinase               315   2e-101   
ref|XP_006662074.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-101   
gb|AGV54600.1|  serine/threonine-protein kinase SAPK3                   315   2e-101   
ref|XP_009626815.1|  PREDICTED: serine/threonine-protein kinase S...    311   2e-101   
ref|XP_006657973.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-101   
ref|XP_009400221.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-101   
gb|ACG32779.1|  serine/threonine-protein kinase SAPK10                  316   2e-101   
ref|XP_004509170.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-101   
emb|CDX78346.1|  BnaA03g02580D                                          316   2e-101   
ref|XP_006477070.1|  PREDICTED: serine/threonine-protein kinase S...    315   3e-101   
ref|XP_008654908.1|  PREDICTED: uncharacterized LOC100191280 isof...    315   3e-101   
ref|XP_010312635.1|  PREDICTED: serine/threonine-protein kinase S...    315   3e-101   
ref|XP_004300317.1|  PREDICTED: serine/threonine-protein kinase S...    315   3e-101   
ref|XP_006664152.1|  PREDICTED: serine/threonine-protein kinase S...    315   3e-101   
gb|AFK34958.1|  unknown                                                 315   3e-101   
ref|NP_001050653.1|  Os03g0610900                                       315   3e-101   
ref|XP_006433942.1|  hypothetical protein CICLE_v10001754mg             314   3e-101   
gb|KDO81023.1|  hypothetical protein CISIN_1g019628mg                   314   3e-101   
ref|XP_006472572.1|  PREDICTED: serine/threonine-protein kinase S...    314   4e-101   
ref|XP_002465184.1|  hypothetical protein SORBIDRAFT_01g033570          314   4e-101   
ref|XP_007155720.1|  hypothetical protein PHAVU_003G225800g             314   4e-101   
emb|CDP08319.1|  unnamed protein product                                314   4e-101   
ref|XP_012067904.1|  PREDICTED: serine/threonine-protein kinase S...    313   4e-101   
ref|XP_007209164.1|  hypothetical protein PRUPE_ppa006108mg             317   4e-101   
ref|NP_001170331.1|  uncharacterized protein LOC100384302               315   4e-101   
ref|XP_004984154.1|  PREDICTED: serine/threonine-protein kinase S...    314   4e-101   
ref|XP_009614053.1|  PREDICTED: serine/threonine-protein kinase S...    314   5e-101   
ref|XP_003564710.2|  PREDICTED: serine/threonine-protein kinase S...    316   5e-101   
gb|AIK22404.1|  sucrose non-fermenting-1-related protein kinase 2.4     314   5e-101   
tpg|DAA46336.1|  TPA: putative snRK/SAPK family protein kinase          313   5e-101   
gb|AGT16367.1|  serine/threonine-protein kinase                         313   5e-101   
gb|AFK34893.1|  unknown                                                 314   5e-101   
dbj|BAK05446.1|  predicted protein                                      314   6e-101   
gb|ACU65228.1|  SNF1-type serine-threonine protein kinase               315   6e-101   
gb|EMS56724.1|  Serine/threonine-protein kinase SAPK4                   315   6e-101   
ref|XP_006580257.1|  PREDICTED: serine/threonine-protein kinase S...    314   6e-101   



>ref|XP_009348751.1| PREDICTED: serine/threonine-protein kinase SRK2A [Pyrus x bretschneideri]
Length=351

 Score =   353 bits (905),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008218556.1| PREDICTED: serine/threonine-protein kinase SRK2A [Prunus mume]
Length=350

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CBI29763.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008361703.1| PREDICTED: serine/threonine-protein kinase SRK2A [Malus domestica]
 gb|AII82273.1| SnRK2.9 [Malus domestica]
 gb|AIK22398.1| sucrose non-fermenting-1-related protein kinase 2.11 [Malus prunifolia]
Length=352

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CAN78793.1| hypothetical protein VITISV_028464 [Vitis vinifera]
Length=357

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002269221.1| PREDICTED: serine/threonine-protein kinase SRK2A [Vitis vinifera]
Length=356

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_012071302.1| PREDICTED: serine/threonine-protein kinase SRK2A [Jatropha curcas]
 gb|KDP38831.1| hypothetical protein JCGZ_04988 [Jatropha curcas]
Length=354

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>dbj|BAN15745.1| subfamily 2 of SNF1-related protein kinase [Dianthus caryophyllus]
Length=361

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011464827.1| PREDICTED: serine/threonine-protein kinase SRK2A [Fragaria vesca 
subsp. vesca]
 gb|AIH00111.1| sucrose nonfermenting 1-related protein kinase 2.8 [Fragaria 
x ananassa]
Length=352

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002530676.1| Serine/threonine-protein kinase ASK1, putative [Ricinus communis]
 gb|EEF31707.1| Serine/threonine-protein kinase ASK1, putative [Ricinus communis]
Length=357

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KJB47470.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=248

 Score =   347 bits (889),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KJB79236.1| hypothetical protein B456_013G038800 [Gossypium raimondii]
Length=354

 Score =   350 bits (898),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KJB47469.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=242

 Score =   345 bits (885),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|ABG81507.1| serine/threonine protein kinase [Camellia sinensis]
Length=358

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008339496.1| PREDICTED: serine/threonine-protein kinase SRK2A [Malus domestica]
Length=352

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MXKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|ACJ84339.1| unknown [Medicago truncatula]
Length=182

 Score =   342 bits (878),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  2     MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  61

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  62    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  121

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  122   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  158

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  159   STVGTPAYIAPEVLSRREYDG  179



>emb|CDO97575.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KDO50084.1| hypothetical protein CISIN_1g0187342mg, partial [Citrus sinensis]
Length=179

 Score =   342 bits (877),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRNK TKELVAMKYIERG KID NVAREIINH+ LRHPNI
Sbjct  1     MEKYELMKDIGSGNFGVARLMRNKNTKELVAMKYIERGHKIDANVAREIINHKQLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KJB47472.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=334

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011087723.1| PREDICTED: serine/threonine-protein kinase SRK2A [Sesamum indicum]
Length=352

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKY+ERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYMERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_007222266.1| hypothetical protein PRUPE_ppa007946mg [Prunus persica]
 gb|EMJ23465.1| hypothetical protein PRUPE_ppa007946mg [Prunus persica]
Length=350

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011092341.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Sesamum 
indicum]
Length=355

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010242684.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X1 [Nelumbo 
nucifera]
Length=355

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011028282.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X1 [Populus 
euphratica]
Length=315

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI+MEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010242685.1| PREDICTED: serine/threonine-protein kinase SAPK7 isoform X2 [Nelumbo 
nucifera]
Length=307

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KJB47468.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=356

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011028283.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X2 [Populus 
euphratica]
Length=363

 Score =   348 bits (894),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI+MEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|EYU35455.1| hypothetical protein MIMGU_mgv1a008963mg [Erythranthe guttata]
Length=357

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCHS+QIC
Sbjct  61    IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006384983.1| kinase family protein [Populus trichocarpa]
 gb|ERP62780.1| kinase family protein [Populus trichocarpa]
Length=353

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+TPTHLAI+MEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVVTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_007042267.1| SNF1-related protein kinase 2.10 isoform 2 [Theobroma cacao]
 gb|EOX98098.1| SNF1-related protein kinase 2.10 isoform 2 [Theobroma cacao]
Length=353

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFIEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006847010.1| PREDICTED: serine/threonine-protein kinase SRK2A [Amborella trichopoda]
 ref|XP_011624335.1| PREDICTED: serine/threonine-protein kinase SRK2A [Amborella trichopoda]
 gb|ERN08591.1| hypothetical protein AMTR_s00017p00148890 [Amborella trichopoda]
Length=354

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YELVKDIGSGNFGVARLMRNK+T+ELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELVKDIGSGNFGVARLMRNKQTRELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR+EYDG
Sbjct  158   STVGTPAYIAPEVLSRKEYDG  178



>ref|XP_007042266.1| SNF1-related protein kinase 2.10 isoform 1 [Theobroma cacao]
 gb|EOX98097.1| SNF1-related protein kinase 2.10 isoform 1 [Theobroma cacao]
Length=424

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 176/204 (86%), Gaps = 23/204 (11%)
 Frame = +3

Query  468   KEKMEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRH  647
             K  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRH
Sbjct  69    KHTMEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRH  128

Query  648   PNIIRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSL  827
             PNIIRF EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++
Sbjct  129   PNIIRFIEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTM  188

Query  828   QICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHS  1007
             QICHRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS
Sbjct  189   QICHRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHS  225

Query  1008  RPKSTVGTPAYIAPEVLSRREYDG  1079
             RPKSTVGTPAYIAPEVLSRREYDG
Sbjct  226   RPKSTVGTPAYIAPEVLSRREYDG  249



>ref|XP_008781505.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Phoenix dactylifera]
Length=356

 Score =   345 bits (886),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006384982.1| hypothetical protein POPTR_0004s22790g [Populus trichocarpa]
 gb|ERP62779.1| hypothetical protein POPTR_0004s22790g [Populus trichocarpa]
Length=375

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 177/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+TPTHLAI+MEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVVTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CAE54588.1| serin/threonine protein kinase [Fagus sylvatica]
Length=353

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKE+KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKESKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC  GRFSEDEARYFFQQLISGV YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICAAGRFSEDEARYFFQQLISGVPYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_003531593.1| PREDICTED: serine/threonine-protein kinase SRK2A-like isoform 
X1 [Glycine max]
 ref|XP_006585497.1| PREDICTED: serine/threonine-protein kinase SRK2A-like isoform 
X2 [Glycine max]
 gb|KHN11243.1| Serine/threonine-protein kinase SRK2B [Glycine soja]
Length=352

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001274892.1| serine/threonine-protein kinase SRK2B-like [Solanum tuberosum]
 ref|XP_006349355.1| PREDICTED: serine/threonine-protein kinase SRK2B-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006349356.1| PREDICTED: serine/threonine-protein kinase SRK2B-like isoform 
X2 [Solanum tuberosum]
 gb|AFR68941.1| sucrose non-fermenting 1-related protein kinase 2 family member 
[Solanum tuberosum]
Length=360

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004230475.1| PREDICTED: serine/threonine-protein kinase SRK2B [Solanum lycopersicum]
 ref|XP_010314655.1| PREDICTED: serine/threonine-protein kinase SRK2B [Solanum lycopersicum]
Length=361

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006431824.1| hypothetical protein CICLE_v10001672mg [Citrus clementina]
 gb|ESR45064.1| hypothetical protein CICLE_v10001672mg [Citrus clementina]
Length=351

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRNK TKELVAMKYIERG KID NVAREIINH+ LRHPNI
Sbjct  1     MEKYELMKDIGSGNFGVARLMRNKNTKELVAMKYIERGHKIDANVAREIINHKQLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006471015.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Citrus 
sinensis]
Length=351

 Score =   343 bits (880),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRNK TKELVAMKYIERG KID NVAREIINH+ LRHPNI
Sbjct  1     MEKYELMKDIGSGNFGVARLMRNKNTKELVAMKYIERGHKIDANVAREIINHKQLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010101152.1| Serine/threonine-protein kinase SAPK7 [Morus notabilis]
 gb|EXB87370.1| Serine/threonine-protein kinase SAPK7 [Morus notabilis]
Length=355

 Score =   343 bits (880),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG +IDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHRIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR+EYDG
Sbjct  158   STVGTPAYIAPEVLSRKEYDG  178



>ref|XP_007159914.1| hypothetical protein PHAVU_002G278200g [Phaseolus vulgaris]
 gb|ESW31908.1| hypothetical protein PHAVU_002G278200g [Phaseolus vulgaris]
Length=356

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002325309.2| hypothetical protein POPTR_0019s00790g [Populus trichocarpa]
 gb|EEE99690.2| hypothetical protein POPTR_0019s00790g [Populus trichocarpa]
Length=353

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CAA06503.1| protein kinase [Craterostigma plantagineum]
Length=355

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLI GV YCH+LQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLICGVHYCHALQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLK CDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKSCDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011001254.1| PREDICTED: serine/threonine-protein kinase SRK2A [Populus euphratica]
 ref|XP_011015060.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Populus 
euphratica]
Length=353

 Score =   342 bits (878),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010065455.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Eucalyptus 
grandis]
 gb|KCW62959.1| hypothetical protein EUGRSUZ_G00557 [Eucalyptus grandis]
 gb|KCW62960.1| hypothetical protein EUGRSUZ_G00557 [Eucalyptus grandis]
Length=362

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREI+NH+SL HPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIMNHKSLIHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010533957.1| PREDICTED: serine/threonine-protein kinase SRK2A [Tarenaya hassleriana]
Length=357

 Score =   342 bits (878),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLMR K TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMRIKNTKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008347910.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Malus 
domestica]
 gb|AGC31662.1| SnRK2.4 [Malus domestica]
 gb|AIK22399.1| sucrose non-fermenting-1-related protein kinase 2.5 [Malus prunifolia]
Length=352

 Score =   342 bits (878),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHL IVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFREVVLTPTHLGIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AGT16073.1| serine/threonine-protein kinase [Saccharum hybrid cultivar R570]
Length=213

 Score =   337 bits (864),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA GGELF+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAGGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010930862.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Elaeis guineensis]
Length=356

 Score =   342 bits (878),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTP+HLAIVME+AAGGELFERICN GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPSHLAIVMEFAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KHN17430.1| Serine/threonine-protein kinase SAPK7 [Glycine soja]
Length=351

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AET04893.2| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=355

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  2     MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  61

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  62    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  121

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  122   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  158

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  159   STVGTPAYIAPEVLSRREYDG  179



>ref|NP_001242600.1| uncharacterized protein LOC100804018 [Glycine max]
 gb|ACU19874.1| unknown [Glycine max]
Length=351

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009776074.1| PREDICTED: serine/threonine-protein kinase SRK2A [Nicotiana sylvestris]
 gb|AAL89456.1| osmotic stress-activated protein kinase [Nicotiana tabacum]
Length=356

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV++TPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVLVTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_003630417.1| Serine/threonine protein kinase [Medicago truncatula]
Length=354

 Score =   342 bits (877),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001236743.1| protein kinase 3 [Glycine max]
 gb|AAB68961.1| protein kinase 3 [Glycine max]
 gb|KHN16911.1| Serine/threonine-protein kinase SAPK7 [Glycine soja]
Length=351

 Score =   342 bits (876),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|ACN33610.1| unknown [Zea mays]
 tpg|DAA37760.1| TPA: putative snRK/SAPK family protein kinase [Zea mays]
Length=356

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001149107.1| LOC100282729 [Zea mays]
 gb|ACG34231.1| serine/threonine-protein kinase SAPK7 [Zea mays]
Length=356

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_003540159.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Glycine 
max]
Length=359

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KHN45467.1| Serine/threonine-protein kinase SRK2B [Glycine soja]
Length=359

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002267922.1| PREDICTED: serine/threonine-protein kinase SRK2A [Vitis vinifera]
 emb|CBI21667.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKD+GSGNFGVARLMR KETKELVAMK+IERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEMVKDLGSGNFGVARLMRVKETKELVAMKFIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009602813.1| PREDICTED: serine/threonine-protein kinase SRK2A [Nicotiana tomentosiformis]
Length=355

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIGSGNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MDKYELVKDIGSGNFGVARLMRHKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV++TPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVLVTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_007148531.1| hypothetical protein PHAVU_006G216400g [Phaseolus vulgaris]
 gb|ESW20525.1| hypothetical protein PHAVU_006G216400g [Phaseolus vulgaris]
Length=351

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRN++TKELVAMKYIERG KIDENVAREIINHRSLRH NI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNRDTKELVAMKYIERGYKIDENVAREIINHRSLRHQNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009355252.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Pyrus 
x bretschneideri]
Length=352

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKDIGSGNFGVARLMRNKETKELVAMK+I+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEIVKDIGSGNFGVARLMRNKETKELVAMKFIDRGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHL IVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHSLQIC
Sbjct  61    IRFREVVLTPTHLGIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008783426.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X2 [Phoenix dactylifera]
Length=252

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+V+DIGSGNFGVA+LMRNKETKELVAMKYIERG +IDENV REIINHRSLRHPNI
Sbjct  1     MEKYEVVRDIGSGNFGVAKLMRNKETKELVAMKYIERGRRIDENVLREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPE+LS REYDG
Sbjct  158   STVGTPAYIAPEILSGREYDG  178



>ref|XP_009104154.1| PREDICTED: serine/threonine-protein kinase SRK2A [Brassica rapa]
 emb|CDY46190.1| BnaA01g23120D [Brassica napus]
Length=352

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMR K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AIZ68211.1| serine/threonine-protein kinase SAPK7 [Ornithogalum saundersiae]
Length=363

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLT THLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH +QIC
Sbjct  61    IRFKEVVLTLTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVCYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006392094.1| hypothetical protein EUTSA_v10023544mg [Eutrema salsugineum]
 gb|ESQ29380.1| hypothetical protein EUTSA_v10023544mg [Eutrema salsugineum]
Length=361

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KDO58728.1| hypothetical protein CISIN_1g029037mg [Citrus sinensis]
Length=181

 Score =   334 bits (856),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDE RYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009148434.1| PREDICTED: serine/threonine-protein kinase SRK2A [Brassica rapa]
Length=359

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002303162.2| hypothetical protein POPTR_0003s01110g [Populus trichocarpa]
 gb|EEE78141.2| hypothetical protein POPTR_0003s01110g [Populus trichocarpa]
Length=357

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME YELVKDIGSGNFGVARLMR+K+T+ELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MENYELVKDIGSGNFGVARLMRHKQTRELVAMKYIERGRKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP+LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPQLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010547458.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Tarenaya 
hassleriana]
Length=356

 Score =   340 bits (871),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLMR K TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMRIKNTKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKE+VLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKELVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AFK33547.1| unknown [Medicago truncatula]
Length=351

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKDIGSGNFGVARLMR+K+TK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDIGSGNFGVARLMRHKDTKQLVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_003592980.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AAV41842.1| stress kinase [Medicago truncatula]
 gb|AAV41843.1| stress kinase [Medicago truncatula]
 gb|AES63231.1| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=351

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKDIGSGNFGVARLMR+K+TK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDIGSGNFGVARLMRHKDTKQLVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004503865.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=354

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+GSGNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGSGNFGVARLLRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVL+RREYDG
Sbjct  158   STVGTPAYIAPEVLNRREYDG  178



>gb|ACG50011.1| SnRK2.7 [Zea mays]
Length=356

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEK+EL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKHELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006652300.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Oryza 
brachyantha]
Length=358

 Score =   340 bits (871),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+TPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CAE54075.1| serine/threonine-protein kinase [Fagus sylvatica]
Length=359

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC  G+FSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICTAGKFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AFK42326.1| unknown [Lotus japonicus]
Length=344

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYEL+KDIGSGNFGVARLMR+KETKELVAMKY ERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELLKDIGSGNFGVARLMRHKETKELVAMKYTERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKE+VLTPTHLAIVMEYAAGGELFERIC  GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKELVLTPTHLAIVMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVCYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001052827.1| Os04g0432000 [Oryza sativa Japonica Group]
 sp|Q7XQP4.2|SAPK7_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK7; AltName: 
Full=Osmotic stress/abscisic acid-activated protein kinase 
7 [Oryza sativa Japonica Group]
 dbj|BAD18003.1| serine/threonine protein kinase SAPK7 [Oryza sativa Japonica 
Group]
 dbj|BAF14741.1| Os04g0432000 [Oryza sativa Japonica Group]
 emb|CAH66441.1| B0308C03.1 [Oryza sativa Indica Group]
 gb|EEE61026.1| hypothetical protein OsJ_14855 [Oryza sativa Japonica Group]
 gb|AEF00936.1| serine/threonine-protein kinase [Oryza sativa Japonica Group]
Length=359

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+TPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010030125.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Eucalyptus 
grandis]
 gb|KCW57091.1| hypothetical protein EUGRSUZ_I02742 [Eucalyptus grandis]
Length=373

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE++KDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSL HPNI
Sbjct  1     MDKYEVIKDIGSGNFGVARLMRNKETKELVAMKYIERGRKIDENVAREIINHRSLCHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVS+CH++QIC
Sbjct  61    IRFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSFCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AGT16423.1| hypothetical protein SHCRBa_145_O09_R_60 [Saccharum hybrid cultivar 
R570]
Length=359

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009804586.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
sylvestris]
 ref|XP_009804587.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
sylvestris]
Length=354

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME YELVK+IGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MENYELVKEIGSGNFGVARLMRHKQTKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVCYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009621087.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
tomentosiformis]
Length=353

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME YELVK+IGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MENYELVKEIGSGNFGVARLMRHKQTKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVCYCHNMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AAA33004.1| serine/threonine protein kinase [Brassica napus]
 prf||2113401B protein kinase
Length=354

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|ADP24128.1| serine/threonine protein kinase [Brassica napus]
Length=354

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006305167.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
 gb|EOA38065.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
Length=266

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_003579766.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Brachypodium 
distachyon]
Length=357

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+TPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CDY34860.1| BnaA09g47860D [Brassica napus]
Length=357

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009118223.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Brassica 
rapa]
Length=357

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|EMS63561.1| Serine/threonine-protein kinase SAPK7 [Triticum urartu]
Length=383

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+TPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011009381.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Populus 
euphratica]
Length=192

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME YELVKD+GSGNFGVARLMR+K+T+ELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MENYELVKDLGSGNFGVARLMRHKQTRELVAMKYIERGRKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IR +EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLI GVSYCHS+QIC
Sbjct  61    IRVREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP+LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPQLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004975639.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Setaria 
italica]
Length=358

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AFK42988.1| unknown [Lotus japonicus]
Length=351

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYEL+KDIGSGNFGVARLMR+KETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELLKDIGSGNFGVARLMRHKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKE+VLTPTHLAIVMEYAAGGELFERIC  GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKELVLTPTHLAIVMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVCYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDL+LENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLRLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTP YIAPEVLSRREYDG
Sbjct  158   STVGTPVYIAPEVLSRREYDG  178



>emb|CDY19332.1| BnaC05g08410D [Brassica napus]
Length=415

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICGAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KGN54829.1| hypothetical protein Csa_4G515040 [Cucumis sativus]
Length=357

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004146378.1| PREDICTED: serine/threonine-protein kinase SRK2H [Cucumis sativus]
 ref|XP_011653912.1| PREDICTED: serine/threonine-protein kinase SRK2H [Cucumis sativus]
 ref|XP_011653913.1| PREDICTED: serine/threonine-protein kinase SRK2H [Cucumis sativus]
Length=355

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_007049928.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOX94085.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
Length=352

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001047099.1| Os02g0551100 [Oryza sativa Japonica Group]
 sp|Q6ZI44.1|SAPK6_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK6; AltName: 
Full=Osmotic stress/abscisic acid-activated protein kinase 
6 [Oryza sativa Japonica Group]
 dbj|BAD15474.1| putative osmotic stress-activated protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAD18002.1| serine/threonine protein kinase SAPK6 [Oryza sativa Japonica 
Group]
 dbj|BAD33270.1| putative osmotic stress-activated protein kinase [Oryza sativa 
Japonica Group]
 gb|ABB89146.1| serine-threonine protein kinase [Oryza sativa Japonica Group]
 dbj|BAF09013.1| Os02g0551100 [Oryza sativa Japonica Group]
 dbj|BAG90400.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57169.1| hypothetical protein OsJ_07099 [Oryza sativa Japonica Group]
 gb|AEF00935.1| serine/threonine-protein kinase [Oryza sativa Japonica Group]
Length=365

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRN+ETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELLKDIGSGNFGVARLMRNRETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDE+RYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDESRYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006417402.1| hypothetical protein EUTSA_v10007985mg [Eutrema salsugineum]
 gb|ESQ35755.1| hypothetical protein EUTSA_v10007985mg [Eutrema salsugineum]
Length=366

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004952838.1| PREDICTED: serine/threonine-protein kinase SAPK6-like isoform 
X2 [Setaria italica]
Length=454

 Score =   341 bits (875),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 175/203 (86%), Gaps = 23/203 (11%)
 Frame = +3

Query  471   EKMEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHP  650
             + ME+YEL+KDIGSGNFGVARLMRNKETKELVAMKYI RGLKIDENVAREIINHRSLRHP
Sbjct  89    DSMERYELLKDIGSGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHP  148

Query  651   NIIRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQ  830
             NIIRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +Q
Sbjct  149   NIIRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQ  208

Query  831   ICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSR  1010
             ICHRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+
Sbjct  209   ICHRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSK  245

Query  1011  PKSTVGTPAYIAPEVLSRREYDG  1079
             PKSTVGTPAYIAPEVLSRREYDG
Sbjct  246   PKSTVGTPAYIAPEVLSRREYDG  268



>gb|AID23890.1| sucrose non-fermenting 1-related protein kinase 2 [Gossypium 
hirsutum]
Length=354

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVL+RREYDG
Sbjct  158   STVGTPAYIAPEVLARREYDG  178



>gb|EEC73377.1| hypothetical protein OsI_07615 [Oryza sativa Indica Group]
Length=365

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRN+ETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELLKDIGSGNFGVARLMRNRETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDE+RYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDESRYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AFK36100.1| unknown [Medicago truncatula]
Length=313

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+GSGNFGVA+LMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYEAVKDLGSGNFGVAKLMRNKVTKELVAMKYIERGSKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008442077.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
 ref|XP_008442078.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
 ref|XP_008442079.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
Length=357

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_172563.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
 sp|P43291.1|SRK2A_ARATH RecName: Full=Serine/threonine-protein kinase SRK2A; AltName: 
Full=Arabidopsis protein SK1; AltName: Full=OST1-kinase-like 
7; AltName: Full=SNF1-related kinase 2.4; Short=SnRK2.4 [Arabidopsis 
thaliana]
 gb|AAA02840.1| serine/threonine kinase [Arabidopsis thaliana]
 gb|AAB65483.1| Ser/Thr kinase; 69816-71936 [Arabidopsis thaliana]
 gb|AAM13129.1| Ser/Thr kinase [Arabidopsis thaliana]
 gb|AAM60822.1| Ser/Thr kinase [Arabidopsis thaliana]
 gb|AAP68289.1| At1g10940 [Arabidopsis thaliana]
 gb|AEE28666.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
Length=363

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|EMT04089.1| Serine/threonine-protein kinase SAPK7 [Aegilops tauschii]
Length=357

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+TPTHLAIVMEYAAGGE+F+RICN GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVVTPTHLAIVMEYAAGGEVFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002892611.1| hypothetical protein ARALYDRAFT_888390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68870.1| hypothetical protein ARALYDRAFT_888390 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010458473.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Camelina 
sativa]
Length=361

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008783425.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X1 [Phoenix dactylifera]
Length=364

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+V+DIGSGNFGVA+LMRNKETKELVAMKYIERG +IDENV REIINHRSLRHPNI
Sbjct  1     MEKYEVVRDIGSGNFGVAKLMRNKETKELVAMKYIERGRRIDENVLREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPE+LS REYDG
Sbjct  158   STVGTPAYIAPEILSGREYDG  178



>gb|KFK43389.1| hypothetical protein AALP_AA1G119700 [Arabis alpina]
Length=360

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AFK47198.1| unknown [Medicago truncatula]
Length=355

 Score =   337 bits (865),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  2     MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  61

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKE VLTPTHLAIVMEYAAGGELFERICN GR SEDEARYFFQQLISGV YCH++QIC
Sbjct  62    IRFKEAVLTPTHLAIVMEYAAGGELFERICNAGRSSEDEARYFFQQLISGVHYCHAMQIC  121

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  122   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  158

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  159   STVGTPAYIAPEVLSRREYDG  179



>gb|KDO58729.1| hypothetical protein CISIN_1g029037mg [Citrus sinensis]
Length=200

 Score =   332 bits (850),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDE RYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002453967.1| hypothetical protein SORBIDRAFT_04g022410 [Sorghum bicolor]
 gb|EES06943.1| hypothetical protein SORBIDRAFT_04g022410 [Sorghum bicolor]
Length=364

 Score =   338 bits (866),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010492159.1| PREDICTED: serine/threonine-protein kinase SRK2A [Camelina sativa]
Length=360

 Score =   338 bits (866),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006305166.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
 gb|EOA38064.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
Length=362

 Score =   338 bits (866),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|EPS60016.1| hypothetical protein M569_14789 [Genlisea aurea]
Length=360

 Score =   337 bits (865),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKE+VLTPTHLAIVMEYAAGGELFERICN GRFSEDE+RYFFQQLI GVS+CH++QIC
Sbjct  61    IRFKELVLTPTHLAIVMEYAAGGELFERICNAGRFSEDESRYFFQQLICGVSFCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSHAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVL RREYDG
Sbjct  158   STVGTPAYIAPEVLQRREYDG  178



>gb|AIO02852.1| phloem small RNA-binding protein kinase 1 [Cucurbita maxima]
Length=359

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEIVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSTAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006300518.1| hypothetical protein CARUB_v10020517mg [Capsella rubella]
 gb|EOA33416.1| hypothetical protein CARUB_v10020517mg [Capsella rubella]
Length=364

 Score =   337 bits (865),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGNKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CDY20973.1| BnaA08g25520D [Brassica napus]
Length=354

 Score =   337 bits (864),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|ACG33803.1| serine/threonine-protein kinase SAPK6 [Zea mays]
Length=364

 Score =   337 bits (865),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001136796.1| uncharacterized LOC100216941 [Zea mays]
 gb|ACF82654.1| unknown [Zea mays]
 gb|AFW62593.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=364

 Score =   337 bits (865),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009144406.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Brassica 
rapa]
Length=354

 Score =   337 bits (864),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011097123.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Sesamum indicum]
Length=354

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVK++G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKNLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC  GRFSE+EARYFFQQLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICTAGRFSENEARYFFQQLISGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AAA33003.1| serine/threonine protein kinase [Brassica napus]
 prf||2113401A protein kinase
Length=359

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREI NHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIYNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICGAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AFW62592.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=356

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MERYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KJB71410.1| hypothetical protein B456_011G121900 [Gossypium raimondii]
 gb|KJB71411.1| hypothetical protein B456_011G121900 [Gossypium raimondii]
Length=353

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVL+RREYDG
Sbjct  158   STVGTPAYIAPEVLARREYDG  178



>gb|KEH35656.1| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=355

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+GSGNFGVA+LMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYEAVKDLGSGNFGVAKLMRNKVTKELVAMKYIERGSKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010418041.1| PREDICTED: serine/threonine-protein kinase SRK2B-like [Camelina 
sativa]
Length=362

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLMR K +K+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMRVKNSKDLVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010473290.1| PREDICTED: serine/threonine-protein kinase SRK2B [Camelina sativa]
Length=362

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLMR K +K+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMRVKNSKDLVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_011009382.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Populus 
euphratica]
Length=357

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME YELVKD+GSGNFGVARLMR+K+T+ELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1     MENYELVKDLGSGNFGVARLMRHKQTRELVAMKYIERGRKIDENVAREIINHKSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRF+EVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLI GVSYCHS+QIC
Sbjct  61    IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP+LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPQLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_007049927.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX94084.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=352

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKE +LTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEAILTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004144354.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cucumis 
sativus]
Length=355

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSTAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_008449831.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
Length=355

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSTAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006647363.1| PREDICTED: serine/threonine-protein kinase SAPK6-like [Oryza 
brachyantha]
Length=371

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMR+KETKELVAMKYI RGLKIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELLKDIGSGNFGVARLMRDKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVLLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDG+PAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGNPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_012087257.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Jatropha 
curcas]
 gb|KDP25157.1| hypothetical protein JCGZ_24259 [Jatropha curcas]
Length=355

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDLGAGNFGVARLLRHKETKQLVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC  GRFSEDEARYFFQQLISGV YCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLISGVDYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004485476.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=351

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE VKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEHVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHCMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDG+PAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGNPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004503013.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=357

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+GSGNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYEAVKDLGSGNFGVARLMRNKVTKELVAMKYIERGHKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLS+REYDG
Sbjct  158   STVGTPAYIAPEVLSKREYDG  178



>ref|XP_010430082.1| PREDICTED: serine/threonine-protein kinase SRK2B-like [Camelina 
sativa]
Length=362

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +K+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKDLVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010475982.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Camelina 
sativa]
Length=363

 Score =   335 bits (860),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+G FGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGKFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAI MEYAAGGELFERIC  GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010911872.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Elaeis 
guineensis]
Length=358

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKDIGSGNFGVA+LMRNKETKELVAMK IERG +IDENV REIINHRSLRHPNI
Sbjct  1     MEKYEVVKDIGSGNFGVAKLMRNKETKELVAMKCIERGRRIDENVLREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPE+LS REYDG
Sbjct  158   STVGTPAYIAPEILSGREYDG  178



>gb|ACN35772.1| unknown [Zea mays]
 gb|ACR38484.1| unknown [Zea mays]
 gb|AFW71757.1| putative snRK/SAPK family protein kinase isoform 1 [Zea mays]
 gb|AFW71758.1| putative snRK/SAPK family protein kinase isoform 2 [Zea mays]
Length=364

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RGLKIDENVAREIINHRSLRH NI
Sbjct  1     MEKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHHNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001105274.1| uncharacterized protein LOC542190 [Zea mays]
 gb|AAU43772.1| putative salt-inducible protein kinase [Zea mays]
Length=364

 Score =   335 bits (859),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RGLKIDENVAREIINHRSLRH NI
Sbjct  1     MEKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHHNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHLMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006426422.1| hypothetical protein CICLE_v10025965mg [Citrus clementina]
 gb|ESR39662.1| hypothetical protein CICLE_v10025965mg [Citrus clementina]
Length=353

 Score =   334 bits (857),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDE RYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006466196.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Citrus 
sinensis]
Length=354

 Score =   334 bits (857),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDE RYFFQQLISGV+YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009384226.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YE+V+DIGSGNFGVA+LMR+KETKELVAMKYIERG +IDENVAREI+NHRSL HPNI
Sbjct  1     MERYEVVRDIGSGNFGVAKLMRHKETKELVAMKYIERGPRIDENVAREIVNHRSLLHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH  QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICDAGRFSEDEARYFFQQLISGVSYCHFRQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006384384.1| kinase SPK-3 family protein [Populus trichocarpa]
 gb|ERP62181.1| kinase SPK-3 family protein [Populus trichocarpa]
Length=360

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 175/207 (85%), Gaps = 29/207 (14%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKE------VVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYC  818
             IRFKE      VVLTPTHL IVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV++C
Sbjct  61    IRFKEASTRNMVVLTPTHLVIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNFC  120

Query  819   HSLQICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSL  998
             H++QICHRDLKLENTLLDGSPAPRLKICDFGYSK                       SSL
Sbjct  121   HNMQICHRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSL  157

Query  999   LHSRPKSTVGTPAYIAPEVLSRREYDG  1079
             LHSRPKSTVGTPAYIAPEVLSRREYDG
Sbjct  158   LHSRPKSTVGTPAYIAPEVLSRREYDG  184



>ref|XP_003526896.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Glycine 
max]
Length=346

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYETVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IR+KEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001238298.1| protein kinase [Glycine max]
 gb|AAB68962.1| protein kinase [Glycine max]
Length=349

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYEAVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IR+KEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KHN09673.1| Serine/threonine-protein kinase SRK2A [Glycine soja]
Length=350

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYETVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IR+KEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KHN31217.1| Serine/threonine-protein kinase SRK2A [Glycine soja]
Length=349

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYEAVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IR+KEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010025673.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Eucalyptus 
grandis]
Length=360

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 174/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VK +G+GNFGVARLMR+KET+ELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKHLGAGNFGVARLMRHKETQELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELF+RIC+ GRFSEDEARYFFQQLISGV+YCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFDRICSAGRFSEDEARYFFQQLISGVNYCHHMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CDX97923.1| BnaA06g06740D [Brassica napus]
Length=362

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 174/209 (83%), Gaps = 31/209 (15%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDE--------ARYFFQQLISGVS  812
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDE        ARYFFQQLISGVS
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEVSFKNRNHARYFFQQLISGVS  120

Query  813   YCHSLQICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*S  992
             YCH++QICHRDLKLENTLLDGSPAPRLKICDFGYSK                       S
Sbjct  121   YCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------S  157

Query  993   SLLHSRPKSTVGTPAYIAPEVLSRREYDG  1079
             SLLHSRPKSTVGTPAYIAPEVLSRREYDG
Sbjct  158   SLLHSRPKSTVGTPAYIAPEVLSRREYDG  186



>ref|XP_009150418.1| PREDICTED: serine/threonine-protein kinase SRK2H [Brassica rapa]
 emb|CDY41527.1| BnaA06g22800D [Brassica napus]
Length=357

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_007049926.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94083.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=357

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 175/206 (85%), Gaps = 28/206 (14%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKE-----VVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCH  821
             IRFKE     VVLTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV+YCH
Sbjct  61    IRFKEASIISVVLTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCH  120

Query  822   SLQICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLL  1001
             S+QICHRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLL
Sbjct  121   SMQICHRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLL  157

Query  1002  HSRPKSTVGTPAYIAPEVLSRREYDG  1079
             HSRPKSTVGTPAYIAPEVLSRREYDG
Sbjct  158   HSRPKSTVGTPAYIAPEVLSRREYDG  183



>ref|XP_009406104.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406105.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   332 bits (852),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+GSGNFGVARL+RNKETKELVA+KYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEMVKDLGSGNFGVARLLRNKETKELVAIKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELF+RIC  GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLICGVSYCHYMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CDY03768.1| BnaC01g28850D [Brassica napus]
Length=589

 Score =   340 bits (871),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMR K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009399177.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+V++IGSGNFGVA+LMR+KETKELVAMKYIERG +IDENVAREI+NHRSLRHPNI
Sbjct  1     MEKYEVVRNIGSGNFGVAKLMRHKETKELVAMKYIERGYRIDENVAREIVNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH  QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICDAGRFSEDEARYFFQQLICGVSYCHFRQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AIZ68209.1| serine/threonine-protein kinase SAPK7-like protein [Ornithogalum 
saundersiae]
Length=358

 Score =   332 bits (851),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+V+D+GSGNFGVARLMR+KETKELVA+KYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVRDLGSGNFGVARLMRHKETKELVAVKYIPRGNKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002866567.1| serine/threonine-protein kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42826.1| serine/threonine-protein kinase [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CDY34668.1| BnaC08g42270D [Brassica napus]
Length=361

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 173/208 (83%), Gaps = 30/208 (14%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDE-------ARYFFQQLISGVSY  815
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDE       ARYFFQQLISGVSY
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEIRKKRKHARYFFQQLISGVSY  120

Query  816   CHSLQICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SS  995
             CH++QICHRDLKLENTLLDGSPAPRLKICDFGYSK                       SS
Sbjct  121   CHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SS  157

Query  996   LLHSRPKSTVGTPAYIAPEVLSRREYDG  1079
             LLHSRPKSTVGTPAYIAPEVLSRREYDG
Sbjct  158   LLHSRPKSTVGTPAYIAPEVLSRREYDG  185



>emb|CDX84430.1| BnaC03g50700D [Brassica napus]
Length=352

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKDLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006394252.1| hypothetical protein EUTSA_v10004481mg [Eutrema salsugineum]
 gb|ESQ31538.1| hypothetical protein EUTSA_v10004481mg [Eutrema salsugineum]
Length=356

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AAM67112.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
Length=361

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSMPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR EYDG
Sbjct  158   STVGTPAYIAPEVLSRGEYDG  178



>ref|NP_176290.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 ref|NP_849834.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 sp|Q9C958.1|SRK2B_ARATH RecName: Full=Serine/threonine-protein kinase SRK2B; AltName: 
Full=OST1-kinase-like 6; AltName: Full=SNF1-related kinase 
2.10; Short=SnRK2.10 [Arabidopsis thaliana]
 gb|AAG51649.1|AC018908_15 putative serine/threonine-protein kinase; 36981-34483 [Arabidopsis 
thaliana]
 gb|AAL61947.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AAO00906.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AEE33750.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 gb|AEE33751.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
Length=361

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AI MEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSMPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR EYDG
Sbjct  158   STVGTPAYIAPEVLSRGEYDG  178



>ref|XP_003575110.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Brachypodium 
distachyon]
Length=362

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 173/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRN+ETKEL+A+KYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNRETKELLAVKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVLLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDG+PAPRLKICDFGYSK                       SSLLHS+PK
Sbjct  121   HRDLKLENTLLDGNPAPRLKICDFGYSK-----------------------SSLLHSKPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>dbj|BAH56941.1| AT5G63650 [Arabidopsis thaliana]
Length=346

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|AAM65503.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=358

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010484120.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Camelina 
sativa]
Length=357

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010444281.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Camelina 
sativa]
Length=356

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_201170.1| serine/threonine-protein kinase SRK2H [Arabidopsis thaliana]
 sp|Q9FFP9.1|SRK2H_ARATH RecName: Full=Serine/threonine-protein kinase SRK2H; AltName: 
Full=OST1-kinase-like 9; AltName: Full=SNF1-related kinase 
2.5; Short=SnRK2.5 [Arabidopsis thaliana]
 dbj|BAB10458.1| serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AED97781.1| serine/threonine-protein kinase SRK2H [Arabidopsis thaliana]
Length=360

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|ABK25003.1| unknown [Picea sitchensis]
Length=427

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 176/201 (88%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+++E+VKDIGSGNFGVARLMRNK+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDRFEVVKDIGSGNFGVARLMRNKKTKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYAAGGELF+RICN GRFSEDEAR+FFQQLISGVSYCH+++IC
Sbjct  61    IRFKEVLLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARFFFQQLISGVSYCHAMKIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR+EYDG
Sbjct  158   STVGTPAYIAPEVLSRKEYDG  178



>ref|XP_010460858.1| PREDICTED: serine/threonine-protein kinase SRK2H [Camelina sativa]
Length=357

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006280694.1| hypothetical protein CARUB_v10026657mg [Capsella rubella]
 gb|EOA13592.1| hypothetical protein CARUB_v10026657mg [Capsella rubella]
Length=359

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010912491.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
SAPK7-like [Elaeis guineensis]
Length=356

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 170/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELV+DIG GNF VARLMRNKET ELVAMKYI RG KIDE VAREIINHRSLRHPNI
Sbjct  1     MEKYELVRDIGVGNFAVARLMRNKETGELVAMKYIPRGQKIDEKVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDG+PAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGNPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVL+RREYDG
Sbjct  158   STVGTPAYIAPEVLARREYDG  178



>gb|ACU23651.1| unknown [Glycine max]
Length=349

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYEAVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IR+KEVVLTPTHL IVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV +CH++QIC
Sbjct  61    IRYKEVVLTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAY+APEVLSRREYDG
Sbjct  158   STVGTPAYVAPEVLSRREYDG  178



>emb|CDP20535.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE++KD+G+GNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVMKDLGAGNFGVARLMRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHL IVMEYAAGGELF+RIC  GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVILTPTHLGIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLISGVCYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLD SPAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDSSPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010546285.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Tarenaya 
hassleriana]
 ref|XP_010546286.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Tarenaya 
hassleriana]
Length=345

 Score =   330 bits (845),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VKD+G+GNFGVARLMR+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKDLGAGNFGVARLMRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSE EARYFFQQLI GV YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEPEARYFFQQLICGVDYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR+EYDG
Sbjct  158   STVGTPAYIAPEVLSRKEYDG  178



>ref|XP_010675155.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+VK +G+GNFGVARLMR+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVKQLGAGNFGVARLMRHKETKELVAVKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTP+HL IVMEYAAGGELF+RIC  GRFSEDEARYFFQQLISGVS+CHS+QIC
Sbjct  61    IRFKEVVLTPSHLGIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLISGVSFCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGS APRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_001031021.2| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
 gb|AEE28667.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
Length=371

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 173/209 (83%), Gaps = 31/209 (15%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDE--------ARYFFQQLISGVS  812
             IRFKEVVLTPTHLAI MEYAAGGELFERIC+ GRFSEDE        ARYFFQQLISGVS
Sbjct  61    IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEEEGNKRKHARYFFQQLISGVS  120

Query  813   YCHSLQICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*S  992
             YCH++QICHRDLKLENTLLDGSPAPRLKICDFGYSK                       S
Sbjct  121   YCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------S  157

Query  993   SLLHSRPKSTVGTPAYIAPEVLSRREYDG  1079
             SLLHSRPKSTVGTPAYIAPEVLSRREYDG
Sbjct  158   SLLHSRPKSTVGTPAYIAPEVLSRREYDG  186



>gb|KJB79237.1| hypothetical protein B456_013G038800 [Gossypium raimondii]
Length=348

 Score =   330 bits (845),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 170/201 (85%), Gaps = 29/201 (14%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDE      QLISGVSYCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDE------QLISGVSYCHSMQIC  114

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  115   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  151

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  152   STVGTPAYIAPEVLSRREYDG  172



>dbj|BAE99712.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=360

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR+EYDG
Sbjct  158   STVGTPAYIAPEVLSRKEYDG  178



>ref|XP_008784212.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Phoenix 
dactylifera]
Length=356

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 170/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELV+DIGSGNF VARLMRNKET ELVAMKYI RG KI ENVAREIINHRSLRHPNI
Sbjct  1     MEKYELVRDIGSGNFAVARLMRNKETGELVAMKYIPRGQKICENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDG+PAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGNPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVL+ REYDG
Sbjct  158   STVGTPAYIAPEVLAHREYDG  178



>ref|XP_009602316.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Nicotiana 
tomentosiformis]
Length=362

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+ YE+VK++GSGNFGVARLMRNKETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MQNYEVVKELGSGNFGVARLMRNKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC  GRFSE EARYFFQQLI GV YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICQAGRFSEAEARYFFQQLICGVHYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDG+PAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGNPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KDO49173.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=205

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_001777278.1| predicted protein [Physcomitrella patens]
 gb|EDQ57933.1| predicted protein [Physcomitrella patens]
Length=349

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 174/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  10    DRYELVKDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  69

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+QICH
Sbjct  70    RFKEVMLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQICH  129

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PKS
Sbjct  130   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSQPKS  166

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVLS++EYDG
Sbjct  167   TVGTPAYIAPEVLSKKEYDG  186



>ref|XP_009404984.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 172/201 (86%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE+V+DIGSGNFGVA+LMR+++TKELVAMK+IERG +IDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVVRDIGSGNFGVAKLMRHRDTKELVAMKHIERGQRIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLI GVSYCH  QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICDAGRFSEDEARYFFQQLICGVSYCHLRQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLS REYDG
Sbjct  158   STVGTPAYIAPEVLSPREYDG  178



>ref|XP_001778501.1| predicted protein [Physcomitrella patens]
 gb|EDQ56674.1| predicted protein [Physcomitrella patens]
Length=348

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 174/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  13    DRYELVKDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  72

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+QICH
Sbjct  73    RFKEVLLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQICH  132

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PKS
Sbjct  133   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSQPKS  169

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVLS++EYDG
Sbjct  170   TVGTPAYIAPEVLSKKEYDG  189



>emb|CEO16426.1| sucrose non-fermenting 1-related protein kinase 2 family member 
[Marchantia polymorpha]
Length=349

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 175/201 (87%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI
Sbjct  9     MDRYELVRDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNI  68

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             +RFKEV++TPTHLAIVMEYAAGGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+QIC
Sbjct  69    VRFKEVMVTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQIC  128

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PK
Sbjct  129   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSILHSQPK  165

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLS++EYDG
Sbjct  166   STVGTPAYIAPEVLSKKEYDG  186



>gb|KJB32410.1| hypothetical protein B456_005G239800 [Gossypium raimondii]
Length=240

 Score =   324 bits (830),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|ABR16094.1| unknown [Picea sitchensis]
 gb|ACN40963.1| unknown [Picea sitchensis]
Length=356

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 174/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSL+HPNI+
Sbjct  17    DRYELVKDIGSGNFGVARLMRDKQTKELVAVKYIERGEKIDENVQREIINHRSLKHPNIV  76

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RF+EV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+QICH
Sbjct  77    RFREVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQICH  136

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       S+LLHS+PKS
Sbjct  137   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SALLHSQPKS  173

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPE+LS++EYDG
Sbjct  174   TVGTPAYIAPEILSKKEYDG  193



>ref|XP_009420573.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=371

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 170/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYELVKDIGSGNFGVARLMR+K T ELVAMKYI RG KI+ENVAREIIN RSL HPNI
Sbjct  1     MEKYELVKDIGSGNFGVARLMRDKVTGELVAMKYIPRGQKINENVAREIINQRSLCHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICHAGRFSEDEARYFFQQLISGVSYCHYMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_002886574.1| hypothetical protein ARALYDRAFT_475237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62833.1| hypothetical protein ARALYDRAFT_475237 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 170/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTH+AI ME+AAGGELFERIC+ GRFSEDEARYFFQQLISGVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHIAIAMEFAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHS PK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSMPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR EYDG
Sbjct  158   STVGTPAYIAPEVLSRGEYDG  178



>gb|KDO50085.1| hypothetical protein CISIN_1g0187342mg, partial [Citrus sinensis]
Length=172

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 166/201 (83%), Gaps = 30/201 (15%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRNK TKELVAMKYIERG KID NVAREIINH+ LRHPNI
Sbjct  1     MEKYELMKDIGSGNFGVARLMRNKNTKELVAMKYIERGHKIDANVAREIINHKQLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISG       QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISG-------QIC  113

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  114   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  150

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  151   STVGTPAYIAPEVLSRREYDG  171



>ref|XP_010547692.1| PREDICTED: serine/threonine-protein kinase SRK2G [Tarenaya hassleriana]
Length=356

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE++KD+G+GNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MEKYEVMKDLGAGNFGVARLMRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RICN GRFSE EARYFFQQLI GV YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEAEARYFFQQLICGVDYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SSLLHS PK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSLLHSIPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSR+EYDG
Sbjct  158   STVGTPAYIAPEVLSRKEYDG  178



>ref|XP_006852955.1| PREDICTED: serine/threonine-protein kinase SAPK10 [Amborella 
trichopoda]
 gb|ERN14422.1| hypothetical protein AMTR_s00033p00242600 [Amborella trichopoda]
Length=364

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTKELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|KJB12210.1| hypothetical protein B456_002G006900 [Gossypium raimondii]
Length=360

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 171/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K T ELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  19    DRYELVKDIGSGNFGVARLMRDKHTDELVAVKYIERGEKIDENVQREIINHRSLRHPNII  78

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  79    RFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  138

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PKS
Sbjct  139   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSQPKS  175

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  176   TVGTPAYIAPEVLLKKEYDG  195



>gb|KJB32411.1| hypothetical protein B456_005G239800 [Gossypium raimondii]
Length=328

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|ACU17547.1| unknown [Glycine max]
Length=168

 Score =   320 bits (821),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 164/191 (86%), Gaps = 23/191 (12%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERICN GRFSEDEARYFFQQLISGV YCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLL+GSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLNGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAP  1049
             STVGTPAYIAP
Sbjct  158   STVGTPAYIAP  168



>ref|XP_009780712.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Nicotiana 
sylvestris]
Length=362

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+ YE+VK++GSGNFGVARLMR+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1     MQNYEVVKELGSGNFGVARLMRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC  GRFSE EARYFFQQLI GV YCHS+QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICQAGRFSEAEARYFFQQLICGVHYCHSMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDG+PAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGNPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KDO79323.1| hypothetical protein CISIN_1g0178602mg [Citrus sinensis]
Length=219

 Score =   322 bits (825),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 170/200 (85%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++Y+ V+DIGSGNFGVARLMR+K TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  23    DRYDFVRDIGSGNFGVARLMRDKVTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  82

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  83    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  142

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  143   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  179

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL R EYDG
Sbjct  180   TVGTPAYIAPEVLLRHEYDG  199



>gb|KDO49171.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=237

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_007137814.1| hypothetical protein PHAVU_009G157800g [Phaseolus vulgaris]
 gb|ESW09808.1| hypothetical protein PHAVU_009G157800g [Phaseolus vulgaris]
Length=351

 Score =   327 bits (837),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE VK++G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1     MDKYEAVKELGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IR+KEVVLTPTHLAIVMEYAAGGELFERIC+ GRFSEDEARYFFQQLISGV +CH+ QIC
Sbjct  61    IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTKQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS PK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSLPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KDO49172.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=240

 Score =   322 bits (826),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|KDO79324.1| hypothetical protein CISIN_1g0178602mg, partial [Citrus sinensis]
 gb|KDO79325.1| hypothetical protein CISIN_1g0178602mg, partial [Citrus sinensis]
 gb|KDO79326.1| hypothetical protein CISIN_1g0178602mg, partial [Citrus sinensis]
Length=200

 Score =   321 bits (822),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 170/200 (85%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++Y+ V+DIGSGNFGVARLMR+K TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  23    DRYDFVRDIGSGNFGVARLMRDKVTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  82

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  83    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  142

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  143   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  179

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL R EYDG
Sbjct  180   TVGTPAYIAPEVLLRHEYDG  199



>gb|AFW71759.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=377

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 173/214 (81%), Gaps = 36/214 (17%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RGLKIDENVAREIINHRSLRH NI
Sbjct  1     MEKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHHNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYC------  818
             IRFKEVVLTPTHLAIVMEYAAGGELF+RIC+ GRFSEDEARYFFQQLI GVSYC      
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMRCA  120

Query  819   -------HSLQICHRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLY  977
                    HS QICHRDLKLENTLLDGSPAPRLKICDFGYSK                   
Sbjct  121   TANFVWIHSQQICHRDLKLENTLLDGSPAPRLKICDFGYSK-------------------  161

Query  978   PCT*SSLLHSRPKSTVGTPAYIAPEVLSRREYDG  1079
                 SSLLHS+PKSTVGTPAYIAPEVLSRREYDG
Sbjct  162   ----SSLLHSKPKSTVGTPAYIAPEVLSRREYDG  191



>ref|XP_009403694.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=360

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 170/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME YELVKDIGSGNFGVARLMRNK+T ELVAMKYI RG KI+ENVAREIIN RSL HPNI
Sbjct  2     MEMYELVKDIGSGNFGVARLMRNKDTGELVAMKYIPRGPKINENVAREIINQRSLSHPNI  61

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIV+EYAAGGELF+RIC+ GRFSEDEARYFFQQLISGVSYCH +QIC
Sbjct  62    IRFKEVMLTPTHLAIVLEYAAGGELFDRICHAGRFSEDEARYFFQQLISGVSYCHFMQIC  121

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  122   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  158

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  159   STVGTPAYIAPEVLSRREYDG  179



>ref|XP_009122476.1| PREDICTED: serine/threonine-protein kinase SRK2G [Brassica rapa]
Length=364

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYEVVKDLGTGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELFERIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFERICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KDO49170.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=288

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|KJB32409.1| hypothetical protein B456_005G239800 [Gossypium raimondii]
Length=363

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_003580888.1| PREDICTED: serine/threonine-protein kinase SAPK5-like [Brachypodium 
distachyon]
Length=380

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE V++IGSGNFGVA+LMRNKET+ELVAMK+IERG +IDENV REI+NHRSLRHPNI
Sbjct  1     MEKYEPVREIGSGNFGVAKLMRNKETRELVAMKFIERGYRIDENVFREIVNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHL IVMEYAAGGELFERIC+ GRF EDEARYFFQQL+ GVS+CH++QIC
Sbjct  61    IRFKEVVLTPTHLGIVMEYAAGGELFERICDAGRFHEDEARYFFQQLVCGVSFCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KHG25553.1| Serine/threonine-protein kinase SRK2E [Gossypium arboreum]
Length=363

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_006288056.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
 gb|EOA20954.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
Length=272

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010263754.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Nelumbo 
nucifera]
Length=362

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTRELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|KDO49168.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=330

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>emb|CDY72554.1| BnaAnng41460D, partial [Brassica napus]
Length=289

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K++ ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19    DRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  79    RFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  139   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  175

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  176   TVGTPAYIAPEVLLKKEYDG  195



>ref|XP_011099217.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Sesamum 
indicum]
Length=355

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++Y+ V+DIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYDFVRDIGSGNFGVARLMRDKQTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRF+EDEAR+FFQQLISGVSYCHS+QICH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFNEDEARFFFQQLISGVSYCHSMQICH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL R+EYDG
Sbjct  178   TVGTPAYIAPEVLLRKEYDG  197



>ref|XP_010255130.1| PREDICTED: serine/threonine-protein kinase SAPK10 [Nelumbo nucifera]
Length=361

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKQTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_010423046.1| PREDICTED: serine/threonine-protein kinase SRK2G [Camelina sativa]
Length=354

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+GSGNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDVVKDLGSGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010452877.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Camelina 
sativa]
Length=356

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+GSGNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDVVKDLGSGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>emb|CDP02466.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++Y+LV+DIGSGNFG+ARLMR+K+TKELVA+KYIERG KIDENV REIINHRSL+HPNI+
Sbjct  5     DRYDLVRDIGSGNFGIARLMRDKQTKELVAVKYIERGDKIDENVKREIINHRSLKHPNIV  64

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  65    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  124

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PKS
Sbjct  125   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSQPKS  161

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL R+EYDG
Sbjct  162   TVGTPAYIAPEVLLRQEYDG  181



>ref|XP_004959953.1| PREDICTED: serine/threonine-protein kinase SAPK5-like isoform 
X2 [Setaria italica]
Length=380

 Score =   326 bits (835),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             ME+YE V++IG+GNFGVA+LMRNKET+ELVAMK+IERG +IDENV REI+NHRSLRHPNI
Sbjct  1     MERYEPVREIGAGNFGVAKLMRNKETRELVAMKFIERGNRIDENVFREIVNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLTPTHLAIVMEYAAGGELFERIC  GRF EDEARYFFQQL+ GVSYCH++QIC
Sbjct  61    IRFKEVVLTPTHLAIVMEYAAGGELFERICEAGRFHEDEARYFFQQLVCGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010526938.1| PREDICTED: serine/threonine-protein kinase SRK2E-like isoform 
X1 [Tarenaya hassleriana]
Length=366

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|EYU44364.1| hypothetical protein MIMGU_mgv1a009037mg [Erythranthe guttata]
Length=355

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++Y+ V+DIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYDFVRDIGSGNFGVARLMRDKQTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQL+SGVSYCHS+QICH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLLSGVSYCHSMQICH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL R+EYDG
Sbjct  178   TVGTPAYIAPEVLLRKEYDG  197



>gb|KFK25224.1| hypothetical protein AALP_AA8G083600 [Arabis alpina]
Length=354

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+GSGNFGVARL+ +KETKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDVVKDLGSGNFGVARLLMHKETKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELFERIC+ GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFERICSAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004290308.1| PREDICTED: serine/threonine-protein kinase SRK2E [Fragaria vesca 
subsp. vesca]
 gb|AIH00109.1| sucrose nonfermenting 1-related protein kinase 2.6 [Fragaria 
x ananassa]
Length=363

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_001769324.1| predicted protein [Physcomitrella patens]
 gb|EDQ65878.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   324 bits (831),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             E+YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  5     ERYELVKDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  64

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYAAGGELFERICN GRFSEDEAR+FFQQLISGVSYCH +QICH
Sbjct  65    RFKEVMLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHVMQICH  124

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGS APRLKICDFGYSK                       SSLLHS+PKS
Sbjct  125   RDLKLENTLLDGSAAPRLKICDFGYSK-----------------------SSLLHSQPKS  161

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVLS++EYDG
Sbjct  162   TVGTPAYIAPEVLSKKEYDG  181



>ref|XP_009397730.1| PREDICTED: serine/threonine-protein kinase SAPK10 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFG+ARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  21    DRYELVKDIGSGNFGIARLMRDKQTKELVAVKYIERGEKIDENVQREIINHRSLRHPNII  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGS APRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSTAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_002871349.1| hypothetical protein ARALYDRAFT_908839 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47608.1| hypothetical protein ARALYDRAFT_908839 [Arabidopsis lyrata subsp. 
lyrata]
Length=351

 Score =   324 bits (831),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDIVKDLGAGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|NP_196476.1| serine/threonine-protein kinase SRK2G [Arabidopsis thaliana]
 sp|P43292.2|SRK2G_ARATH RecName: Full=Serine/threonine-protein kinase SRK2G; AltName: 
Full=Arabidopsis protein SK1; AltName: Full=OST1-kinase-like 
8; AltName: Full=SNF1-related kinase 2.1; Short=SnRK2.1 [Arabidopsis 
thaliana]
 dbj|BAB10008.1| serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|ABD85157.1| At5g08590 [Arabidopsis thaliana]
 gb|AED91326.1| serine/threonine-protein kinase SRK2G [Arabidopsis thaliana]
Length=353

 Score =   324 bits (831),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>gb|KDO49169.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=280

 Score =   322 bits (824),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_006288057.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
 gb|EOA20955.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
Length=354

 Score =   324 bits (831),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006412293.1| hypothetical protein EUTSA_v10025907mg [Eutrema salsugineum]
 gb|ESQ53746.1| hypothetical protein EUTSA_v10025907mg [Eutrema salsugineum]
Length=287

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K++ ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19    DRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  79    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  139   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  175

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  176   TVGTPAYIAPEVLLKKEYDG  195



>ref|XP_010109893.1| Serine/threonine-protein kinase SAPK10 [Morus notabilis]
 gb|EXC24862.1| Serine/threonine-protein kinase SAPK10 [Morus notabilis]
Length=374

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 178/202 (88%), Gaps = 14/202 (7%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++Y+LV+DIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYDLVRDIGSGNFGVARLMRDKQTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERIC+ GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICHAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPC--T*SSLLHSRP  1013
             RDLKLENTLLDGSPAP+LKICDFGYSKV            +  F+  C    SS+LHS+P
Sbjct  141   RDLKLENTLLDGSPAPQLKICDFGYSKV------------VTSFIPDCGNCQSSVLHSQP  188

Query  1014  KSTVGTPAYIAPEVLSRREYDG  1079
             KSTVGTPAYIAPEVL R+EYDG
Sbjct  189   KSTVGTPAYIAPEVLLRQEYDG  210



>ref|XP_006399366.1| hypothetical protein EUTSA_v10013967mg [Eutrema salsugineum]
 gb|ESQ40819.1| hypothetical protein EUTSA_v10013967mg [Eutrema salsugineum]
Length=353

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKY++VKD+G+GNFGVARL+R+K+T+ELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MEKYDVVKDLGTGNFGVARLLRHKDTRELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_010491506.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Camelina 
sativa]
Length=354

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KY++VKD+GSGNFGVARL+++K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYDVVKDLGSGNFGVARLLKHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_006283988.1| hypothetical protein CARUB_v10005110mg [Capsella rubella]
 gb|EOA16886.1| hypothetical protein CARUB_v10005110mg [Capsella rubella]
Length=362

 Score =   324 bits (831),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19    DRYELVKDIGSGNFGVARLMRDKQTNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  79    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  139   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  175

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  176   TVGTPAYIAPEVLLKKEYDG  195



>ref|XP_007042345.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007042347.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX98176.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX98178.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=363

 Score =   324 bits (831),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>gb|KDO49166.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
 gb|KDO49167.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=363

 Score =   324 bits (831),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_006423077.1| hypothetical protein CICLE_v10028703mg [Citrus clementina]
 gb|ESR36317.1| hypothetical protein CICLE_v10028703mg [Citrus clementina]
Length=330

 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVS+CHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSFCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_009774098.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
 ref|XP_009774100.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
 ref|XP_009774101.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
 ref|XP_009774102.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
Length=363

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIGSGNFGVARLMR+++T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGSGNFGVARLMRDRQTNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_006480145.1| PREDICTED: serine/threonine-protein kinase SRK2E-like [Citrus 
sinensis]
Length=363

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCHS+Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_002521837.1| Serine/threonine-protein kinase SAPK10, putative [Ricinus communis]
 gb|EEF40473.1| Serine/threonine-protein kinase SAPK10, putative [Ricinus communis]
Length=363

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELVKDIG+GNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVKDIGAGNFGVARLMRDKQTDELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_007042344.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX98175.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=370

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 173/200 (87%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  28    DRYELVRDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  87

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  88    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  147

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  148   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  184

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  185   TVGTPAYIAPEVLLKKEYDG  204



>ref|XP_009131093.1| PREDICTED: serine/threonine-protein kinase SRK2G [Brassica rapa]
Length=360

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 171/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYE+VKD+G+GNFGVARL+++KETKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1     MDKYEVVKDLGTGNFGVARLLKHKETKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEV+LTPTHLAIVMEYA+GGELF+RIC  GRFSE EARYFFQQLI GV YCHSLQIC
Sbjct  61    IRFKEVMLTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAP LKICDFGYSK                       SS+LHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPLLKICDFGYSK-----------------------SSILHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_009383517.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 170/201 (85%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             M+KYELV+D+G+GNFGVARL+R+K+TKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1     MDKYELVRDLGAGNFGVARLLRHKDTKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVVLT THL IVMEYAAGGELF+RI N GRFSEDEARYFFQQLI GVSYCH +QIC
Sbjct  61    IRFKEVVLTRTHLGIVMEYAAGGELFDRISNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



>ref|XP_004505181.1| PREDICTED: serine/threonine-protein kinase SRK2E-like [Cicer 
arietinum]
Length=363

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKQTDELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHTMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_008236629.1| PREDICTED: serine/threonine-protein kinase SRK2E [Prunus mume]
Length=362

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 172/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYELVRDIGSGNFGVARLMRDKQTDELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS+PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSQPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL ++EYDG
Sbjct  178   TVGTPAYIAPEVLLKKEYDG  197



>ref|XP_010028289.1| PREDICTED: serine/threonine-protein kinase SRK2I [Eucalyptus 
grandis]
 gb|KCW55004.1| hypothetical protein EUGRSUZ_I00977 [Eucalyptus grandis]
Length=363

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 171/200 (86%), Gaps = 23/200 (12%)
 Frame = +3

Query  480   EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNII  659
             ++Y+LV+DIGSGNFG+ARLMR+K T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21    DRYDLVRDIGSGNFGIARLMRDKVTQELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  660   RFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQICH  839
             RFKEV+LTPTHLAIVMEYA+GGELFERICN GRFSEDEAR+FFQQLISGVSYCH++Q+CH
Sbjct  81    RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  840   RDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPKS  1019
             RDLKLENTLLDGSPAPRLKICDFGYSK                       SS+LHS PKS
Sbjct  141   RDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSVLHSEPKS  177

Query  1020  TVGTPAYIAPEVLSRREYDG  1079
             TVGTPAYIAPEVL RREYDG
Sbjct  178   TVGTPAYIAPEVLQRREYDG  197



>gb|ACZ13319.1| serine threonine kinase SAPK-5 [Oryza sativa Indica Group]
Length=201

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 169/201 (84%), Gaps = 23/201 (11%)
 Frame = +3

Query  477   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  656
             MEKYE V++IG+GNFGVA+LMRNKET+ELVAMK+IERG +IDENV REI+NHRSLRHPNI
Sbjct  1     MEKYEPVREIGAGNFGVAKLMRNKETRELVAMKFIERGNRIDENVFREIVNHRSLRHPNI  60

Query  657   IRFKEVVLTPTHLAIVMEYAAGGELFERICNVGRFSEDEARYFFQQLISGVSYCHSLQIC  836
             IRFKEVV+T  HLAIVMEYAAGGELFERIC  GRF EDEARYFFQQL+ GVSYCH++QIC
Sbjct  61    IRFKEVVVTGRHLAIVMEYAAGGELFERICEAGRFHEDEARYFFQQLVCGVSYCHAMQIC  120

Query  837   HRDLKLENTLLDGSPAPRLKICDFGYSKVCILRGNI**KSWLLIFLYPCT*SSLLHSRPK  1016
             HRDLKLENTLLDGSPAPRLKICDFGYSK                       SSLLHSRPK
Sbjct  121   HRDLKLENTLLDGSPAPRLKICDFGYSK-----------------------SSLLHSRPK  157

Query  1017  STVGTPAYIAPEVLSRREYDG  1079
             STVGTPAYIAPEVLSRREYDG
Sbjct  158   STVGTPAYIAPEVLSRREYDG  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2815412562560