BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig156

Length=651
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001240863.1|  protein kinase APK1A, chloroplastic-like           214   2e-63   Glycine max [soybeans]
ref|NP_001234409.1|  protein kinase 1b                                  213   2e-63   
ref|XP_007150326.1|  hypothetical protein PHAVU_005G144200g             211   2e-62   Phaseolus vulgaris [French bean]
ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic     210   4e-62   
ref|XP_011035314.1|  PREDICTED: protein kinase APK1A, chloroplast...    210   5e-62   Populus euphratica
emb|CDP09060.1|  unnamed protein product                                209   7e-62   Coffea canephora [robusta coffee]
ref|XP_006424836.1|  hypothetical protein CICLE_v10028570mg             209   8e-62   Citrus clementina [clementine]
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...    209   9e-62   Nicotiana sylvestris
gb|KDO72843.1|  hypothetical protein CISIN_1g046897mg                   209   1e-61   Citrus sinensis [apfelsine]
ref|XP_004487006.1|  PREDICTED: protein kinase APK1B, chloroplast...    208   2e-61   Cicer arietinum [garbanzo]
ref|XP_011035309.1|  PREDICTED: protein kinase APK1A, chloroplast...    208   3e-61   Populus euphratica
ref|XP_002299870.1|  Protein kinase capable of phosphorylating ty...    207   5e-61   Populus trichocarpa [western balsam poplar]
ref|NP_001242670.1|  uncharacterized protein LOC100798404               207   6e-61   Glycine max [soybeans]
ref|XP_004487002.1|  PREDICTED: protein kinase APK1B, chloroplast...    208   6e-61   
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                     207   7e-61   Glycine soja [wild soybean]
ref|XP_007016405.1|  Kinase superfamily protein isoform 3               205   7e-61   
ref|XP_007016404.1|  Kinase superfamily protein isoform 2               204   2e-60   
ref|XP_007016403.1|  Kinase 1B isoform 1                                204   7e-60   
dbj|BAE71262.1|  putative protein kinase APK1A                          204   1e-59   Trifolium pratense [peavine clover]
gb|KCW88942.1|  hypothetical protein EUGRSUZ_A01268                     200   1e-59   Eucalyptus grandis [rose gum]
ref|XP_011042707.1|  PREDICTED: protein kinase APK1A, chloroplastic     203   2e-59   Populus euphratica
ref|XP_012092540.1|  PREDICTED: protein kinase APK1B, chloroplast...    202   4e-59   Jatropha curcas
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...    202   5e-59   Prunus mume [ume]
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg             202   6e-59   
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...    201   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...    201   1e-58   Eucalyptus grandis [rose gum]
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic     201   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic     201   2e-58   Nelumbo nucifera [Indian lotus]
emb|CBI16124.3|  unnamed protein product                                201   2e-58   Vitis vinifera
ref|XP_009124367.1|  PREDICTED: protein kinase APK1B, chloroplast...    201   3e-58   Brassica rapa
ref|XP_010487664.1|  PREDICTED: protein kinase APK1A, chloroplastic     200   3e-58   Camelina sativa [gold-of-pleasure]
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                     200   3e-58   Eucalyptus grandis [rose gum]
gb|KHG20116.1|  Protein kinase APK1B, chloroplastic -like protein       200   4e-58   Gossypium arboreum [tree cotton]
ref|XP_010106485.1|  Protein kinase APK1A                               199   5e-58   Morus notabilis
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic     200   6e-58   Vitis vinifera
ref|XP_007141880.1|  hypothetical protein PHAVU_008G233400g             198   2e-57   Phaseolus vulgaris [French bean]
ref|XP_004142761.1|  PREDICTED: probable serine/threonine-protein...    198   2e-57   Cucumis sativus [cucumbers]
ref|XP_011089469.1|  PREDICTED: protein kinase APK1B, chloroplastic     198   2e-57   Sesamum indicum [beniseed]
ref|XP_010457947.1|  PREDICTED: protein kinase APK1A, chloroplast...    198   3e-57   Camelina sativa [gold-of-pleasure]
dbj|BAC43185.1|  putative protein kinase                                192   3e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95754.1|  BnaC03g26350D                                          197   5e-57   
ref|XP_008458866.1|  PREDICTED: protein kinase APK1A, chloroplastic     197   5e-57   Cucumis melo [Oriental melon]
dbj|BAD12263.1|  protein kinase                                         197   6e-57   Brassica rapa
gb|KEH39440.1|  kinase 1B                                               196   8e-57   Medicago truncatula
ref|XP_003519344.1|  PREDICTED: protein kinase APK1A, chloroplast...    196   9e-57   Glycine max [soybeans]
ref|XP_010475518.1|  PREDICTED: protein kinase APK1A, chloroplast...    196   9e-57   Camelina sativa [gold-of-pleasure]
emb|CDX83305.1|  BnaA03g22010D                                          196   1e-56   
gb|ACU19261.1|  unknown                                                 196   1e-56   Glycine max [soybeans]
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplastic     196   1e-56   Fragaria vesca subsp. vesca
ref|XP_003544233.1|  PREDICTED: protein kinase APK1A, chloroplast...    196   1e-56   Glycine max [soybeans]
gb|KJB55870.1|  hypothetical protein B456_009G099000                    196   1e-56   Gossypium raimondii
ref|XP_010521843.1|  PREDICTED: protein kinase APK1A, chloroplast...    196   1e-56   Tarenaya hassleriana [spider flower]
emb|CDX77220.1|  BnaC04g40150D                                          196   1e-56   
ref|XP_012074945.1|  PREDICTED: probable serine/threonine-protein...    196   1e-56   Jatropha curcas
emb|CDY31741.1|  BnaA04g16770D                                          196   1e-56   Brassica napus [oilseed rape]
ref|XP_003616403.1|  Serine/threonine protein kinase                    196   1e-56   Medicago truncatula
ref|XP_010678048.1|  PREDICTED: probable serine/threonine-protein...    196   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001031440.1|  protein kinase APK1B                               196   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307674.1|  hypothetical protein CARUB_v10009302mg             195   2e-56   
gb|AGP76187.1|  MLPK                                                    196   3e-56   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010510562.1|  PREDICTED: protein kinase APK1B, chloroplast...    195   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010414461.1|  PREDICTED: protein kinase APK1B, chloroplast...    195   3e-56   Camelina sativa [gold-of-pleasure]
gb|KHG10966.1|  Protein kinase APK1B, chloroplastic -like protein       195   3e-56   Gossypium arboreum [tree cotton]
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...    195   3e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB55871.1|  hypothetical protein B456_009G099000                    196   3e-56   Gossypium raimondii
gb|KHF99777.1|  Protein kinase APK1B, chloroplastic -like protein       195   4e-56   Gossypium arboreum [tree cotton]
ref|XP_010510560.1|  PREDICTED: protein kinase APK1B, chloroplast...    195   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010414460.1|  PREDICTED: protein kinase APK1B, chloroplast...    195   4e-56   Camelina sativa [gold-of-pleasure]
gb|KJB83756.1|  hypothetical protein B456_013G263600                    194   5e-56   Gossypium raimondii
ref|XP_010554610.1|  PREDICTED: serine/threonine-protein kinase B...    194   6e-56   Tarenaya hassleriana [spider flower]
ref|XP_006294292.1|  hypothetical protein CARUB_v10023308mg             194   7e-56   Capsella rubella
ref|XP_006409926.1|  hypothetical protein EUTSA_v10016722mg             194   7e-56   Eutrema salsugineum [saltwater cress]
gb|KJB20070.1|  hypothetical protein B456_003G131600                    194   8e-56   Gossypium raimondii
ref|XP_010470020.1|  PREDICTED: protein kinase APK1B, chloroplast...    194   8e-56   Camelina sativa [gold-of-pleasure]
gb|AIU96237.1|  serine/threonine-protein kinase BIK1                    187   9e-56   Nicotiana benthamiana
ref|XP_010470019.1|  PREDICTED: protein kinase APK1B, chloroplast...    194   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009133856.1|  PREDICTED: protein kinase APK1B, chloroplast...    193   1e-55   Brassica rapa
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...    193   2e-55   Vitis vinifera
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic     193   2e-55   Sesamum indicum [beniseed]
ref|NP_001031439.1|  protein kinase APK1B                               193   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322956.2|  hypothetical protein POPTR_0016s11410g             193   2e-55   
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic     193   2e-55   
ref|XP_010678047.1|  PREDICTED: probable serine/threonine-protein...    192   3e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002533148.1|  Protein kinase APK1B, chloroplast precursor,...    192   3e-55   Ricinus communis
emb|CDY06715.1|  BnaA10g04940D                                          192   3e-55   
ref|XP_004236745.1|  PREDICTED: protein kinase APK1A, chloroplastic     192   3e-55   Solanum lycopersicum
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...    192   3e-55   Cucumis melo [Oriental melon]
ref|XP_009118950.1|  PREDICTED: protein kinase APK1A, chloroplast...    192   4e-55   Brassica rapa
emb|CDY09904.1|  BnaC08g45470D                                          192   4e-55   Brassica napus [oilseed rape]
ref|XP_011011764.1|  PREDICTED: protein kinase APK1B, chloroplast...    188   5e-55   Populus euphratica
gb|KJB36716.1|  hypothetical protein B456_006G172600                    188   6e-55   Gossypium raimondii
emb|CDX95143.1|  BnaC05g05280D                                          192   6e-55   
ref|XP_002892407.1|  hypothetical protein ARALYDRAFT_470784             191   7e-55   
ref|XP_009759469.1|  PREDICTED: protein kinase APK1A, chloroplast...    191   8e-55   Nicotiana sylvestris
ref|XP_011657150.1|  PREDICTED: protein kinase APK1A, chloroplastic     191   8e-55   Cucumis sativus [cucumbers]
ref|XP_009626085.1|  PREDICTED: protein kinase APK1A, chloroplastic     191   9e-55   Nicotiana tomentosiformis
ref|XP_010542648.1|  PREDICTED: protein kinase APK1A, chloroplast...    186   2e-54   Tarenaya hassleriana [spider flower]
gb|KJB76052.1|  hypothetical protein B456_012G070600                    189   2e-54   Gossypium raimondii
ref|NP_172237.1|  protein kinase APK1A                                  190   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36715.1|  hypothetical protein B456_006G172600                    189   3e-54   Gossypium raimondii
ref|XP_010557255.1|  PREDICTED: protein kinase APK1A, chloroplast...    190   3e-54   Tarenaya hassleriana [spider flower]
gb|ACG32116.1|  protein kinase APK1B                                    190   3e-54   Zea mays [maize]
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...    190   4e-54   Solanum tuberosum [potatoes]
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...    189   4e-54   Cicer arietinum [garbanzo]
gb|EYU41728.1|  hypothetical protein MIMGU_mgv1a007413mg                189   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_009118427.1|  PREDICTED: protein kinase APK1A, chloroplastic     189   4e-54   Brassica rapa
ref|XP_010557252.1|  PREDICTED: protein kinase APK1A, chloroplast...    190   5e-54   
gb|KHG05340.1|  Protein kinase APK1A, chloroplastic -like protein       189   5e-54   Gossypium arboreum [tree cotton]
gb|KJB76051.1|  hypothetical protein B456_012G070600                    189   6e-54   Gossypium raimondii
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...    189   6e-54   Pyrus x bretschneideri [bai li]
ref|XP_011011763.1|  PREDICTED: probable serine/threonine-protein...    188   9e-54   Populus euphratica
ref|XP_010543301.1|  PREDICTED: probable serine/threonine-protein...    188   9e-54   Tarenaya hassleriana [spider flower]
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...    189   1e-53   Solanum lycopersicum
ref|XP_009364395.1|  PREDICTED: protein kinase APK1A, chloroplast...    189   1e-53   Pyrus x bretschneideri [bai li]
ref|NP_001145874.1|  uncharacterized protein LOC100279389               188   1e-53   Zea mays [maize]
gb|ACF87678.1|  unknown                                                 188   1e-53   Zea mays [maize]
ref|XP_006365700.1|  PREDICTED: protein kinase APK1A, chloroplast...    187   2e-53   Solanum tuberosum [potatoes]
emb|CDP06608.1|  unnamed protein product                                187   2e-53   Coffea canephora [robusta coffee]
gb|AAF79545.1|AC022464_3  F22G5.5                                       189   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542646.1|  PREDICTED: protein kinase APK1A, chloroplast...    187   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...    188   2e-53   
ref|XP_004487004.1|  PREDICTED: protein kinase APK1B, chloroplast...    187   3e-53   
ref|XP_010557253.1|  PREDICTED: protein kinase APK1A, chloroplast...    187   3e-53   
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...    187   5e-53   
ref|XP_006417790.1|  hypothetical protein EUTSA_v10007756mg             187   6e-53   Eutrema salsugineum [saltwater cress]
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...    186   7e-53   Nicotiana sylvestris
ref|XP_009404596.1|  PREDICTED: protein kinase APK1A, chloroplast...    186   7e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK44181.1|  unknown                                                 186   8e-53   Lotus japonicus
ref|XP_010534501.1|  PREDICTED: serine/threonine-protein kinase B...    186   9e-53   Tarenaya hassleriana [spider flower]
gb|ACJ84452.1|  unknown                                                 182   1e-52   Medicago truncatula
ref|XP_010043547.1|  PREDICTED: protein kinase APK1A, chloroplast...    186   1e-52   Eucalyptus grandis [rose gum]
emb|CDP00097.1|  unnamed protein product                                185   1e-52   Coffea canephora [robusta coffee]
ref|XP_007009313.1|  Kinase superfamily protein isoform 2               184   1e-52   
gb|KJB20072.1|  hypothetical protein B456_003G131600                    185   1e-52   Gossypium raimondii
ref|XP_004981243.1|  PREDICTED: protein kinase APK1B, chloroplast...    186   1e-52   Setaria italica
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...    185   2e-52   Nicotiana sylvestris
ref|XP_009140954.1|  PREDICTED: protein kinase APK1B, chloroplastic     185   3e-52   Brassica rapa
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...    184   4e-52   Eucalyptus grandis [rose gum]
ref|XP_007009312.1|  Kinase superfamily protein isoform 1               184   5e-52   Theobroma cacao [chocolate]
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...    184   5e-52   Sesamum indicum [beniseed]
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...    184   6e-52   Phoenix dactylifera
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                   183   8e-52   Citrus sinensis [apfelsine]
gb|KEH34697.1|  tyrosine kinase family protein                          183   8e-52   Medicago truncatula
ref|XP_006846202.1|  PREDICTED: probable serine/threonine-protein...    183   9e-52   Amborella trichopoda
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...    183   1e-51   Nicotiana tomentosiformis
ref|XP_009143298.1|  PREDICTED: serine/threonine-protein kinase B...    182   1e-51   Brassica rapa
ref|XP_010922319.1|  PREDICTED: probable serine/threonine-protein...    183   1e-51   Elaeis guineensis
ref|XP_010558327.1|  PREDICTED: probable serine/threonine-protein...    182   1e-51   
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg             183   1e-51   Citrus clementina [clementine]
ref|XP_008240890.1|  PREDICTED: probable serine/threonine-protein...    182   1e-51   Prunus mume [ume]
gb|KEH34700.1|  tyrosine kinase family protein                          183   1e-51   Medicago truncatula
gb|KHN47889.1|  Protein kinase APK1B, chloroplastic                     182   2e-51   Glycine soja [wild soybean]
ref|XP_003522100.1|  PREDICTED: protein kinase APK1B, chloroplast...    182   2e-51   Glycine max [soybeans]
ref|XP_010920578.1|  PREDICTED: protein kinase APK1B, chloroplast...    182   2e-51   Elaeis guineensis
ref|XP_010531641.1|  PREDICTED: serine/threonine-protein kinase B...    181   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_007027015.1|  Kinase superfamily protein                         181   3e-51   
ref|XP_010030960.1|  PREDICTED: protein kinase APK1A, chloroplast...    182   4e-51   Eucalyptus grandis [rose gum]
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130          182   5e-51   Sorghum bicolor [broomcorn]
ref|XP_011091519.1|  PREDICTED: probable serine/threonine-protein...    181   5e-51   Sesamum indicum [beniseed]
ref|XP_009130691.1|  PREDICTED: probable serine/threonine-protein...    181   6e-51   Brassica rapa
emb|CDY55560.1|  BnaA03g54910D                                          181   6e-51   Brassica napus [oilseed rape]
ref|XP_010507635.1|  PREDICTED: serine/threonine-protein kinase B...    174   7e-51   
ref|NP_001274846.1|  protein kinase APK1B, chloroplastic-like           181   7e-51   Solanum tuberosum [potatoes]
ref|XP_003567536.1|  PREDICTED: probable serine/threonine-protein...    180   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_008784588.1|  PREDICTED: protein kinase APK1A, chloroplast...    181   1e-50   Phoenix dactylifera
gb|AAA18853.1|  protein kinase                                          180   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447952.1|  PREDICTED: probable serine/threonine-protein...    180   1e-50   Cucumis melo [Oriental melon]
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK          180   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15912.1|  Protein kinase APK1A, chloroplastic                     180   1e-50   Gossypium arboreum [tree cotton]
ref|XP_004142067.1|  PREDICTED: probable serine/threonine-protein...    180   1e-50   Cucumis sativus [cucumbers]
ref|XP_009124366.1|  PREDICTED: protein kinase APK1B, chloroplast...    181   1e-50   Brassica rapa
emb|CDX80814.1|  BnaC03g00680D                                          180   1e-50   
ref|XP_012089179.1|  PREDICTED: protein kinase APK1B, chloroplast...    180   1e-50   Jatropha curcas
ref|XP_010490647.1|  PREDICTED: probable serine/threonine-protein...    180   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009414323.1|  PREDICTED: probable serine/threonine-protein...    180   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011027201.1|  PREDICTED: protein kinase APK1A, chloroplastic     180   2e-50   Populus euphratica
gb|EYU18976.1|  hypothetical protein MIMGU_mgv1a007452mg                179   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_010470021.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   3e-50   
ref|XP_010111458.1|  putative serine/threonine-protein kinase NAK       179   3e-50   Morus notabilis
gb|KJB73944.1|  hypothetical protein B456_011G261900                    179   4e-50   Gossypium raimondii
ref|XP_010937617.1|  PREDICTED: protein kinase APK1A, chloroplast...    179   4e-50   Elaeis guineensis
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008             178   5e-50   
emb|CDY10453.1|  BnaCnng03540D                                          178   5e-50   Brassica napus [oilseed rape]
emb|CDY04848.1|  BnaAnng00300D                                          178   6e-50   
ref|XP_002316286.1|  hypothetical protein POPTR_0010s21090g             179   6e-50   Populus trichocarpa [western balsam poplar]
ref|XP_008810614.1|  PREDICTED: protein kinase APK1A, chloroplastic     179   6e-50   Phoenix dactylifera
emb|CDY20465.1|  BnaC04g05790D                                          178   6e-50   Brassica napus [oilseed rape]
emb|CDY48100.1|  BnaC02g03570D                                          178   7e-50   Brassica napus [oilseed rape]
ref|XP_009125442.1|  PREDICTED: probable serine/threonine-protein...    178   8e-50   Brassica rapa
ref|XP_011030315.1|  PREDICTED: protein kinase APK1A, chloroplast...    178   8e-50   Populus euphratica
ref|XP_007140532.1|  hypothetical protein PHAVU_008G120600g             178   8e-50   Phaseolus vulgaris [French bean]
ref|XP_010452061.1|  PREDICTED: probable serine/threonine-protein...    178   8e-50   Camelina sativa [gold-of-pleasure]
ref|NP_001288898.1|  protein kinase APK1B, chloroplastic-like           178   9e-50   Brassica rapa
ref|XP_009122790.1|  PREDICTED: probable serine/threonine-protein...    177   1e-49   Brassica rapa
emb|CDY40347.1|  BnaA10g27210D                                          177   1e-49   Brassica napus [oilseed rape]
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...    177   1e-49   
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...    177   1e-49   Solanum lycopersicum
ref|XP_002283701.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   1e-49   Vitis vinifera
ref|XP_009414410.1|  PREDICTED: probable serine/threonine-protein...    178   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002311169.2|  hypothetical protein POPTR_0008s05650g             177   1e-49   Populus trichocarpa [western balsam poplar]
ref|NP_180459.2|  protein kinase APK1B                                  178   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241128.1|  probable serine/threonine-protein kinase NAK...    177   2e-49   Glycine max [soybeans]
ref|XP_002879189.1|  hypothetical protein ARALYDRAFT_481810             178   2e-49   
ref|XP_004246420.1|  PREDICTED: probable serine/threonine-protein...    177   2e-49   Solanum lycopersicum
gb|EYU26593.1|  hypothetical protein MIMGU_mgv1a007265mg                177   2e-49   Erythranthe guttata [common monkey flower]
gb|EPS63220.1|  protein kinase 1b                                       176   2e-49   Genlisea aurea
ref|XP_010517317.1|  PREDICTED: serine/threonine-protein kinase BIK1    176   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010937616.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   3e-49   Elaeis guineensis
gb|AAO18450.1|  putative protein kinase                                 176   4e-49   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051730.1|  Os03g0821900                                       176   5e-49   
ref|XP_006650809.1|  PREDICTED: protein kinase APK1B, chloroplast...    176   5e-49   
ref|XP_010508995.1|  PREDICTED: serine/threonine-protein kinase B...    176   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010423878.1|  PREDICTED: probable serine/threonine-protein...    176   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006573305.1|  PREDICTED: protein kinase APK1B, chloroplast...    176   6e-49   Glycine max [soybeans]
ref|XP_009133858.1|  PREDICTED: protein kinase APK1B, chloroplast...    175   7e-49   Brassica rapa
ref|XP_006294362.1|  hypothetical protein CARUB_v10023379mg             175   8e-49   Capsella rubella
ref|XP_009414322.1|  PREDICTED: probable serine/threonine-protein...    176   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG15911.1|  Protein kinase APK1A, chloroplastic                     178   1e-48   Gossypium arboreum [tree cotton]
emb|CDY39519.1|  BnaC04g15180D                                          174   1e-48   Brassica napus [oilseed rape]
ref|NP_181496.1|  serine/threonine-protein kinase BIK1                  174   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141912.1|  uncharacterized LOC100274061                       175   1e-48   Zea mays [maize]
ref|XP_002879808.1|  botrytis-induced kinase1                           174   2e-48   
ref|XP_007133997.1|  hypothetical protein PHAVU_010G010300g             175   2e-48   Phaseolus vulgaris [French bean]
gb|KFK24748.1|  hypothetical protein AALP_AA8G019600                    174   2e-48   Arabis alpina [alpine rockcress]
ref|XP_009384873.1|  PREDICTED: protein kinase APK1A, chloroplast...    174   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001184929.1|  protein kinase APK1A                               174   3e-48   
ref|XP_008371735.1|  PREDICTED: probable serine/threonine-protein...    174   3e-48   Malus domestica [apple tree]
ref|XP_006379595.1|  hypothetical protein POPTR_0008s05650g             174   4e-48   
gb|EEC78387.1|  hypothetical protein OsI_18165                          173   4e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_010067409.1|  PREDICTED: probable serine/threonine-protein...    173   4e-48   Eucalyptus grandis [rose gum]
ref|XP_010558329.1|  PREDICTED: probable serine/threonine-protein...    172   5e-48   Tarenaya hassleriana [spider flower]
dbj|BAJ87345.1|  predicted protein                                      169   5e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010231839.1|  PREDICTED: protein kinase APK1B, chloroplast...    173   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_006398693.1|  hypothetical protein EUTSA_v10013737mg             173   6e-48   Eutrema salsugineum [saltwater cress]
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...    173   6e-48   
ref|XP_009384872.1|  PREDICTED: probable serine/threonine-protein...    173   7e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009357737.1|  PREDICTED: probable serine/threonine-protein...    173   7e-48   Pyrus x bretschneideri [bai li]
gb|KJB76054.1|  hypothetical protein B456_012G070600                    172   8e-48   Gossypium raimondii
gb|EMT08269.1|  Protein kinase APK1A, chloroplastic                     170   9e-48   
ref|XP_004307510.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   9e-48   Fragaria vesca subsp. vesca
ref|XP_010558326.1|  PREDICTED: probable serine/threonine-protein...    172   1e-47   Tarenaya hassleriana [spider flower]
gb|KJB76739.1|  hypothetical protein B456_012G104300                    169   1e-47   Gossypium raimondii
gb|EPS69141.1|  hypothetical protein M569_05623                         171   1e-47   Genlisea aurea
gb|KJB76738.1|  hypothetical protein B456_012G104300                    169   1e-47   Gossypium raimondii
dbj|BAJ95924.1|  predicted protein                                      172   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008369907.1|  PREDICTED: probable serine/threonine-protein...    173   2e-47   
ref|XP_008233629.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   2e-47   Prunus mume [ume]
ref|XP_006827147.1|  PREDICTED: protein kinase 2B, chloroplastic        172   3e-47   Amborella trichopoda
ref|NP_001054444.1|  Os05g0110900                                       171   3e-47   
ref|XP_006646742.1|  PREDICTED: protein kinase APK1A, chloroplast...    171   4e-47   
ref|XP_006654906.1|  PREDICTED: protein kinase APK1A, chloroplast...    171   4e-47   
ref|XP_004503146.1|  PREDICTED: protein kinase APK1A, chloroplast...    171   6e-47   Cicer arietinum [garbanzo]
gb|EEC72262.1|  hypothetical protein OsI_05407                          170   1e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001045548.1|  Os01g0973500                                       170   1e-46   
gb|EAZ15004.1|  hypothetical protein OsJ_04942                          170   1e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009341752.1|  PREDICTED: probable serine/threonine-protein...    169   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_007218038.1|  hypothetical protein PRUPE_ppa006035mg             170   1e-46   
gb|ABD39229.1|  protein kinase ABC1063                                  169   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007163407.1|  hypothetical protein PHAVU_001G232300g             169   2e-46   Phaseolus vulgaris [French bean]
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg             169   2e-46   
gb|KFK36852.1|  hypothetical protein AALP_AA4G180100                    168   3e-46   Arabis alpina [alpine rockcress]
gb|ABF18545.1|  serine/threonine kinase-like protein ABC1063            167   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20337.1|  Protein kinase APK1A, chloroplastic                     167   4e-46   
ref|XP_009384874.1|  PREDICTED: protein kinase APK1B, chloroplast...    168   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001241432.1|  probable serine/threonine-protein kinase NAK...    168   5e-46   Glycine max [soybeans]
gb|KFK34793.1|  hypothetical protein AALP_AA5G193900                    167   5e-46   Arabis alpina [alpine rockcress]
gb|AFK41166.1|  unknown                                                 168   5e-46   Medicago truncatula
ref|XP_004302742.1|  PREDICTED: probable serine/threonine-protein...    168   5e-46   Fragaria vesca subsp. vesca
ref|XP_006411192.1|  hypothetical protein EUTSA_v10016758mg             168   6e-46   Eutrema salsugineum [saltwater cress]
ref|XP_009419746.1|  PREDICTED: probable serine/threonine-protein...    168   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002440455.1|  hypothetical protein SORBIDRAFT_09g001190          168   7e-46   Sorghum bicolor [broomcorn]
ref|XP_003558236.1|  PREDICTED: protein kinase APK1B, chloroplast...    167   8e-46   Brachypodium distachyon [annual false brome]
ref|XP_010325852.1|  PREDICTED: probable serine/threonine-protein...    168   8e-46   Solanum lycopersicum
ref|XP_008387769.1|  PREDICTED: probable serine/threonine-protein...    167   8e-46   
gb|ABC74580.1|  rust resistance gene ABC1041                            168   9e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010690630.1|  PREDICTED: probable serine/threonine-protein...    167   9e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004492356.1|  PREDICTED: probable serine/threonine-protein...    167   9e-46   
ref|XP_008802716.1|  PREDICTED: protein kinase APK1B, chloroplast...    167   1e-45   Phoenix dactylifera
gb|ABF95246.1|  Protein kinase APK1B, chloroplast precursor, puta...    166   1e-45   Oryza sativa Japonica Group [Japonica rice]
gb|KJB16970.1|  hypothetical protein B456_002G257500                    164   1e-45   
ref|NP_001049704.1|  Os03g0274800                                       166   1e-45   
ref|XP_008343582.1|  PREDICTED: protein kinase APK1A, chloroplast...    166   2e-45   
ref|XP_009419747.1|  PREDICTED: probable serine/threonine-protein...    166   3e-45   
ref|XP_009133374.1|  PREDICTED: serine/threonine-protein kinase BIK1    166   3e-45   
ref|XP_008654993.1|  PREDICTED: LOC100283086 isoform X2                 166   3e-45   
ref|XP_008354131.1|  PREDICTED: protein kinase APK1A, chloroplast...    166   3e-45   
gb|KJB16969.1|  hypothetical protein B456_002G257500                    165   3e-45   
emb|CDY07643.1|  BnaA03g18680D                                          166   4e-45   
ref|XP_010452063.1|  PREDICTED: probable serine/threonine-protein...    165   4e-45   
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...    165   4e-45   
gb|EMS53821.1|  putative serine/threonine-protein kinase NAK            167   4e-45   
ref|XP_009380641.1|  PREDICTED: probable serine/threonine-protein...    166   4e-45   
emb|CDY45196.1|  BnaA06g34000D                                          166   5e-45   
gb|KDO82855.1|  hypothetical protein CISIN_1g014623mg                   166   5e-45   
ref|XP_006601720.1|  PREDICTED: protein kinase isoform X1               165   5e-45   
ref|NP_001151952.1|  LOC100285589                                       165   5e-45   
ref|XP_006438644.1|  hypothetical protein CICLE_v10031645mg             166   5e-45   
ref|XP_004490013.1|  PREDICTED: protein kinase 2B, chloroplastic-...    165   6e-45   
emb|CDY24954.1|  BnaC03g22180D                                          165   6e-45   
ref|XP_004505862.1|  PREDICTED: protein kinase APK1B, chloroplast...    165   9e-45   
emb|CDX93249.1|  BnaC04g46470D                                          164   9e-45   
gb|AFW83844.1|  putative protein kinase superfamily protein             164   9e-45   
ref|XP_009101235.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    166   1e-44   
ref|XP_010507637.1|  PREDICTED: serine/threonine-protein kinase B...    164   1e-44   
ref|XP_003517946.2|  PREDICTED: protein kinase 2B, chloroplastic-...    164   1e-44   
ref|XP_011025834.1|  PREDICTED: protein kinase 2B, chloroplastic-...    165   1e-44   
ref|XP_003519043.2|  PREDICTED: protein kinase 2B, chloroplastic-...    164   1e-44   
ref|XP_007157675.1|  hypothetical protein PHAVU_002G089100g             164   1e-44   
ref|XP_011025841.1|  PREDICTED: protein kinase 2B, chloroplastic-...    165   1e-44   
ref|XP_009129122.1|  PREDICTED: protein kinase 2B, chloroplastic ...    166   1e-44   
emb|CDY07022.1|  BnaA04g22930D                                          164   2e-44   
gb|KHN31764.1|  Protein kinase 2B, chloroplastic                        164   2e-44   
ref|XP_009141824.1|  PREDICTED: serine/threonine-protein kinase B...    163   2e-44   
ref|XP_004960525.1|  PREDICTED: protein kinase APK1A, chloroplast...    164   2e-44   
ref|XP_010268227.1|  PREDICTED: protein kinase 2B, chloroplastic-...    164   2e-44   
ref|XP_010111129.1|  Protein kinase APK1A                               166   2e-44   
ref|XP_002311595.1|  KINASE 2B family protein                           164   2e-44   
ref|XP_007208720.1|  hypothetical protein PRUPE_ppa015273mg             161   2e-44   
ref|XP_006602311.1|  PREDICTED: protein kinase 2B, chloroplastic-...    163   2e-44   
gb|KHN17927.1|  Protein kinase APK1B, chloroplastic                     162   2e-44   
ref|XP_006602310.1|  PREDICTED: protein kinase 2B, chloroplastic-...    164   2e-44   
ref|XP_006576543.1|  PREDICTED: protein kinase APK1B, chloroplast...    163   3e-44   
ref|XP_010523451.1|  PREDICTED: protein kinase 2B, chloroplastic-...    164   3e-44   
ref|XP_010554324.1|  PREDICTED: protein kinase 2B, chloroplastic-...    164   3e-44   
ref|XP_004505860.1|  PREDICTED: protein kinase APK1B, chloroplast...    164   3e-44   
ref|XP_006649840.1|  PREDICTED: protein kinase APK1B, chloroplast...    162   4e-44   
ref|XP_011071021.1|  PREDICTED: protein kinase 2B, chloroplastic-...    163   4e-44   
ref|NP_001235430.1|  protein kinase                                     162   4e-44   
gb|ACF83789.1|  unknown                                                 162   4e-44   
ref|XP_008457478.1|  PREDICTED: protein kinase APK1B, chloroplast...    163   4e-44   
ref|NP_001238650.1|  protein kinase                                     163   4e-44   
gb|EYU28722.1|  hypothetical protein MIMGU_mgv1a007163mg                163   5e-44   
ref|NP_001242718.1|  protein kinase APK1A, chloroplastic-like           163   5e-44   
ref|XP_010258573.1|  PREDICTED: protein kinase 2B, chloroplastic-...    163   6e-44   
ref|XP_008780759.1|  PREDICTED: protein kinase 2B, chloroplastic-...    163   6e-44   
ref|XP_006590337.1|  PREDICTED: uncharacterized protein LOC100809...    163   6e-44   
gb|EPS59398.1|  hypothetical protein M569_15409                         162   6e-44   
ref|XP_006291104.1|  hypothetical protein CARUB_v10017216mg             163   6e-44   
ref|XP_004142838.1|  PREDICTED: protein kinase APK1B, chloroplast...    161   7e-44   
ref|XP_004145296.1|  PREDICTED: protein kinase APK1B, chloroplast...    162   7e-44   
ref|XP_006403457.1|  hypothetical protein EUTSA_v10010443mg             162   8e-44   
ref|NP_001149460.1|  LOC100283086                                       162   8e-44   
gb|KHG05760.1|  Protein kinase 2B, chloroplastic -like protein          162   9e-44   
ref|XP_008654992.1|  PREDICTED: LOC100283086 isoform X1                 163   9e-44   
ref|XP_006291105.1|  hypothetical protein CARUB_v10017216mg             163   9e-44   
ref|XP_008221672.1|  PREDICTED: protein kinase 2B, chloroplastic-...    162   1e-43   
tpg|DAA50034.1|  TPA: putative protein kinase superfamily protein       158   1e-43   
ref|XP_010096366.1|  Protein kinase 2B                                  162   1e-43   
ref|XP_010227588.1|  PREDICTED: probable serine/threonine-protein...    163   1e-43   
emb|CDY67404.1|  BnaA02g36850D                                          162   1e-43   
emb|CDY41675.1|  BnaC02g34790D                                          162   1e-43   
gb|KJB80149.1|  hypothetical protein B456_013G083100                    162   1e-43   
emb|CDY03036.1|  BnaC07g21910D                                          162   1e-43   
gb|KHN21952.1|  Protein kinase APK1A, chloroplastic                     163   1e-43   
ref|XP_009129123.1|  PREDICTED: protein kinase 2B, chloroplastic ...    163   2e-43   
ref|XP_009129121.1|  PREDICTED: protein kinase 2B, chloroplastic ...    163   2e-43   
gb|AGU99598.1|  protein kinase                                          162   2e-43   
ref|XP_008221674.1|  PREDICTED: protein kinase 2B, chloroplastic-...    161   2e-43   
ref|XP_002465484.1|  hypothetical protein SORBIDRAFT_01g039630          160   2e-43   
gb|KDO69307.1|  hypothetical protein CISIN_1g015731mg                   158   2e-43   
ref|XP_002876829.1|  hypothetical protein ARALYDRAFT_484186             161   3e-43   
gb|AET14353.1|  protein kinase 1b                                       161   3e-43   
ref|XP_010258572.1|  PREDICTED: protein kinase 2B, chloroplastic-...    161   3e-43   
ref|XP_008339927.1|  PREDICTED: protein kinase 2B, chloroplastic-...    161   3e-43   
gb|KFK33463.1|  hypothetical protein AALP_AA5G016500                    162   3e-43   
ref|XP_010425051.1|  PREDICTED: protein kinase 2B, chloroplastic-...    161   4e-43   
ref|NP_178383.1|  protein kinase 2B                                     161   4e-43   
dbj|BAC42058.1|  putative protein kinase                                161   4e-43   
ref|XP_010502291.1|  PREDICTED: protein kinase 2B, chloroplastic        160   4e-43   
ref|XP_010514052.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   4e-43   
ref|XP_010652320.1|  PREDICTED: protein kinase 2B, chloroplastic ...    160   5e-43   
ref|XP_002277256.1|  PREDICTED: protein kinase 2B, chloroplastic ...    160   5e-43   
ref|XP_009592152.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   5e-43   
emb|CDP00299.1|  unnamed protein product                                160   5e-43   
ref|XP_012091915.1|  PREDICTED: protein kinase 2B, chloroplastic        160   5e-43   
gb|KJB50673.1|  hypothetical protein B456_008G182000                    160   5e-43   
ref|XP_010504400.1|  PREDICTED: probable receptor-like protein ki...    160   5e-43   
gb|EMS62888.1|  Protein kinase APK1A, chloroplastic                     162   5e-43   
ref|XP_002315799.1|  KINASE 2B family protein                           160   5e-43   
ref|XP_010427317.1|  PREDICTED: probable receptor-like protein ki...    160   5e-43   
ref|XP_006486482.1|  PREDICTED: protein kinase APK1B, chloroplast...    160   6e-43   
ref|XP_010427316.1|  PREDICTED: probable receptor-like protein ki...    159   6e-43   
ref|XP_010516114.1|  PREDICTED: probable receptor-like protein ki...    159   6e-43   
ref|XP_010504399.1|  PREDICTED: probable receptor-like protein ki...    159   6e-43   
ref|XP_006435539.1|  hypothetical protein CICLE_v10031723mg             160   6e-43   
ref|XP_010234717.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   6e-43   
ref|XP_010527880.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   6e-43   
gb|ACJ84335.1|  unknown                                                 160   7e-43   
ref|XP_003613630.1|  Protein kinase 2B                                  160   7e-43   
ref|XP_007046178.1|  Kinase 2B isoform 1                                160   7e-43   
ref|XP_003573903.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   7e-43   
emb|CDY41231.1|  BnaC08g26270D                                          159   8e-43   
ref|XP_009116239.1|  PREDICTED: probable receptor-like protein ki...    159   8e-43   
ref|XP_009116240.1|  PREDICTED: probable receptor-like protein ki...    159   8e-43   
gb|KEH30162.1|  kinase 1B                                               160   8e-43   
ref|XP_007153823.1|  hypothetical protein PHAVU_003G067900g             159   8e-43   
emb|CDY40221.1|  BnaA09g35030D                                          159   8e-43   
gb|ACJ84784.1|  unknown                                                 157   9e-43   
gb|KJB80150.1|  hypothetical protein B456_013G083100                    159   9e-43   
emb|CDY02940.1|  BnaC04g25460D                                          158   9e-43   
ref|XP_006395757.1|  hypothetical protein EUTSA_v10004126mg             160   1e-42   
gb|EMS68595.1|  Protein kinase APK1A, chloroplastic                     160   1e-42   
ref|XP_007132065.1|  hypothetical protein PHAVU_011G064000g             159   1e-42   
ref|XP_011086380.1|  PREDICTED: protein kinase 2B, chloroplastic        159   1e-42   
ref|XP_010044713.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   1e-42   
ref|XP_008221673.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   1e-42   
gb|EMT32058.1|  Protein kinase APK1A, chloroplastic                     159   1e-42   
ref|XP_002893367.1|  hypothetical protein ARALYDRAFT_472702             159   1e-42   
ref|NP_001183697.1|  uncharacterized LOC100502290                       159   2e-42   
ref|XP_009769692.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   2e-42   
ref|XP_004238776.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   2e-42   
ref|XP_004228391.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   2e-42   
ref|XP_002314178.2|  Protein kinase capable of phosphorylating ty...    158   2e-42   
ref|XP_009389571.1|  PREDICTED: protein kinase 2A, chloroplastic-...    158   3e-42   
gb|KEH30163.1|  kinase 1B                                               158   3e-42   
ref|XP_009389572.1|  PREDICTED: protein kinase 2A, chloroplastic-...    158   3e-42   
gb|AAT40481.1|  putative protein kinase                                 158   3e-42   
gb|AAT39953.2|  Protein kinase APK1B, chloroplast precursor, puta...    158   3e-42   
ref|XP_004984728.1|  PREDICTED: protein kinase APK1B, chloroplast...    157   3e-42   
gb|KEH30161.1|  kinase 1B                                               159   3e-42   
ref|XP_006363247.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   3e-42   
gb|KEH30160.1|  kinase 1B                                               159   3e-42   
gb|AAO29965.1|  serine/threonine-specific protein kinase -like          157   3e-42   
ref|XP_006363926.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   3e-42   
ref|NP_191105.2|  PBS1-like 1 kinase                                    157   4e-42   
ref|XP_007222585.1|  hypothetical protein PRUPE_ppa006262mg             158   4e-42   
gb|EPS58949.1|  hypothetical protein M569_15863                         156   4e-42   
ref|XP_010476493.1|  PREDICTED: protein kinase 2A, chloroplastic-...    154   4e-42   
ref|XP_009412594.1|  PREDICTED: probable serine/threonine-protein...    158   4e-42   
ref|XP_010917006.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   4e-42   
ref|XP_010229119.1|  PREDICTED: protein kinase 2B, chloroplastic        158   4e-42   
emb|CAB75903.1|  serine/threonine-specific protein kinase-like          157   5e-42   
ref|XP_009360375.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   5e-42   
ref|XP_008663158.1|  PREDICTED: protein kinase 2B, chloroplastic-...    150   5e-42   
ref|NP_001190097.1|  PBS1-like 1 kinase                                 158   6e-42   
emb|CDX76093.1|  BnaA04g03570D                                          156   6e-42   
ref|NP_001149364.1|  protein kinase APK1A                               156   9e-42   
gb|ACF79269.1|  unknown                                                 156   1e-41   
ref|XP_010044714.1|  PREDICTED: protein kinase 2B, chloroplastic-...    156   1e-41   
ref|NP_174019.2|  putative protein kinase                               157   1e-41   
ref|XP_008458874.1|  PREDICTED: protein kinase APK1B, chloroplast...    155   1e-41   
ref|XP_004983145.1|  PREDICTED: protein kinase 2B, chloroplastic-...    157   1e-41   
gb|AAF79849.1|AC000348_2  T7N9.2                                        157   1e-41   
ref|XP_002520117.1|  Protein kinase APK1A, chloroplast precursor,...    156   2e-41   
ref|XP_008677038.1|  PREDICTED: protein kinase APK1A isoform X1         156   2e-41   
gb|KHG12048.1|  Protein kinase 2B, chloroplastic -like protein          156   2e-41   
ref|XP_010037161.1|  PREDICTED: protein kinase 2B, chloroplastic-...    156   2e-41   
ref|XP_006649471.1|  PREDICTED: protein kinase 2B, chloroplastic-...    156   2e-41   
ref|XP_004985548.1|  PREDICTED: protein kinase 2B, chloroplastic-...    156   3e-41   
ref|XP_010458935.1|  PREDICTED: protein kinase 2A, chloroplastic-...    156   3e-41   
ref|XP_010496035.1|  PREDICTED: protein kinase 2A, chloroplastic        156   3e-41   
ref|XP_010926227.1|  PREDICTED: protein kinase 2B, chloroplastic-...    156   3e-41   
gb|KEH39442.1|  kinase 1B                                               154   3e-41   
ref|XP_010320662.1|  PREDICTED: probable receptor-like protein ki...    157   3e-41   
ref|XP_008653698.1|  PREDICTED: protein kinase 2B, chloroplastic-...    150   3e-41   
ref|XP_006357263.1|  PREDICTED: probable receptor-like protein ki...    156   4e-41   
emb|CDY53554.1|  BnaA09g57130D                                          155   4e-41   
emb|CDX81634.1|  BnaC08g39670D                                          155   5e-41   
gb|ABF94203.1|  serine/threonine-protein kinase NAK, putative, ex...    155   5e-41   
ref|XP_002520138.1|  Protein kinase APK1B, chloroplast precursor,...    156   6e-41   
ref|XP_004238768.1|  PREDICTED: probable receptor-like protein ki...    156   6e-41   
gb|AAL84315.1|AC073556_32  putative protein tyrosine-serine-threo...    155   6e-41   
ref|XP_010552590.1|  PREDICTED: protein kinase 2B, chloroplastic        154   7e-41   
gb|EEC74601.1|  hypothetical protein OsI_10191                          155   7e-41   
ref|XP_006307552.1|  hypothetical protein CARUB_v10009175mg             155   7e-41   
ref|XP_008457480.1|  PREDICTED: protein kinase APK1B, chloroplast...    154   7e-41   
ref|XP_009587494.1|  PREDICTED: probable receptor-like protein ki...    155   7e-41   
ref|XP_011086394.1|  PREDICTED: probable receptor-like protein ki...    155   8e-41   
ref|XP_011021613.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   8e-41   
ref|XP_008389509.1|  PREDICTED: protein kinase 2B, chloroplastic        154   8e-41   
ref|XP_010476492.1|  PREDICTED: protein kinase 2A, chloroplastic-...    155   8e-41   
ref|XP_009117905.1|  PREDICTED: protein kinase 2A, chloroplastic        155   8e-41   
ref|XP_009797575.1|  PREDICTED: probable receptor-like protein ki...    155   9e-41   
ref|XP_009762807.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   9e-41   
ref|XP_002465785.1|  hypothetical protein SORBIDRAFT_01g045780          155   9e-41   
gb|ACF81963.1|  unknown                                                 154   9e-41   
ref|NP_001147807.1|  serine/threonine-protein kinase NAK                155   1e-40   
ref|XP_002876303.1|  hypothetical protein ARALYDRAFT_485972             154   1e-40   
ref|NP_001130876.1|  LOC100191980                                       154   1e-40   
ref|XP_009590721.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   1e-40   
gb|KEH34692.1|  kinase 1B                                               151   1e-40   
dbj|BAK02513.1|  predicted protein                                      154   1e-40   
ref|XP_010683239.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   1e-40   
ref|XP_008811563.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   1e-40   
gb|ABK24429.1|  unknown                                                 154   2e-40   
ref|XP_012091941.1|  PREDICTED: probable receptor-like protein ki...    155   2e-40   
ref|XP_004297338.1|  PREDICTED: probable receptor-like protein ki...    155   2e-40   
ref|XP_002467271.1|  hypothetical protein SORBIDRAFT_01g022400          154   2e-40   
ref|XP_011021612.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   2e-40   
ref|XP_002890052.1|  hypothetical protein ARALYDRAFT_471608             153   2e-40   
ref|XP_009627248.1|  PREDICTED: probable receptor-like protein ki...    154   3e-40   
gb|EMT28025.1|  Putative serine/threonine-protein kinase NAK            154   3e-40   
gb|EMS64110.1|  Protein kinase 2B, chloroplastic                        154   3e-40   
dbj|BAC57958.1|  serine/threonine protein kinase                        153   3e-40   
emb|CDY46426.1|  BnaA08g20040D                                          153   3e-40   
gb|KGN64246.1|  hypothetical protein Csa_1G045440                       149   3e-40   
ref|XP_006390970.1|  hypothetical protein EUTSA_v10018676mg             152   3e-40   
ref|XP_006842103.1|  PREDICTED: probable receptor-like protein ki...    154   3e-40   
ref|XP_009110056.1|  PREDICTED: protein kinase 2B, chloroplastic        152   4e-40   
ref|NP_172889.1|  protein kinase 2A                                     153   4e-40   



>ref|NP_001240863.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 ref|XP_006593429.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|ACM89549.1| putative protein kinase [Glycine max]
 gb|KHN30169.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=419

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLK  390
            MG+CLS +IKAESP   + +   +STDG+ LG ++ K   NS PQTP+SEGEILQS NLK
Sbjct  1    MGVCLSAQIKAESPFNTVFNSKYVSTDGNDLGSTNDKVSANSVPQTPRSEGEILQSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SFT ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G+Q
Sbjct  61   SFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGIQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ SHP+LV+LIG+C
Sbjct  121  GHREWLAEVNYLGQLSHPHLVRLIGFC  147



>ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum]
 gb|ACD77110.1| protein kinase 1b [Solanum lycopersicum]
Length=401

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGICLS RIKAESP H GL+S+ V S DG   G S+S +  P T +SEGEILQSPNLKSF
Sbjct  1    MGICLSARIKAESPFHTGLNSRSV-SIDG---GDSNSSSRVPSTTRSEGEILQSPNLKSF  56

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F+DLK ATR+FR DSVLGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G QGH
Sbjct  57   SFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGH  116

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQFSHP+LVKLIGYC
Sbjct  117  REWLAEVNYLGQFSHPHLVKLIGYC  141



>ref|XP_007150326.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
 gb|ESW22320.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
Length=422

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 125/148 (84%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  387
            MG+CLS +IKAESP+  GL+SK   STDG+ LG ++ K   NS PQTP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPYNTGLNSK-YGSTDGNYLGSTNDKVSGNSVPQTPRSEGEILQSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSFT ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G+
Sbjct  60   KSFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGI  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ SHP+LV+LIG+C
Sbjct  120  QGHREWLAEVNYLGQLSHPHLVRLIGFC  147



>ref|XP_009590400.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590401.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590402.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=404

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGICLS RIKAESP H GL+S+   STDG     S   ++ P  P+SEGEILQS NLKSF
Sbjct  1    MGICLSARIKAESPFHTGLNSRSA-STDGYDSNPSSRVSTVPLAPRSEGEILQSANLKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F+DLK ATR+FR DSVLGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G QGH
Sbjct  60   SFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQFSHP+LVKLIGYC
Sbjct  120  REWLAEVNYLGQFSHPHLVKLIGYC  144



>ref|XP_011035314.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Populus euphratica]
Length=405

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 120/148 (81%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  387
            MGICLS +IKAES  + GLSSK V STDGS L  + SK    S P TP+SEGEILQS NL
Sbjct  1    MGICLSAQIKAESSCNTGLSSKYV-STDGSDLSSTGSKVLSVSVPPTPRSEGEILQSTNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQAGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQF HP+LVKLIGYC
Sbjct  120  QGHKEWLAEVNYLGQFYHPHLVKLIGYC  147



>emb|CDP09060.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 122/148 (82%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MGICLS RIKAESP H GL+SK V STDG+ L  S  K S    P  P+SEGEILQSPNL
Sbjct  1    MGICLSARIKAESPYHTGLTSKNV-STDGNSLKSSSGKVSSGSVPPPPRSEGEILQSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFAATKPGTGVVIAVKRLNLEGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQF HP+LVKLIGYC
Sbjct  120  QGHREWLAEVNYLGQFCHPHLVKLIGYC  147



>ref|XP_006424836.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006424837.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006488335.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Citrus sinensis]
 gb|ESR38076.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 gb|ESR38077.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
Length=404

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 122/148 (82%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MGICLS RIKAESP + G+SSK V S+DG+ +  + SK S    P TP+SEGEIL+SPNL
Sbjct  1    MGICLSARIKAESPFNTGVSSKYV-SSDGNDMSSTGSKVSSLSVPPTPRSEGEILRSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F+DLK ATR+FR DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHSFAATKPGTGMVIAVKRLNQDGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  QGHKEWLAEVNYLGQLYHPNLVKLIGYC  147



>ref|XP_009774717.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009774718.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=404

 Score =   209 bits (533),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGICLS RIKAESP H GL+S+ V STDG     S   ++ P  P+SEGEILQS NLKSF
Sbjct  1    MGICLSARIKAESPFHTGLNSRSV-STDGYDSNPSSRVSTVPPAPRSEGEILQSANLKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F++L+ ATR+FR DSVLGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G QGH
Sbjct  60   SFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQFSHP+LVKLIGYC
Sbjct  120  REWLAEVNYLGQFSHPHLVKLIGYC  144



>gb|KDO72843.1| hypothetical protein CISIN_1g046897mg [Citrus sinensis]
Length=404

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 122/148 (82%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MGICLS RIKAESP + G+SSK V S+DG+ +  + SK S    P TP+SEGEIL+SPNL
Sbjct  1    MGICLSARIKAESPFNTGVSSKYV-SSDGNDMSSTGSKVSSLSVPPTPRSEGEILRSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F+DLK ATR+FR DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHSFAATKPGTGMVIAVKRLNQDGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  120  QGHKEWLAEVNYLGQLYHPNLVKLVGYC  147



>ref|XP_004487006.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X5 
[Cicer arietinum]
Length=411

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNL  387
            MG+CLS +IKAESP+  GL+SK    I  D S    S DS  S PQTP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPYNTGLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNL  60

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G 
Sbjct  61   KSYTLAELKAATRNFRPDSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDGC  120

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQFSHP+LV+LIGYC
Sbjct  121  QGHREWLAEVNYLGQFSHPHLVRLIGYC  148



>ref|XP_011035309.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035310.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035311.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035312.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
Length=407

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 119/150 (79%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAES---PHPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSP  381
            MGICLS +IKAES      GLSSK V STDGS L  + SK    S P TP+SEGEILQS 
Sbjct  1    MGICLSAQIKAESSCNTVAGLSSKYV-STDGSDLSSTGSKVLSVSVPPTPRSEGEILQST  59

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NLKSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  
Sbjct  60   NLKSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQA  119

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQF HP+LVKLIGYC
Sbjct  120  GFQGHKEWLAEVNYLGQFYHPHLVKLIGYC  149



>ref|XP_002299870.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE84675.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=405

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  387
            MGICLS +IKAES  + GLSSK V STDG+ L  + SK    S P TP+SEGEILQS NL
Sbjct  1    MGICLSAQIKAESSCNTGLSSKYV-STDGNDLSSTGSKVLSVSVPPTPRSEGEILQSTNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F+DLKMATR FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFSDLKMATRSFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQDGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQF HP+LVKLIGYC
Sbjct  120  QGHKEWLAEVNYLGQFYHPHLVKLIGYC  147



>ref|NP_001242670.1| uncharacterized protein LOC100798404 [Glycine max]
 gb|ACU24124.1| unknown [Glycine max]
Length=422

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 123/148 (83%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  387
            MG+CLS +IKAESP+  G +SK V STDG+  G ++ K   NS PQTP+SEGEIL+S NL
Sbjct  1    MGVCLSAQIKAESPYNTGFNSKYV-STDGNDFGSTNDKVSANSIPQTPRSEGEILRSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF  ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G+
Sbjct  60   KSFPLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGI  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ SHP+LV+LIG+C
Sbjct  120  QGHREWLAEVNYLGQLSHPHLVRLIGFC  147



>ref|XP_004487002.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004487003.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNL  387
            MG+CLS +IKAESP+  GL+SK    I  D S    S DS  S PQTP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPYNTGLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNL  60

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G 
Sbjct  61   KSYTLAELKAATRNFRPDSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDGC  120

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQFSHP+LV+LIGYC
Sbjct  121  QGHREWLAEVNYLGQFSHPHLVRLIGYC  148



>gb|KHN33381.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=422

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 123/148 (83%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  387
            MG+CLS +IKAESP+  G +SK V STDG+  G ++ K   NS PQTP+SE EIL+S NL
Sbjct  1    MGVCLSAQIKAESPYNTGFNSKYV-STDGNDFGSTNDKVSANSIPQTPRSEVEILRSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSFT ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G+
Sbjct  60   KSFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGI  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ SHP+LV+LIG+C
Sbjct  120  QGHREWLAEVNYLGQLSHPHLVRLIGFC  147



>ref|XP_007016405.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY34024.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
Length=337

 Score =   205 bits (522),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 120/149 (81%), Gaps = 5/149 (3%)
 Frame = +1

Query  217  MMGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPN  384
            +MGICLS RIKAESP   GLSSK V S DG  +  + SK S    P TP+SEGEIL SPN
Sbjct  12   LMGICLSARIKAESPSSTGLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPN  70

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            LKSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G
Sbjct  71   LKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDG  130

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             QGH EWLAE+NYLGQ  HP+LVKLIGYC
Sbjct  131  FQGHKEWLAEVNYLGQLYHPHLVKLIGYC  159



>ref|XP_007016404.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY34023.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
Length=325

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MGICLS RIKAESP   GLSSK V S DG  +  + SK S    P TP+SEGEIL SPNL
Sbjct  1    MGICLSARIKAESPSSTGLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HP+LVKLIGYC
Sbjct  120  QGHKEWLAEVNYLGQLYHPHLVKLIGYC  147



>ref|XP_007016403.1| Kinase 1B isoform 1 [Theobroma cacao]
 gb|EOY34022.1| Kinase 1B isoform 1 [Theobroma cacao]
Length=405

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MGICLS RIKAESP   GLSSK V S DG  +  + SK S    P TP+SEGEIL SPNL
Sbjct  1    MGICLSARIKAESPSSTGLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HP+LVKLIGYC
Sbjct  120  QGHKEWLAEVNYLGQLYHPHLVKLIGYC  147



>dbj|BAE71262.1| putative protein kinase APK1A [Trifolium pratense]
Length=409

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 121/148 (82%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  387
            MG+CLS +IKAESP+  GL+SK   S  G+ L  ++SK    S PQTP+SEGEIL+S N+
Sbjct  1    MGVCLSAQIKAESPYNTGLNSKNSNSA-GNDLSSTNSKVSTGSVPQTPRSEGEILKSTNV  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+NSL+P KPGTG+VIAVKRLN    
Sbjct  60   KSYTLAELKSATRNFRPDSVLGEGGFGSVFKGWIDENSLAPAKPGTGIVIAVKRLNQESF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQFSHP+LV+LIGYC
Sbjct  120  QGHREWLAEVNYLGQFSHPHLVRLIGYC  147



>gb|KCW88942.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=291

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG+C S RIKAE+P + G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F
Sbjct  1    MGVCWSNRIKAETPTNTGVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F++L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QGH
Sbjct  60   SFSELRTATRNFRPDSVLGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  120  REWLAEINYLGQLHHPNLVKLIGFC  144



>ref|XP_011042707.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=405

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 120/148 (81%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MGICLS +IKAESP   GLSSK V STDG+ L  + SK S    P TP+SEGEILQS NL
Sbjct  1    MGICLSAQIKAESPCSTGLSSKNV-STDGTDLSSTSSKVSSLSVPPTPRSEGEILQSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQAGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQF HP+LVKLIGYC
Sbjct  120  QGHKEWLAEVNYLGQFYHPHLVKLIGYC  147



>ref|XP_012092540.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Jatropha 
curcas]
 gb|KDP20446.1| hypothetical protein JCGZ_05291 [Jatropha curcas]
Length=404

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 4/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG+CLS +IKAESP + GLSSK V +   D S   K  S + PP TP+SEGEILQS NLK
Sbjct  1    MGVCLSAQIKAESPFNTGLSSKYVSTDVNDRSTSSKVSSASMPP-TPRSEGEILQSSNLK  59

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+VIAVKRLN  GLQ
Sbjct  60   SFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFAAAKPGTGMVIAVKRLNQEGLQ  119

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQF HP+LVKLIGYC
Sbjct  120  GHKEWLAEVNYLGQFCHPHLVKLIGYC  146



>ref|XP_008223637.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
 ref|XP_008223643.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=414

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGS-GLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG+CLS RIKAESP + G++SK ++STDG+       S  S P TP+SEGEILQS NLKS
Sbjct  1    MGVCLSARIKAESPCNTGVNSK-IVSTDGNLSTSSKVSSFSAPPTPRSEGEILQSSNLKS  59

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F DLKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN    QG
Sbjct  60   FSFNDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESFQG  119

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQF HPNLVKLIG+C
Sbjct  120  HREWLAEVNYLGQFHHPNLVKLIGFC  145



>ref|XP_007205264.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
 gb|EMJ06463.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
Length=414

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGS-GLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG+CLS RIKAESP + G++SK ++STDG+       S  S P TP+SEGEILQS NLKS
Sbjct  1    MGVCLSARIKAESPCNTGVNSK-IVSTDGNLSTSSKVSSFSAPPTPRSEGEILQSSNLKS  59

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F DLKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN    QG
Sbjct  60   FSFNDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESFQG  119

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQF HPNLVKLIG+C
Sbjct  120  HREWLAEVNYLGQFHHPNLVKLIGFC  145



>ref|XP_010685751.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK-NSPPQTPKSEGEILQSPNLKS  393
            MGICLS RIKAESP H G++SK V S DG+      SK +S P TP+SEGEILQS NLK+
Sbjct  1    MGICLSARIKAESPSHTGINSKYV-SKDGNDPTFPSSKVSSAPLTPRSEGEILQSSNLKN  59

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F++LK ATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN    QG
Sbjct  60   FSFSELKAATRNFRPDSVLGEGGFGSVFKGWIDENSYAATKPGTGMVIAVKRLNQESYQG  119

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HP+LVKL+GYC
Sbjct  120  HREWLAEVNYLGQLYHPHLVKLVGYC  145



>ref|XP_010047703.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Eucalyptus grandis]
 gb|KCW88941.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=407

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG+C S RIKAE+P + G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F
Sbjct  1    MGVCWSNRIKAETPTNTGVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F++L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QGH
Sbjct  60   SFSELRTATRNFRPDSVLGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  120  REWLAEINYLGQLHHPNLVKLIGFC  144



>ref|XP_010256925.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
 ref|XP_010256926.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=415

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG C S RIKAESP H G++SKCV S DG+ +  S S+ S    P TP+  GEI+ S NL
Sbjct  1    MGACWSARIKAESPFHTGVNSKCV-SKDGNDVSGSSSRASATSVPLTPRGAGEIIPSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F++LKMATR+FR DSVLGEGGFG VFKGWID+N+L+  KPGTG++IAVKRLN  G 
Sbjct  60   KSFSFSELKMATRNFRPDSVLGEGGFGSVFKGWIDENALTAAKPGTGMIIAVKRLNQEGY  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  QGHREWLAEVNYLGQLYHPNLVKLIGYC  147



>ref|XP_010264446.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=413

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVI--STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG C S RIKAESP H G++SK V     D SG     S  S PQTP+SEGEIL S NLK
Sbjct  1    MGACWSARIKAESPFHTGVNSKYVSKDENDVSGASSKVSAASVPQTPRSEGEILLSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+F +LKMATR+FR DSVLGEGGFG VFKGWID+++ +  KPGTG+VIAVKRLN  G Q
Sbjct  61   SFSFNELKMATRNFRPDSVLGEGGFGSVFKGWIDEHAFTAAKPGTGIVIAVKRLNQEGFQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  GHKEWLAEVNYLGQLYHPNLVKLIGYC  147



>emb|CBI16124.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 118/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  387
            MG+CLS RIKAESP H G SSK V STDG+    + SK    S P TP+SEG+ILQSPNL
Sbjct  1    MGVCLSARIKAESPCHTGGSSKYV-STDGNEQNSTSSKVSVASVPPTPRSEGDILQSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            K+FTF++LKMATR+FR DSVLGEGGFG VFKGWID+ S +  +PGTG+VIAVKRLN    
Sbjct  60   KNFTFSELKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFAAARPGTGMVIAVKRLNLESF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HP+LVKLIG+C
Sbjct  120  QGHKEWLAEVNYLGQLYHPHLVKLIGFC  147



>ref|XP_009124367.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 ref|XP_009124368.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 ref|XP_009124369.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 emb|CDY47885.1| BnaA07g14300D [Brassica napus]
Length=413

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAESP + G+SSK + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGVSSKYMSSEANDSQSMGSKCSSASIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+  +LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   SFSLDELKSATRNFRQDSVLGEGGFGCVFKGWIDEQSLAASKPGTGMVIAVKRLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  121  GHQEWLAEVNYLGQFSHPNLVKLIGYC  147



>ref|XP_010487664.1| PREDICTED: protein kinase APK1A, chloroplastic [Camelina sativa]
Length=413

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS ++KAESP  G SSK V S   D   LG   S  S   TP++EGEILQSPNLKS
Sbjct  1    MGICLSAQVKAESP--GTSSKYVSSDVKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QG
Sbjct  59   FSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  119  HQEWLAEVNYLGQFSHRHLVKLIGYC  144



>gb|KCW88940.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=408

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPH--PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG+C S RIKAE+P    G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+
Sbjct  1    MGVCWSNRIKAETPTNTAGVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKN  59

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F++L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QG
Sbjct  60   FSFSELRTATRNFRPDSVLGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQG  119

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  120  HREWLAEINYLGQLHHPNLVKLIGFC  145



>gb|KHG20116.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=404

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS RI     + GLSSK V S   D S      S  S P TP+SEGEILQSPNLKS
Sbjct  1    MGICLSARINESPSNTGLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLKS  60

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+FADLKMATR+FR DSVLGEGGFG VFK WID+NSL+ +KPGTG VIAVKRLN  G QG
Sbjct  61   FSFADLKMATRNFRPDSVLGEGGFGSVFKAWIDENSLAASKPGTGTVIAVKRLNQEGFQG  120

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HP+LVKLIGYC
Sbjct  121  HREWLAEVNYLGQLYHPHLVKLIGYC  146



>ref|XP_010106485.1| Protein kinase APK1A [Morus notabilis]
 gb|EXC10661.1| Protein kinase APK1A [Morus notabilis]
Length=402

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 116/146 (79%), Gaps = 5/146 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGS--GLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS +IKAES   GL+SK V STDG+        S  S P TP+SEGEILQS NLKS
Sbjct  1    MGICLSAQIKAESQ--GLNSKYV-STDGNLSSTSSKVSSVSVPPTPRSEGEILQSSNLKS  57

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F FADL+MATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN  G QG
Sbjct  58   FCFADLRMATRNFRPDSVLGEGGFGSVFKGWIDENSFAATKPGTGMVIAVKRLNQDGFQG  117

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HP+LVKLIGYC
Sbjct  118  HKEWLAEVNYLGQLYHPHLVKLIGYC  143



>ref|XP_002283646.2| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
 ref|XP_010651014.1| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
Length=442

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 118/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  387
            MG+CLS RIKAESP H G SSK V STDG+    + SK    S P TP+SEG+ILQSPNL
Sbjct  1    MGVCLSARIKAESPCHTGGSSKYV-STDGNEQNSTSSKVSVASVPPTPRSEGDILQSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            K+FTF++LKMATR+FR DSVLGEGGFG VFKGWID+ S +  +PGTG+VIAVKRLN    
Sbjct  60   KNFTFSELKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFAAARPGTGMVIAVKRLNLESF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HP+LVKLIG+C
Sbjct  120  QGHKEWLAEVNYLGQLYHPHLVKLIGFC  147



>ref|XP_007141880.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
 gb|ESW13874.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
Length=400

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLS +IKAESP   GLSSK   +T+  GL    S  S P TP++EGEIL+S N+KSF
Sbjct  1    MGCCLSAKIKAESPPRNGLSSKDG-NTEEDGLSGKISTPSVPPTPRTEGEILKSSNMKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            TF +LK+ATR+FR DSV+GEGGFG VFKGWID+ SL+P +PGTGLVIAVKRLN  GLQGH
Sbjct  60   TFGELKIATRNFRPDSVVGEGGFGCVFKGWIDEQSLAPVRPGTGLVIAVKRLNQEGLQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
            SEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  120  SEWLTEINYLGQLHHPNLVKLIGYC  144



>ref|XP_004142761.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
sativus]
 gb|KGN51318.1| hypothetical protein Csa_5G517160 [Cucumis sativus]
Length=401

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 117/147 (80%), Gaps = 5/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNS--PPQTPKSEGEILQSPNLK  390
            MG CLS RIKAESP H GLSS+   + DG+  G S SK+S   P+TP++EGEILQS NLK
Sbjct  1    MGSCLSARIKAESPLHNGLSSR--YARDGNDKGNSTSKSSVSTPRTPRTEGEILQSSNLK  58

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            +F++ +LK ATR+FR DSVLGEGGFG VFKGWID+ S + TKPGTGLVIAVKRLN  G Q
Sbjct  59   NFSYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQ  118

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWL E++YLGQ  HPNLV+LIG+C
Sbjct  119  GHREWLTEIDYLGQLHHPNLVRLIGFC  145



>ref|XP_011089469.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
 ref|XP_011089470.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
Length=406

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 118/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  387
            MGIC S RIKA++P H G++S+ V S+DG  +    SK    S P TP++EGEILQS NL
Sbjct  1    MGICFSARIKADTPAHTGVNSQYV-SSDGYDMSLGSSKISSTSVPPTPRTEGEILQSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F+DLK+ATR+FR DSVLG GGFG VFKGWID+NS +  KPGTG++IAVK+L+    
Sbjct  60   KSFSFSDLKVATRNFRPDSVLGGGGFGSVFKGWIDENSFTAAKPGTGMIIAVKKLHQESY  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  120  QGHREWLAEVNYLGQFSHPNLVKLIGYC  147



>ref|XP_010457947.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS ++KAE P  G SSK V S   D   LG   S  S   TP++EGEILQSPNLKS
Sbjct  1    MGICLSAQVKAEIP--GTSSKYVSSDVKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QG
Sbjct  59   FSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  119  HQEWLAEVNYLGQFSHRHLVKLIGYC  144



>dbj|BAC43185.1| putative protein kinase [Arabidopsis thaliana]
Length=215

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS +IKA SP  G S K + S     LG   S  S    P++EGEILQSPNLKSFT
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSFT  58

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QGH 
Sbjct  59   FAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGHQ  118

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  119  EWLAEVNYLGQFSHPNLVKLIGYC  142



>emb|CDX95754.1| BnaC03g26350D [Brassica napus]
Length=404

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
             F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   CFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNKEGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  121  GHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>ref|XP_008458866.1| PREDICTED: protein kinase APK1A, chloroplastic [Cucumis melo]
Length=401

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 5/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNS--PPQTPKSEGEILQSPNLK  390
            MG CLS RIKAESP H GLSSK   + DG+  G S SK+S   P+TP++EGEILQS NLK
Sbjct  1    MGSCLSARIKAESPLHNGLSSK--YARDGNDKGNSTSKSSVSTPRTPRTEGEILQSSNLK  58

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            +F + +LK ATR+FR DSVLGEGGFG VFKGWID+ S + TKPGTGLVIAVK+LN  G Q
Sbjct  59   NFAYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKKLNQEGFQ  118

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWL E++YLGQ  HPNLV+LIG+C
Sbjct  119  GHREWLTEIDYLGQLHHPNLVRLIGFC  145



>dbj|BAD12263.1| protein kinase [Brassica rapa]
Length=404

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGIC+SV++KAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICMSVQVKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
             F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   CFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  121  GHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>gb|KEH39440.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG+CLS +IKAESP + G +SK   S  G+ L  ++SK S    P TP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPFNTGFNSKNSNSA-GNDLSSTNSKVSAASVPPTPRSEGEILQSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+N+L   KPGTG+VIAVKRLN    
Sbjct  60   KSYTLAELKSATRNFRPDSVLGEGGFGSVFKGWIDENTLVAAKPGTGIVIAVKRLNQESF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQFSHP+LV+LIGYC
Sbjct  120  QGHREWLAEVNYLGQFSHPHLVRLIGYC  147



>ref|XP_003519344.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform 1 
[Glycine max]
 gb|KHN41092.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=392

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLS RIKAESP   GLSSK   + +  GL    S  S P TP++EGEIL+S N+KSF
Sbjct  1    MGCCLSARIKAESPPRNGLSSKDG-NKEEDGLSSKASTPSVPPTPRTEGEILKSSNMKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F++LK ATR+FR DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  GLQGH
Sbjct  60   NFSELKTATRNFRPDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEGLQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
            SEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  120  SEWLTEINYLGQLRHPNLVKLIGYC  144



>ref|XP_010475518.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
 ref|XP_010475519.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG+CLS ++KAESP  G SSK   S   D   LG   S  S   TP++EGEILQSPNLKS
Sbjct  1    MGMCLSAQVKAESP--GTSSKYASSDGKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+FA+L+ ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QG
Sbjct  59   FSFAELRSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  119  HQEWLAEVNYLGQFSHRHLVKLIGYC  144



>emb|CDX83305.1| BnaA03g22010D [Brassica napus]
Length=404

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
             F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   CFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  121  GHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>gb|ACU19261.1| unknown [Glycine max]
Length=392

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLS RIKAESP   GLSSK   + +  GL    S  S P TP++EGEIL+S N+KSF
Sbjct  1    MGCCLSARIKAESPPRNGLSSKDG-NKEEDGLSSKASTPSVPPTPRTEGEILKSSNMKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F++LK ATR+FR DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  GLQGH
Sbjct  60   NFSELKTATRNFRPDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEGLQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
            SEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  120  SEWLTEINYLGQLRHPNLVKLIGYC  144



>ref|XP_004294513.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011461211.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 115/144 (80%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG+C S +IKAESP     SK V S DGS   K  S ++PP TP++EGEILQS NL+SF+
Sbjct  1    MGVCWSAQIKAESP-LNTGSKFV-SNDGSTSSKVSSFSAPP-TPRTEGEILQSTNLRSFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FADLK+ATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN    QGH 
Sbjct  58   FADLKLATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESFQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  118  EWLAEVNYLGQFHHPNLVKLIGYC  141



>ref|XP_003544233.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Glycine 
max]
 gb|KHN20929.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=399

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLS RIKAESP   GLSSK   + +  GL    S  S P TP++EGEIL+S N+KSF
Sbjct  1    MGCCLSARIKAESPPRNGLSSKDG-NKEEDGLSSKVSTPSDPPTPRTEGEILKSSNMKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F++LK ATR+FR DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  GLQGH
Sbjct  60   NFSELKTATRNFRPDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEGLQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
            SEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  120  SEWLTEINYLGQLRHPNLVKLIGYC  144



>gb|KJB55870.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55872.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=404

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS RI     + GLSSK V S   D S      S  S P TP+SEGEILQSPNLK 
Sbjct  1    MGICLSARINESPSNTGLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLKC  60

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+FADLKMATR+FR DSVLGEGGFG VFK WID+NSL+  KPGTG VIAVKRLN  G QG
Sbjct  61   FSFADLKMATRNFRPDSVLGEGGFGSVFKAWIDENSLAAAKPGTGTVIAVKRLNQEGFQG  120

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HP++VKLIGYC
Sbjct  121  HREWLAEVNYLGQLYHPHIVKLIGYC  146



>ref|XP_010521843.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010521844.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
Length=414

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 6/147 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGS---GLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG+CLS ++KAE  +PG S K  +S+DG+    LG   S  S   TP++EGEILQSPNLK
Sbjct  1    MGVCLSAQVKAE--NPGASPKH-LSSDGNDTGSLGSKASSMSVRPTPRTEGEILQSPNLK  57

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+F++LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG VIAVKRLN  G Q
Sbjct  58   SFSFSELKTATRNFRPDSVLGEGGFGCVFKGWIDEQTLTATKPGTGTVIAVKRLNQDGWQ  117

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQFSHP+LVKLIGYC
Sbjct  118  GHKEWLAEVNYLGQFSHPHLVKLIGYC  144



>emb|CDX77220.1| BnaC04g40150D [Brassica napus]
Length=418

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+FA++K ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   SFSFAEVKSATRNFRPDSVLGEGGFGCVFKGWIDEQSLTASKPGTGMVIAVKRLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  121  GHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>ref|XP_012074945.1| PREDICTED: probable serine/threonine-protein kinase NAK [Jatropha 
curcas]
 gb|KDP35639.1| hypothetical protein JCGZ_09077 [Jatropha curcas]
Length=392

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 118/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG+CLS RIKA +P + GL+SK   S DG  L    SK S    PQTP+SEGEILQSPNL
Sbjct  1    MGLCLSNRIKAYTPSNTGLNSKSA-SRDGKNLSSVSSKVSSASIPQTPRSEGEILQSPNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            K+F+F++L+ +TR+FR DSVLGEGGFG VFKGWID++SLS TKP +G+VIAVKRLN  G 
Sbjct  60   KNFSFSELRTSTRNFRPDSVLGEGGFGSVFKGWIDEHSLSATKPDSGMVIAVKRLNQEGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  QGHKEWLAEINYLGQLEHPNLVKLIGYC  147



>emb|CDY31741.1| BnaA04g16770D [Brassica napus]
Length=418

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+FA++K ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   SFSFAEVKSATRNFRPDSVLGEGGFGCVFKGWIDEQSLTASKPGTGMVIAVKRLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  121  GHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>ref|XP_003616403.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES99361.1| kinase 1B [Medicago truncatula]
Length=418

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 113/148 (76%), Gaps = 4/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTD----GSGLGKSDSKNSPPQTPKSEGEILQSPNL  387
            MG CLS RIKAESP    SS    S +    G   GK  +  + P TP++EGEIL+S N+
Sbjct  1    MGCCLSARIKAESPPRNGSSSKDRSRETGLSGRSSGKVSTAPTAPPTPRTEGEILKSSNM  60

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSFTF++LK ATR+FR DSV+GEGGFG VFKGWID+N+L P +PGTG+VIAVKRLN  GL
Sbjct  61   KSFTFSELKTATRNFRPDSVVGEGGFGAVFKGWIDENTLVPVRPGTGVVIAVKRLNQEGL  120

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGHSEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  121  QGHSEWLTEINYLGQLHHPNLVKLIGYC  148



>ref|XP_010678048.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKS  393
            MG C S RIKAESP H G +S+   S DG     S  S  S PQTP+SEGEILQS NLK+
Sbjct  1    MGACWSKRIKAESPLHTGYNSRTG-SKDGKDWSNSKLSSASTPQTPRSEGEILQSSNLKN  59

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F +LK ATR+FR DSVLGEGGFG VFKGWID+++L+PT+PGTG+VIAVKRLN  G QG
Sbjct  60   FSFNELKTATRNFRPDSVLGEGGFGAVFKGWIDEHALTPTRPGTGIVIAVKRLNQEGPQG  119

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWL E+NYLGQ  HPNLV+LIGYC
Sbjct  120  HKEWLTEINYLGQLRHPNLVRLIGYC  145



>ref|NP_001031440.1| protein kinase APK1B [Arabidopsis thaliana]
 gb|AEC08191.1| protein kinase APK1B [Arabidopsis thaliana]
Length=415

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGICLS +IKA SP  PG S K + S     LG   S  S    P++EGEILQSPNLKSF
Sbjct  1    MGICLSAQIKAVSPGKPGASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSF  60

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            TFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QGH
Sbjct  61   TFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGH  120

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  121  QEWLAEVNYLGQFSHPNLVKLIGYC  145



>ref|XP_006307674.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 ref|XP_006307675.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40572.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40573.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
Length=410

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 114/144 (79%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS ++KAESP  G S K      GS LG   S  S   TP++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESP--GTSPKYDAKDTGS-LGSKASSVSVRPTPRTEGEILQSPNLKSFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH 
Sbjct  58   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQ  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  118  EWLAEVNYLGQFSHGHLVKLIGYC  141



>gb|AGP76187.1| MLPK [Brassica rapa subsp. chinensis]
Length=418

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGIC+S +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICMSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+FA++K ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   SFSFAEVKSATRNFRPDSVLGEGGFGCVFKGWIDEQSLTASKPGTGMVIAVKRLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  121  GHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>ref|XP_010510562.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Camelina 
sativa]
Length=414

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G QG
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGY  648
            H EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  119  HQEWLAEVNYLGQFSHPNLVKLIGY  143



>ref|XP_010414461.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G QG
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGY  648
            H EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  119  HQEWLAEVNYLGQFSHPNLVKLIGY  143



>gb|KHG10966.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=418

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 115/150 (77%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKSDSKNS-----PPQTPKSEGEILQSP  381
            MG CLS  IKAES  + GLSSK   S DG  +    S +       P TP+SEGEILQSP
Sbjct  12   MGNCLSAGIKAESHSNTGLSSK-YDSGDGKDISSESSNSKVSSFSAPLTPRSEGEILQSP  70

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NLKSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NS + TKPG+G+VIAVKRLN  
Sbjct  71   NLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTATKPGSGIVIAVKRLNQD  130

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+N+LGQ  HPNLVKLIGYC
Sbjct  131  GFQGHKEWLAEVNFLGQLYHPNLVKLIGYC  160



>ref|XP_010685750.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=404

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 117/156 (75%), Gaps = 14/156 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCV----------ISTDGSGLGKSDSK-NSPPQTPKSEG  363
            MGICLS RIKAESP H G  S CV          +S DG+      SK +S P TP+SEG
Sbjct  1    MGICLSARIKAESPSHTG--SNCVLACLGINSKYVSKDGNDPTFPSSKVSSAPLTPRSEG  58

Query  364  EILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAV  543
            EILQS NLK+F+F++LK ATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAV
Sbjct  59   EILQSSNLKNFSFSELKAATRNFRPDSVLGEGGFGSVFKGWIDENSYAATKPGTGMVIAV  118

Query  544  KRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            KRLN    QGH EWLAE+NYLGQ  HP+LVKL+GYC
Sbjct  119  KRLNQESYQGHREWLAEVNYLGQLYHPHLVKLVGYC  154



>gb|KJB55871.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55873.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=475

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = +1

Query  217  MMGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            +MGICLS RI     + GLSSK V S   D S      S  S P TP+SEGEILQSPNLK
Sbjct  71   LMGICLSARINESPSNTGLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLK  130

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
             F+FADLKMATR+FR DSVLGEGGFG VFK WID+NSL+  KPGTG VIAVKRLN  G Q
Sbjct  131  CFSFADLKMATRNFRPDSVLGEGGFGSVFKAWIDENSLAAAKPGTGTVIAVKRLNQEGFQ  190

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HP++VKLIGYC
Sbjct  191  GHREWLAEVNYLGQLYHPHIVKLIGYC  217



>gb|KHF99777.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=402

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 111/145 (77%), Gaps = 5/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGICLS RIKAESP+  GLSS  V            S  S P TP+SEGEILQ  NLKSF
Sbjct  1    MGICLSARIKAESPNNTGLSSNYV----SGDTSSKVSSVSVPLTPRSEGEILQCTNLKSF  56

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +FA+LK ATR+FR DSVLGEGGFG VFKGWID+NS + +KPGTG+VIAVKRLN  G QGH
Sbjct  57   SFANLKTATRNFRPDSVLGEGGFGSVFKGWIDENSFNASKPGTGIVIAVKRLNQEGFQGH  116

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  117  KEWLAEVNYLGQLYHPNLVKLIGYC  141



>ref|XP_010510560.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X1 [Camelina 
sativa]
Length=417

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKA SP   G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAVSPGKQGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G Q
Sbjct  61   SFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGY  648
            GH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  121  GHQEWLAEVNYLGQFSHPNLVKLIGY  146



>ref|XP_010414460.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKA SP   G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAVSPGKQGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G Q
Sbjct  61   SFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGY  648
            GH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  121  GHQEWLAEVNYLGQFSHPNLVKLIGY  146



>gb|KJB83756.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
 gb|KJB83757.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
Length=402

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 111/145 (77%), Gaps = 5/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGICLS RIKAESP+  GLSS  V            S  S P TP++EGEILQ  NLKSF
Sbjct  1    MGICLSARIKAESPNNTGLSSNYV----SGDTSSRVSSVSVPLTPRTEGEILQCTNLKSF  56

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +FA+LK ATR+FR DSVLGEGGFG VFKGWID+NS + +KPGTG+VIAVKRLN  G QGH
Sbjct  57   SFANLKTATRNFRPDSVLGEGGFGSVFKGWIDENSFNASKPGTGIVIAVKRLNQEGFQGH  116

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  117  KEWLAEVNYLGQLYHPNLVKLIGYC  141



>ref|XP_010554610.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=397

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTP-KSEGEILQSPNLKSF  396
            MG CLS RIKAESP    ++    S+D  GL  S  K+S      K+EGEILQS ++KSF
Sbjct  1    MGSCLSSRIKAESPPRNGANSSGKSSDLYGLSLSSQKSSMTTVSHKTEGEILQSASVKSF  60

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            TF +LK+ATR+FR DSV+GEGGFG VFKGWID+N+L+PTKPGTGLVIAVKRLN  GLQGH
Sbjct  61   TFNELKLATRNFRPDSVVGEGGFGSVFKGWIDENTLTPTKPGTGLVIAVKRLNQEGLQGH  120

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWL E+NYLGQ +HPNLVKLIGYC
Sbjct  121  REWLTEINYLGQLNHPNLVKLIGYC  145



>ref|XP_006294292.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
 gb|EOA27190.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
Length=414

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QG
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGY  648
            H EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  119  HQEWLAEVNYLGQFSHPNLVKLIGY  143



>ref|XP_006409926.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
 gb|ESQ51379.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
Length=417

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKSSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+FA+LK+ATR+FR DSVLGEGGFG VFKGWID+ SLS +KPGTG+VIAVKRLN  G Q
Sbjct  61   SFSFAELKLATRNFRPDSVLGEGGFGCVFKGWIDEQSLSASKPGTGMVIAVKRLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQFSHP+LVKLIGYC
Sbjct  121  GHQEWLAEVNYLGQFSHPHLVKLIGYC  147



>gb|KJB20070.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
 gb|KJB20071.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=418

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 115/150 (77%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKSDSKNS-----PPQTPKSEGEILQSP  381
            +G CLS  IKAES  + GLSSK   S DG  +    S +       P TP+SEGEILQSP
Sbjct  12   IGNCLSAGIKAESHSNTGLSSK-YDSGDGKDVSSESSNSKVSSFSAPLTPRSEGEILQSP  70

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NLKSF+FADLKMATR+FR DSVLGEGGFG VFKGW+D+NS + TKPG+G+VIAVKRLN  
Sbjct  71   NLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWVDENSFTATKPGSGIVIAVKRLNQD  130

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  131  GFQGHKEWLAEVNYLGQLYHPNLVKLIGYC  160



>ref|XP_010470020.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG+CLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGLCLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G QG
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGY  648
            H EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  119  HQEWLAEVNYLGQFSHPNLVKLIGY  143



>gb|AIU96237.1| serine/threonine-protein kinase BIK1, partial [Nicotiana benthamiana]
Length=196

 Score =   187 bits (476),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 110/145 (76%), Gaps = 8/145 (6%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C+SVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NL SF
Sbjct  1    MGSCISVRIKAESPLHAG-------ASDGRDLSSRLSYSSAPLTPRSQNEILESTNLNSF  53

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+++    +PGTGLVIAVKRLN  G QGH
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDEHTFKSARPGTGLVIAVKRLNQEGFQGH  113

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLG  SHPNLVKLIGYC
Sbjct  114  KEWLAEINYLGSLSHPNLVKLIGYC  138



>ref|XP_010470019.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG+CLS +IKA SP   G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGLCLSAQIKAVSPGKQGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G Q
Sbjct  61   SFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGY  648
            GH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  121  GHQEWLAEVNYLGQFSHPNLVKLIGY  146



>ref|XP_009133856.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Brassica rapa]
 ref|XP_009133857.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Brassica rapa]
Length=404

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGIC+SV++KAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICMSVQVKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
             F+FA+LK ATR+FRL SVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G Q
Sbjct  61   CFSFAELKAATRNFRLYSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  121  GHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>ref|XP_002266032.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654281.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654282.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 emb|CBI30550.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 116/148 (78%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG C S RIKAESP H G SSK V S D + L +S SK S    PQTP++EGEILQ+ NL
Sbjct  1    MGACCSNRIKAESPVHTGASSKNV-SKDENDLSRSSSKFSSTSIPQTPRTEGEILQASNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL  T+PG G+V+AVKRLN  G 
Sbjct  60   KSFGFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENSLMATRPGAGMVVAVKRLNQEGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  QGHREWLAEINYLGQLQHPNLVKLIGYC  147



>ref|XP_011094865.1| PREDICTED: protein kinase APK1A, chloroplastic [Sesamum indicum]
Length=414

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 119/150 (79%), Gaps = 6/150 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  381
            MGICLS +IKAESP     G++S  ++S DG+ L  S SK S    P TP++EGEILQS 
Sbjct  1    MGICLSNQIKAESPFHTGTGVNSSKMVSGDGTELSNSVSKASSASVPPTPRTEGEILQSS  60

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NLKSFTF+DLK ATR+FR DSVLGEGGFG VFKGWID++SL+ ++PG+ +V+AVKRLN  
Sbjct  61   NLKSFTFSDLKAATRNFRPDSVLGEGGFGSVFKGWIDESSLAASRPGSSMVVAVKRLNQE  120

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  GWQGHKEWLAEINYLGQLRHPNLVKLIGYC  150



>ref|NP_001031439.1| protein kinase APK1B [Arabidopsis thaliana]
 sp|P46573.2|APK1B_ARATH RecName: Full=Protein kinase APK1B, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC33221.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15075.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC08190.1| protein kinase APK1B [Arabidopsis thaliana]
Length=412

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS +IKA SP  G S K + S     LG   S  S    P++EGEILQSPNLKSFT
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSFT  58

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QGH 
Sbjct  59   FAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGHQ  118

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  119  EWLAEVNYLGQFSHPNLVKLIGYC  142



>ref|XP_002322956.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
 gb|EEF04717.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
Length=428

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 118/154 (77%), Gaps = 13/154 (8%)
 Frame = +1

Query  214  LMMGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEI  369
            ++MG+C S RIK+ +  + GLSSKC     GS  GK+        S  S PQTP+SEGEI
Sbjct  28   VLMGLCWSNRIKSYTCSNTGLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEI  82

Query  370  LQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKR  549
            LQS NLK FTF +LK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIAVKR
Sbjct  83   LQSSNLKIFTFGELKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIAVKR  142

Query  550  LNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LN  G QGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  143  LNQEGFQGHREWLAEINYLGQFQHPNLVKLIGYC  176



>ref|XP_008357182.1| PREDICTED: protein kinase APK1A, chloroplastic [Malus domestica]
Length=418

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 111/146 (76%), Gaps = 5/146 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDG--SGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG+CLS RIKAESP    +     S DG  S   K  S  +PP TP+SEGEILQS NLKS
Sbjct  1    MGVCLSARIKAESP--ANTGSNFKSNDGNLSASSKVSSYTAPP-TPRSEGEILQSSNLKS  57

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F +LKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN    QG
Sbjct  58   FSFNNLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESYQG  117

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  118  HREWLAEVNYLGQLYHPNLVKLIGFC  143



>ref|XP_010678047.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKS  393
            MG C S RIKAESP H    +    S DG     S  S  S PQTP+SEGEILQS NLK+
Sbjct  1    MGACWSKRIKAESPLHTAGYNSRTGSKDGKDWSNSKLSSASTPQTPRSEGEILQSSNLKN  60

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F +LK ATR+FR DSVLGEGGFG VFKGWID+++L+PT+PGTG+VIAVKRLN  G QG
Sbjct  61   FSFNELKTATRNFRPDSVLGEGGFGAVFKGWIDEHALTPTRPGTGIVIAVKRLNQEGPQG  120

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWL E+NYLGQ  HPNLV+LIGYC
Sbjct  121  HKEWLTEINYLGQLRHPNLVRLIGYC  146



>ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF29229.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=410

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 111/145 (77%), Gaps = 4/145 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C SVRIKAESP H G   +   +    G   S S ++ P TP++EGEILQS NLKSF
Sbjct  1    MGSCFSVRIKAESPLHHGADPR---NRSKGGHDVSGSSSAVPSTPRTEGEILQSSNLKSF  57

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRLN  G QGH
Sbjct  58   SFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLNQEGFQGH  117

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  QEWLAEINYLGQLDHPNLVKLIGYC  142



>emb|CDY06715.1| BnaA10g04940D [Brassica napus]
Length=408

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG CLS ++KAESP  G S K     D   LG   S  S   TP+SEGEILQSPNLKSF+
Sbjct  1    MGACLSAQVKAESP--GASPKF---KDTGSLGSKGSSVSVRPTPRSEGEILQSPNLKSFS  55

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH 
Sbjct  56   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQ  115

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  116  EWLAEVNYLGQFSHGHLVKLIGYC  139



>ref|XP_004236745.1| PREDICTED: protein kinase APK1A, chloroplastic [Solanum lycopersicum]
Length=394

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 110/145 (76%), Gaps = 8/145 (6%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLSVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NLKSF
Sbjct  1    MGSCLSVRIKAESPLHHG-------ASDGRELSSRHSYSSAPLTPRSQSEILESSNLKSF  53

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+N+    +PGTGLVIAVKRLN  G QGH
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDENTFKAARPGTGLVIAVKRLNQEGFQGH  113

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+ YL Q SHPNLVKLIGYC
Sbjct  114  KEWLAEITYLSQLSHPNLVKLIGYC  138



>ref|XP_008464124.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Cucumis melo]
Length=404

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAE-SPHPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  387
            MG+CLS RIKAE S + G++S  V STDG+ +G ++SK    S P TP++EGEILQS NL
Sbjct  1    MGVCLSTRIKAENSCNTGVNSNAV-STDGNDIGSTNSKINLLSMPPTPRTEGEILQSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F +LK ATR+FR DSV+GEGGFG VFKGWID++S +  KPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFTELKAATRNFRPDSVVGEGGFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+N+LGQ SH +LV+L+GYC
Sbjct  120  QGHREWLAEVNFLGQLSHCHLVRLVGYC  147



>ref|XP_009118950.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Brassica 
rapa]
Length=408

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG CLS ++KAESP  G S K     D   LG   S  S   TP+SEGEILQSPNLKSF+
Sbjct  1    MGACLSAQVKAESP--GASPKF---KDTGSLGSKGSSVSVRPTPRSEGEILQSPNLKSFS  55

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH 
Sbjct  56   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQ  115

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  116  EWLAEVNYLGQFSHGHLVKLIGYC  139



>emb|CDY09904.1| BnaC08g45470D [Brassica napus]
Length=406

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 113/144 (78%), Gaps = 7/144 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS ++KAESP  G S K     D   LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESP--GASPK-----DTKSLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  53

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F++LK ATR+FR DSVLGEGGFG VFKGWID+ SLS T+PGTGLVIAVK+LN  G QGH 
Sbjct  54   FSELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLSATRPGTGLVIAVKKLNQDGWQGHQ  113

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  114  EWLAEVNYLGQFSHGHLVKLIGYC  137



>ref|XP_011011764.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Populus euphratica]
Length=275

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 117/152 (77%), Gaps = 13/152 (9%)
 Frame = +1

Query  220  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQ  375
            MG+C S RIK+ +  + GLSSKC     GS  GK+        S  S PQTP+SEGEIL+
Sbjct  1    MGLCWSNRIKSYTCSNTGLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEILE  55

Query  376  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  555
            S NLK+FTF +LK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIA+KRLN
Sbjct  56   SSNLKTFTFGELKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIALKRLN  115

Query  556  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              G QGH EWLAE+NYLGQF HPNLVKLIG+C
Sbjct  116  QEGFQGHREWLAEINYLGQFQHPNLVKLIGFC  147



>gb|KJB36716.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=283

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLKS  393
            MG+C S RIK+ SP  G++S+       +    S  ++S   PQTP+SEGEILQS NLK+
Sbjct  1    MGVCWSHRIKSVSPSTGVNSRNASRNGNNLSSSSSRESSASIPQTPRSEGEILQSSNLKT  60

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            FTF++LK ATR+FR DSVLGEGGFG VFKGWID++S   TKPGTG++IAVKRLN  G QG
Sbjct  61   FTFSELKAATRNFRPDSVLGEGGFGSVFKGWIDEHSFKATKPGTGIIIAVKRLNQEGFQG  120

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  HKEWLAEINYLGQLHHPNLVKLIGYC  146



>emb|CDX95143.1| BnaC05g05280D [Brassica napus]
Length=408

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG CLS ++KAESP  G S K     D   LG   S  S   TP++EGEILQSPNLKSF+
Sbjct  1    MGACLSAQVKAESP--GASPKF---KDTGSLGSKGSSVSVRPTPRTEGEILQSPNLKSFS  55

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH 
Sbjct  56   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQ  115

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  116  EWLAEVNYLGQFSHGHLVKLIGYC  139



>ref|XP_002892407.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68666.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS ++KAES   G S K   + D + LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESS--GASPK-YDAKDTASLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FADLK ATR+FR DSVLGEGGFG VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH 
Sbjct  58   FADLKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQ  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  118  EWLAEVNYLGQFSHRHLVKLIGYC  141



>ref|XP_009759469.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=395

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 8/145 (6%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C+SVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NLKSF
Sbjct  1    MGSCISVRIKAESPLHAG-------ASDGRDLSSRLSYSSAPLTPRSQNEILESSNLKSF  53

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+++    +PGTGLVIAVKRLN  G QGH
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDEHTFKAARPGTGLVIAVKRLNQEGFQGH  113

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLG  SHPNLVKLIGYC
Sbjct  114  KEWLAEINYLGSLSHPNLVKLIGYC  138



>ref|XP_011657150.1| PREDICTED: protein kinase APK1A, chloroplastic [Cucumis sativus]
 gb|KGN47146.1| hypothetical protein Csa_6G190370 [Cucumis sativus]
Length=404

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAE-SPHPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  387
            MG+CLS RIKAE S + G++S  V STDG+ +G ++SK    S P TP++EGEILQS NL
Sbjct  1    MGVCLSTRIKAENSCNTGVNSNGV-STDGNDIGSTNSKINLLSVPPTPRTEGEILQSSNL  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF+F +LK ATR+FR DSV+GEGGFG VFKGWID++S +  KPGTG+VIAVKRLN  G 
Sbjct  60   KSFSFTELKAATRNFRPDSVVGEGGFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+N+LGQ SH +LV+L+GYC
Sbjct  120  QGHREWLAEVNFLGQLSHCHLVRLVGYC  147



>ref|XP_009626085.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=395

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 8/145 (6%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C+SVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NLKSF
Sbjct  1    MGSCISVRIKAESPLHAG-------ASDGRDLSSRLSYSSAPLTPRSQNEILESSNLKSF  53

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+++    +PGTGLVIAVKRLN  G QGH
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDEHTFKSARPGTGLVIAVKRLNQEGFQGH  113

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLG  SHPNLVKLIGYC
Sbjct  114  KEWLAEINYLGSLSHPNLVKLIGYC  138



>ref|XP_010542648.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=257

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 113/147 (77%), Gaps = 6/147 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  390
            MGICLS ++KAE    G S K  +S+DG+  G   SK S      TP++EGEILQSP L 
Sbjct  1    MGICLSAQVKAEVS--GASPK-YMSSDGNQTGSMGSKASSVSVRPTPRTEGEILQSPTLN  57

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+FA+LK ATR+FR DSVLGEGGFG VFKGWI + SL+ TKPGTGLVIAVKRLN  G Q
Sbjct  58   SFSFAELKAATRNFRPDSVLGEGGFGCVFKGWIHEQSLTATKPGTGLVIAVKRLNQDGWQ  117

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWL E+N+LGQFSHP+LVKLIGYC
Sbjct  118  GHKEWLTEVNFLGQFSHPHLVKLIGYC  144



>gb|KJB76052.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=376

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKAESP H G +S+   S +G  +G S S+ S    P++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNGANSR-YGSKNGEEMGGSSSRVSSMSMPRTEGEILQSSNLKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTGLVIAVKRLN  G QGH
Sbjct  60   NFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTGLVIAVKRLNQEGFQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  QEWLAEINYLGQLHHPNLVKLIGYC  144



>ref|NP_172237.1| protein kinase APK1A [Arabidopsis thaliana]
 ref|NP_973778.1| protein kinase APK1A [Arabidopsis thaliana]
 sp|Q06548.1|APK1A_ARATH RecName: Full=Protein kinase APK1A, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02092.1| tyrosine-serine-threonine kinase [Arabidopsis thaliana]
 gb|AAO42086.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AAO50645.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28143.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28144.1| protein kinase APK1A [Arabidopsis thaliana]
Length=410

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS ++KAES   G S+K      GS LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESS--GASTKYDAKDIGS-LGSKASSVSVRPSPRTEGEILQSPNLKSFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH 
Sbjct  58   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQ  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  118  EWLAEVNYLGQFSHRHLVKLIGYC  141



>gb|KJB36715.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=397

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLKS  393
            MG+C S RIK+ SP  G++S+       +    S  ++S   PQTP+SEGEILQS NLK+
Sbjct  1    MGVCWSHRIKSVSPSTGVNSRNASRNGNNLSSSSSRESSASIPQTPRSEGEILQSSNLKT  60

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            FTF++LK ATR+FR DSVLGEGGFG VFKGWID++S   TKPGTG++IAVKRLN  G QG
Sbjct  61   FTFSELKAATRNFRPDSVLGEGGFGSVFKGWIDEHSFKATKPGTGIIIAVKRLNQEGFQG  120

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  HKEWLAEINYLGQLHHPNLVKLIGYC  146



>ref|XP_010557255.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X3 
[Tarenaya hassleriana]
Length=412

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  390
            MGIC+S R+KAESP     S   +S+DG+  G   SK+S      TP++EGEILQSPNLK
Sbjct  1    MGICMSARVKAESPGKTGGSPKYMSSDGNDKGSLGSKSSSMSVRPTPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG+VIAVKRLN  G Q
Sbjct  61   SFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGTGMVIAVKRLNQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQFSH +L+KLIGYC
Sbjct  121  GHKEWLAEVNYLGQFSHRHLMKLIGYC  147



>gb|ACG32116.1| protein kinase APK1B [Zea mays]
Length=419

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIST--DGSGLGKSDSKNSPPQTP---KSEGEILQSPN  384
            MG C   RIK  SPHPG S     S+  DGS L    S+ S    P   K+E EILQS N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSSGKDGSRLSGCSSRASSASMPPSAKTECEILQSAN  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            +K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLNH G
Sbjct  61   VKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLNHEG  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  121  LQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>ref|XP_006339025.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=413

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  381
            MGICLS +IKAE+      GL S+ V S +G+ +  S+SK+S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTFYTVSGLDSRNV-SGNGTDISNSNSKHSSASVPPTPRSEGEILQSS  59

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NL+SFTF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  
Sbjct  60   NLRSFTFSELRSATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQE  119

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ  HPNLV LIGYC
Sbjct  120  GWQGHREWLAEINYLGQLHHPNLVNLIGYC  149



>ref|XP_004490898.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=397

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGS---GLGKSDSKNSPPQTPKSEGEILQSPNL  387
            MG CLS RIKAESP   GLSSK     DGS   GL    +  + P TP++EGEIL S N+
Sbjct  1    MGCCLSARIKAESPPRNGLSSK-----DGSKDNGLSGRTTPTTGPPTPRTEGEILNSSNM  55

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSFTF++LK+ATR+FR DSV+GEGGFG VFKGWID++SL P KPGTG+VIAVKRLN  GL
Sbjct  56   KSFTFSELKIATRNFRPDSVVGEGGFGAVFKGWIDEHSLVPVKPGTGVVIAVKRLNQEGL  115

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGHSEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  116  QGHSEWLTEINYLGQLHHPNLVKLIGYC  143



>gb|EYU41728.1| hypothetical protein MIMGU_mgv1a007413mg [Erythranthe guttata]
Length=408

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 115/150 (77%), Gaps = 6/150 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  381
            MGIC S +IKAESP     G+ S  ++S DG  L  S SK S    P TP++EGEILQS 
Sbjct  1    MGICFSNQIKAESPFHTGTGVISSRMVSGDGIELSNSSSKRSSSSVPPTPRTEGEILQSS  60

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NLKSF F+DLK ATR+FR DSVLGEGGFG VFKGWID+NSL+ +KPG+ LV+AVKRLN  
Sbjct  61   NLKSFGFSDLKAATRNFRPDSVLGEGGFGSVFKGWIDENSLAASKPGSSLVVAVKRLNQD  120

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ  HPNLV+LIGYC
Sbjct  121  GWQGHKEWLAEINYLGQLRHPNLVRLIGYC  150



>ref|XP_009118427.1| PREDICTED: protein kinase APK1A, chloroplastic [Brassica rapa]
 emb|CDY06271.1| BnaA09g49320D [Brassica napus]
Length=406

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 110/144 (76%), Gaps = 7/144 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS ++KAESP            D   LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESP-------VASPKDTKSLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  53

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F++LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ T+PGTGLVIAVK+LN  G QGH 
Sbjct  54   FSELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATRPGTGLVIAVKKLNQDGWQGHQ  113

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  114  EWLAEVNYLGQFSHGHLVKLIGYC  137



>ref|XP_010557252.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=435

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  390
            MGIC+S R+KAESP     S   +S+DG+  G   SK+S      TP++EGEILQSPNLK
Sbjct  24   MGICMSARVKAESPGKTGGSPKYMSSDGNDKGSLGSKSSSMSVRPTPRTEGEILQSPNLK  83

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG+VIAVKRLN  G Q
Sbjct  84   SFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGTGMVIAVKRLNQDGWQ  143

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQFSH +L+KLIGYC
Sbjct  144  GHKEWLAEVNYLGQFSHRHLMKLIGYC  170



>gb|KHG05340.1| Protein kinase APK1A, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG05994.1| Protein kinase APK1A, chloroplastic -like protein [Gossypium 
arboreum]
Length=411

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKAESP H G +S+   S +G  +G S S+ S    P++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNGANSR-YGSKNGEEMGGSSSRISSMSMPRTEGEILQSSNLKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTGLVIAVKRLN  G QGH
Sbjct  60   NFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTGLVIAVKRLNQEGFQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  QEWLAEINYLGQLHHPNLVKLIGYC  144



>gb|KJB76051.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
 gb|KJB76053.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=411

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKAESP H G +S+   S +G  +G S S+ S    P++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNGANSR-YGSKNGEEMGGSSSRVSSMSMPRTEGEILQSSNLKSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTGLVIAVKRLN  G QGH
Sbjct  60   NFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTGLVIAVKRLNQEGFQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  QEWLAEINYLGQLHHPNLVKLIGYC  144



>ref|XP_009353659.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009353660.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=391

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 109/146 (75%), Gaps = 4/146 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGS--GLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MGICLS RIK ES      SKCV S DG         S  S P TP+SEGEIL+SPNLKS
Sbjct  1    MGICLSARIKVESS-VNTGSKCV-SNDGDLSSTSSKVSSFSAPPTPRSEGEILKSPNLKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F++ DLK+ATR+FR DSVLGEGGFG VFKGWID+NS +  KPG+G+ +AVKRLN    QG
Sbjct  59   FSYNDLKLATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGSGIDLAVKRLNQESFQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  119  HREWLAEVNYLGQLYHPNLVKLIGYC  144



>ref|XP_011011763.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Populus euphratica]
Length=399

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 117/152 (77%), Gaps = 13/152 (9%)
 Frame = +1

Query  220  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQ  375
            MG+C S RIK+ +  + GLSSKC     GS  GK+        S  S PQTP+SEGEIL+
Sbjct  1    MGLCWSNRIKSYTCSNTGLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEILE  55

Query  376  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  555
            S NLK+FTF +LK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIA+KRLN
Sbjct  56   SSNLKTFTFGELKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIALKRLN  115

Query  556  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              G QGH EWLAE+NYLGQF HPNLVKLIG+C
Sbjct  116  QEGFQGHREWLAEINYLGQFQHPNLVKLIGFC  147



>ref|XP_010543301.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
Length=387

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG+C S R+KA+       S   +S DGS   K  S  S    P+SEGEILQSPNLK+F 
Sbjct  1    MGVCFSNRVKADISSTTWLSSRFLSRDGS---KCSSTASFSHGPRSEGEILQSPNLKNFC  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F DLK ATR+FR DSV+GEGGFG VFKGWID+NS + +KPG+G+V+AVKRLN  G QGH 
Sbjct  58   FGDLKSATRNFRPDSVVGEGGFGSVFKGWIDENSFAASKPGSGIVVAVKRLNQEGFQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_004249535.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=413

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  381
            MGICLS +IKAE+      GL S+ V S +G+ +  S+SK S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTFYTVSGLDSRNV-SGNGTDISNSNSKRSSASIPPTPRSEGEILQSS  59

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NL+SFTF +L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  
Sbjct  60   NLRSFTFNELRSATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQE  119

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ  HPNLV LIGYC
Sbjct  120  GWQGHREWLAEINYLGQLHHPNLVNLIGYC  149



>ref|XP_009364395.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=418

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG+CLS RIKAESP     SK   +          S  + P TP+SEGEILQS NLKSF+
Sbjct  1    MGVCLSARIKAESP-ANTGSKFESNDGSLSASSKVSSYTAPPTPRSEGEILQSSNLKSFS  59

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN    QGH 
Sbjct  60   FNNLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESYQGHR  119

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  120  EWLAEVNYLGQLYHPNLVKLIGFC  143



>ref|NP_001145874.1| uncharacterized protein LOC100279389 [Zea mays]
 gb|ACL52773.1| unknown [Zea mays]
Length=419

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIST--DGSGLGKSDSKNSPPQTP---KSEGEILQSPN  384
            MG C   RIK  SPHPG S     S+  DGS L    S+ S    P   K+E EIL+S N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSSGKDGSRLSGCSSRASSASMPPSAKTECEILRSAN  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            +K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLNH G
Sbjct  61   VKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLNHEG  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  121  LQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>gb|ACF87678.1| unknown [Zea mays]
 tpg|DAA52220.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=419

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIST--DGSGLGKSDSKNSPPQTP---KSEGEILQSPN  384
            MG C   RIK  SPHPG S     S+  DGS L    S+ S    P   K+E EIL+S N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSSGKDGSRLSGCSSRASSASMPPSAKTECEILRSAN  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            +K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLNH G
Sbjct  61   VKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLNHEG  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  121  LQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>ref|XP_006365700.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=394

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 108/145 (74%), Gaps = 8/145 (6%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLSVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+  NL SF
Sbjct  1    MGSCLSVRIKAESPLHHG-------ASDGRELSSRHSYSSAPLTPRSQSEILELSNLNSF  53

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+N+    +PGTGLVIAVKRLN  G QGH
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDENTFKAARPGTGLVIAVKRLNQEGFQGH  113

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+ YL Q SHPNLVKLIGYC
Sbjct  114  KEWLAEITYLSQLSHPNLVKLIGYC  138



>emb|CDP06608.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 113/150 (75%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPG---LSSKCVISTDG---SGLGKSDSKNSPPQTPKSEGEILQSP  381
            MGICLS ++KAE P      ++S+ V S DG   S L    S  S  QTP+SEGEIL+S 
Sbjct  1    MGICLSQQVKAEFPFSSGTEVNSRNV-SEDGTQTSNLSSKASSFSMCQTPRSEGEILESS  59

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NLKSFTF +LK ATR+FR DSVLGEGGFG VFKGWID+ S + +KPGTG+V+AVKRLN  
Sbjct  60   NLKSFTFGELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSQAASKPGTGIVVAVKRLNQD  119

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  GWQGHKEWLAEINYLGQLRHPNLVKLIGYC  149



>gb|AAF79545.1|AC022464_3 F22G5.5 [Arabidopsis thaliana]
Length=464

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS ++KAES   G S+K      GS LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESS--GASTKYDAKDIGS-LGSKASSVSVRPSPRTEGEILQSPNLKSFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH 
Sbjct  58   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQ  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  118  EWLAEVNYLGQFSHRHLVKLIGYC  141



>ref|XP_010542646.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010542647.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=398

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 113/147 (77%), Gaps = 6/147 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  390
            MGICLS ++KAE    G S K  +S+DG+  G   SK S      TP++EGEILQSP L 
Sbjct  1    MGICLSAQVKAEVS--GASPK-YMSSDGNQTGSMGSKASSVSVRPTPRTEGEILQSPTLN  57

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+FA+LK ATR+FR DSVLGEGGFG VFKGWI + SL+ TKPGTGLVIAVKRLN  G Q
Sbjct  58   SFSFAELKAATRNFRPDSVLGEGGFGCVFKGWIHEQSLTATKPGTGLVIAVKRLNQDGWQ  117

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWL E+N+LGQFSHP+LVKLIGYC
Sbjct  118  GHKEWLTEVNFLGQFSHPHLVKLIGYC  144



>ref|XP_009610451.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 117/152 (77%), Gaps = 8/152 (5%)
 Frame = +1

Query  217  MMGICLSVRIKAESPH----PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQ  375
            +MGICLS +IK E+       GL S+   S +G+    S+SK S    P TP+SEGEILQ
Sbjct  14   LMGICLSYQIKTETTFYTAASGLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQ  72

Query  376  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  555
            S NL+S+TF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN
Sbjct  73   SSNLRSYTFSELRAATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLN  132

Query  556  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  133  QEGWQGHREWLAEINYLGQLHHPNLVKLIGYC  164



>ref|XP_004487004.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004487005.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X4 
[Cicer arietinum]
Length=428

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 106/131 (81%), Gaps = 3/131 (2%)
 Frame = +1

Query  268  GLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  438
            GL+SK    I  D S    S DS  S PQTP+SEGEILQS NLKS+T A+LK ATR+FR 
Sbjct  5    GLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNLKSYTLAELKAATRNFRP  64

Query  439  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  618
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQFS
Sbjct  65   DSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDGCQGHREWLAEVNYLGQFS  124

Query  619  HPNLVKLIGYC  651
            HP+LV+LIGYC
Sbjct  125  HPHLVRLIGYC  135



>ref|XP_010557253.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 118/147 (80%), Gaps = 6/147 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  390
            MGIC+S R+KAESP  G S K  +S+DG+  G   SK+S      TP++EGEILQSPNLK
Sbjct  24   MGICMSARVKAESP--GGSPK-YMSSDGNDKGSLGSKSSSMSVRPTPRTEGEILQSPNLK  80

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG+VIAVKRLN  G Q
Sbjct  81   SFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGTGMVIAVKRLNQDGWQ  140

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQFSH +L+KLIGYC
Sbjct  141  GHKEWLAEVNYLGQFSHRHLMKLIGYC  167



>ref|XP_009610452.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana tomentosiformis]
Length=414

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 8/151 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPH----PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQS  378
            MGICLS +IK E+       GL S+   S +G+    S+SK S    P TP+SEGEILQS
Sbjct  1    MGICLSYQIKTETTFYTAASGLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQS  59

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
             NL+S+TF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN 
Sbjct  60   SNLRSYTFSELRAATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQ  119

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  EGWQGHREWLAEINYLGQLHHPNLVKLIGYC  150



>ref|XP_006417790.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
 gb|ESQ36143.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
Length=413

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MGICLS ++KAESP          + D   LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESPGASPKYTSSDAKDSGSLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  60

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ T+PGTGLVIAVK+LN  G QGH 
Sbjct  61   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATRPGTGLVIAVKKLNQDGWQGHQ  120

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  121  EWLAEVNYLGQFSHGHLVKLIGYC  144



>ref|XP_009772470.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772475.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772479.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=415

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 8/151 (5%)
 Frame = +1

Query  220  MGICLSVRIKAES----PHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQS  378
            MGICLS +IK E+       GL S+   S +G+    S+SK S    P TP+SEGEILQS
Sbjct  1    MGICLSYQIKTETTFYTASSGLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQS  59

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
             NL+S+TF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN 
Sbjct  60   SNLRSYTFSELRAATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQ  119

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  EGWQGHREWLAEINYLGQLHHPNLVKLIGYC  150



>ref|XP_009404596.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=414

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 112/148 (76%), Gaps = 4/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKS----DSKNSPPQTPKSEGEILQSPNL  387
            MG C   +IKAESP     +    S  GS  GK+     SK S P TP+SE EILQS N+
Sbjct  1    MGNCWGAKIKAESPSHSAFASGTNSKYGSREGKAFSSSSSKVSVPPTPRSEDEILQSSNV  60

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSFTF++LK ATR+FR DSVLGEGGFG VFKGW+D+++ +PTKPGTG+VIAVK+LN  G 
Sbjct  61   KSFTFSELKTATRNFRPDSVLGEGGFGSVFKGWVDEHTFAPTKPGTGMVIAVKKLNQDGH  120

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ SHPNLV+LIGYC
Sbjct  121  QGHREWLAEVNYLGQLSHPNLVRLIGYC  148



>gb|AFK44181.1| unknown [Lotus japonicus]
Length=401

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 113/149 (76%), Gaps = 5/149 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTD----GSGLGKSDSKNSPPQTPKSEGEILQSPN  384
            MG C S RIKAESP   GLSSK    ++    G+      S  S P TP++EGEIL+S N
Sbjct  1    MGCCFSARIKAESPPRNGLSSKDGCRSEDCLNGASSSSKVSIPSMPPTPRTEGEILKSSN  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            +KSFTF +LK +TR+FR DS++GEGGFG V+KGWID+ SL+P +PGTG+VIAVKRLN  G
Sbjct  61   MKSFTFGELKTSTRNFRPDSMVGEGGFGCVYKGWIDEQSLAPARPGTGMVIAVKRLNQEG  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LQGHSEWL E+NYLGQ  HPNLV+L+GYC
Sbjct  121  LQGHSEWLTEINYLGQLHHPNLVRLVGYC  149



>ref|XP_010534501.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=396

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTP--KSEGEILQSPNLKS  393
            MG CLS  I+A+SP P  ++    S+D  GL  S S+ SP  T   K+EGEILQS ++KS
Sbjct  1    MGSCLSCLIEAQSP-PRDANSSEKSSDLYGLSLS-SRKSPITTASHKTEGEILQSASVKS  58

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F+F +LK+ATR+FR DSV+GEGGFG VFKGWID+++L+PTKPGTGLVIAVKRLN  G QG
Sbjct  59   FSFNELKLATRNFRPDSVIGEGGFGSVFKGWIDESTLTPTKPGTGLVIAVKRLNQEGFQG  118

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  119  HREWLAEINYLGQLNHPNLVKLIGYC  144



>gb|ACJ84452.1| unknown [Medicago truncatula]
Length=272

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query  214  LMMGICLSVRIKAESP-HPGLSSKCVISTD--GSGLGKSDSKNSPPQTPKSEGEILQSPN  384
            +MMG C S ++KAESP H GL+SK V   +   SGL +  S +S   + ++EGEILQS  
Sbjct  1    MMMGCCFSAKVKAESPTHNGLNSKVVGREEDVSSGLSRRASSSSVLLSSRTEGEILQSNY  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            LK FT  +++ ATR+FR DS++GEGGFG VFKGWID+++L+PTKPGTG VIAVKRLN   
Sbjct  61   LKCFTINEVRAATRNFRPDSMIGEGGFGCVFKGWIDEHTLAPTKPGTGFVIAVKRLNQES  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             QGHSEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  121  SQGHSEWLTEINYLGQLHHPNLVKLIGYC  149



>ref|XP_010043547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043548.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043549.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043550.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW85564.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85565.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85566.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
Length=406

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNS---PPQTPKSEGEILQSPNLK  390
            MGICLS RIKAESP+   ++   I T  + L  + SK S    P T +SE EILQS N++
Sbjct  1    MGICLSARIKAESPYNTGTNTKSIGTSENDLSSNGSKTSSVLAPLTLRSECEILQSLNVQ  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
             F++ADL+MATR+FR DSVLGEGGFG VFKGWID+NS S  K GTG+VIAVK+LN    Q
Sbjct  61   IFSYADLRMATRNFRPDSVLGEGGFGSVFKGWIDENSFSAAKAGTGIVIAVKKLNQESFQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HP+LV+LIGYC
Sbjct  121  GHREWLAEVNYLGQLYHPHLVRLIGYC  147



>emb|CDP00097.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKAESP H G +S+ V S       +  S  S PQTP+SE EIL+S NL+SF
Sbjct  1    MGSCFSARIKAESPLHAGANSRYVSSDGRDSSSRL-SSASVPQTPRSESEILESSNLRSF  59

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F DLK ATR+FR DSVLGEGGFG VFKGW+D++S    KPGTGLVIAVKRLN  GLQGH
Sbjct  60   GFNDLKTATRNFRPDSVLGEGGFGCVFKGWVDQHSCKAAKPGTGLVIAVKRLNQEGLQGH  119

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWL E+NYLGQ  HPNLVKL+GYC
Sbjct  120  KEWLTEINYLGQLHHPNLVKLVGYC  144



>ref|XP_007009313.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18123.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=347

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKAESP H   +S       G+G+  S S+ S     ++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNEANSGHGGGKYGNGMSGSSSRISSVSVARTEGEILQSSNLKSF  60

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F++L+ ATR+FR DSVLGEGGFG VFKGW+D+NSL+  KPGTG+VIAVKRLN  GLQGH
Sbjct  61   SFSELRTATRNFRPDSVLGEGGFGCVFKGWVDENSLTAAKPGTGMVIAVKRLNQEGLQGH  120

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  121  QEWLAEINYLGQLYHPNLVKLVGYC  145



>gb|KJB20072.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=400

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  340  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  519
            P TP+SEGEILQSPNLKSF+FADLKMATR+FR DSVLGEGGFG VFKGW+D+NS + TKP
Sbjct  39   PLTPRSEGEILQSPNLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWVDENSFTATKP  98

Query  520  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G+G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  99   GSGIVIAVKRLNQDGFQGHKEWLAEVNYLGQLYHPNLVKLIGYC  142



>ref|XP_004981243.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Setaria 
italica]
Length=416

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTP---KSEGEILQSPN  384
            MG C   RIK  SPHPG S     S   DGS L    S+ S    P   K+E EILQS N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSGGKDGSRLSGCSSRASSASMPPNAKTECEILQSAN  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            +K F+F++LK ATR+FR DSVLGEGGFG V+KGWID+N+L+P +PGTG+ +AVKRLN  G
Sbjct  61   VKVFSFSNLKSATRNFRPDSVLGEGGFGSVYKGWIDENTLAPCRPGTGIAVAVKRLNQEG  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  121  LQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>ref|XP_009766459.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=416

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 114/150 (76%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESP---HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  381
            MGICLS +IKAE+      G+ S+ V S +G+    S SK S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTIFTGTGIGSRNV-SGNGTETSNSYSKRSSGSVPPTPRSEGEILQSS  59

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NL+SFTF +L+ ATR+FR DSV+GEGGFG VFKGW+D+ +L  +KPG G+VIAVK+LN  
Sbjct  60   NLRSFTFNELRAATRNFRPDSVVGEGGFGSVFKGWVDEQTLVASKPGAGIVIAVKKLNQE  119

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GLQGH EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  120  GLQGHREWLAEINYLGQLRHPNLVKLVGYC  149



>ref|XP_009140954.1| PREDICTED: protein kinase APK1B, chloroplastic [Brassica rapa]
Length=418

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+ A++K  TR+FR D VLGEGGFG VFKGWI + SL+ +KPGTG+VIAVKR+N  G Q
Sbjct  61   SFSVAEVKSETRNFRPDIVLGEGGFGCVFKGWIYEQSLTASKPGTGMVIAVKRINQDGWQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  121  GHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>ref|XP_010047712.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Eucalyptus 
grandis]
Length=398

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  268  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  447
            G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F+F++L+ ATR+FR DSV
Sbjct  9    GVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNFSFSELRTATRNFRPDSV  67

Query  448  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  627
            LGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QGH EWLAE+NYLGQ  HPN
Sbjct  68   LGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQGHREWLAEINYLGQLHHPN  127

Query  628  LVKLIGYC  651
            LVKLIG+C
Sbjct  128  LVKLIGFC  135



>ref|XP_007009312.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18122.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=410

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKAESP H   +S       G+G+  S S+ S     ++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNEANSGHGGGKYGNGMSGSSSRISSVSVARTEGEILQSSNLKSF  60

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F++L+ ATR+FR DSVLGEGGFG VFKGW+D+NSL+  KPGTG+VIAVKRLN  GLQGH
Sbjct  61   SFSELRTATRNFRPDSVLGEGGFGCVFKGWVDENSLTAAKPGTGMVIAVKRLNQEGLQGH  120

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  121  QEWLAEINYLGQLYHPNLVKLVGYC  145



>ref|XP_011077648.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Sesamum 
indicum]
Length=417

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 115/152 (76%), Gaps = 8/152 (5%)
 Frame = +1

Query  220  MGICLSVRIKAES-----PHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQ  375
            MGICLS +IKAES        G +S  V+S  G+ L  S SKNS    P TP+SEGEILQ
Sbjct  1    MGICLSNQIKAESSFHTGTDVGATSSKVVSGYGTELSNSSSKNSSISVPPTPRSEGEILQ  60

Query  376  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  555
            S NLKSFTF+DLK ATR+FR DSV+GEGGFG VFKGWID+ SL+ ++ G G+V+AVK+LN
Sbjct  61   SSNLKSFTFSDLKAATRNFRPDSVIGEGGFGSVFKGWIDEQSLAASRAGAGMVVAVKKLN  120

Query  556  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  QEGWQGHKEWLAEINYLGQLRHPNLVKLIGYC  152



>ref|XP_008784589.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=415

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-----PGLSSKCVISTDGSGLGKSDSKNSP-PQTPKSEGEILQSP  381
            MG C   R+KAESP       G++SKC           S    +  P TP+SEGEILQS 
Sbjct  1    MGNCWGARVKAESPSHNGFASGMNSKCSSGDGKGSGSSSRVSAASVPPTPRSEGEILQSS  60

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKPGTG+VIAVK+LN  
Sbjct  61   NVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKPGTGIVIAVKKLNQE  120

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  121  GFQGHREWLAEVNYLGQLSHPNLVKLIGYC  150



>gb|KDO51148.1| hypothetical protein CISIN_1g015909mg [Citrus sinensis]
Length=398

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG C S RIKAE+P H  ++SK   S D   L  S  K S    PQTP+SEGEILQS N+
Sbjct  1    MGACCSNRIKAETPSHTDVNSKYS-SRDAKSLSSSSGKASSFSLPQTPRSEGEILQSSNI  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            K+F+++DL+ ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG++IAVKRLN  G 
Sbjct  60   KNFSYSDLRTATRNFRPDSVLGEGGFGSVFKGWVDEHSLASTRPGTGMLIAVKRLNQEGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWL E+NYLGQ  HPNLVKL+GYC
Sbjct  120  QGHKEWLTEINYLGQLHHPNLVKLVGYC  147



>gb|KEH34697.1| tyrosine kinase family protein [Medicago truncatula]
Length=399

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query  214  LMMGICLSVRIKAESP-HPGLSSKCVISTD--GSGLGKSDSKNSPPQTPKSEGEILQSPN  384
            +MMG C S ++KAESP H GL+SK V   +   SGL +  S +S   + ++EGEILQS  
Sbjct  1    MMMGCCFSAKVKAESPTHNGLNSKVVGREEDVSSGLSRRASSSSVLLSSRTEGEILQSNY  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            LK FT  +++ ATR+FR DS++GEGGFG VFKGWID+++L+PTKPGTG VIAVKRLN   
Sbjct  61   LKCFTINEVRAATRNFRPDSMIGEGGFGCVFKGWIDEHTLAPTKPGTGFVIAVKRLNQES  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             QGHSEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  121  SQGHSEWLTEINYLGQLHHPNLVKLIGYC  149



>ref|XP_006846202.1| PREDICTED: probable serine/threonine-protein kinase NAK [Amborella 
trichopoda]
 gb|ERN07877.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
Length=405

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 115/159 (72%), Gaps = 23/159 (14%)
 Frame = +1

Query  220  MGICLS----VRIKAESPHPGLSSKCVISTDGSGL-GKSDSK-----NSPPQ-----TPK  354
            MG C S     R+KAESP        + S   SGL  +S SK     NSPP      TPK
Sbjct  1    MGNCWSWNWSARVKAESP--------LHSVPASGLDSRSSSKDGVDPNSPPSGSVPPTPK  52

Query  355  SEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLV  534
            SEGEILQS N+KSF+FA+LK ATR+FR DSVLGEGGFG VFKGWID+++ +PTKPGTG+V
Sbjct  53   SEGEILQSSNVKSFSFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEHTFAPTKPGTGIV  112

Query  535  IAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            IAVKR N  G QGH EWLAE+NYLGQ SHPNLVKLIG+C
Sbjct  113  IAVKRHNQDGYQGHREWLAEVNYLGQLSHPNLVKLIGFC  151



>ref|XP_009588344.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
tomentosiformis]
Length=417

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 112/150 (75%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  381
            MGICLS +IKAE+      G+ S+ V S DG+    S SK S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTFYTGTGIGSRNV-SGDGTETSNSYSKRSSGSVPPTPRSEGEILQSS  59

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NL+SFTF +L+ ATR+FR DSV+GEGGFG VFKGW+D  +L  +KPG G+VIAVK+LN  
Sbjct  60   NLRSFTFNELRAATRNFRPDSVVGEGGFGSVFKGWVDDQTLVASKPGAGIVIAVKKLNQE  119

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GLQGH EWLAE+NYLGQ  HPNLVKL+GY 
Sbjct  120  GLQGHREWLAEINYLGQLRHPNLVKLVGYS  149



>ref|XP_009143298.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Brassica 
rapa]
 emb|CDX74847.1| BnaA05g05930D [Brassica napus]
Length=382

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KAE+P     S  +      GL  S  K++     K+EGEIL+S  +K+FT
Sbjct  1    MGSCFSSRVKAENPFNDGKSSVLY-----GLSMSSRKSTVAAAQKTEGEILESTPVKNFT  55

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ SL+PTKPGTGLVIAVK+LN  GLQGH 
Sbjct  56   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETSLTPTKPGTGLVIAVKKLNREGLQGHR  115

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  116  EWLTEINYLGQLSHPNLVKLIGYC  139



>ref|XP_010922319.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=409

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 112/151 (74%), Gaps = 7/151 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVIST----DGSGLGKSDSKNSP---PQTPKSEGEILQS  378
            MG C SVRIKAESP    S+  V S     DG+GL  S S+ S    P T +SE EILQ 
Sbjct  1    MGNCWSVRIKAESPFHSASASGVNSRNNGKDGNGLSGSSSRVSSSSVPLTCRSEDEILQC  60

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
              L+ F F+DLK ATR+FR DSVLGEGGFG VFKGWID+++L+ +KPGTG+VIAVKRLNH
Sbjct  61   SKLRCFAFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHALTASKPGTGMVIAVKRLNH  120

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             G QGH EWLAE+NYLGQ  HPNLV+LIGYC
Sbjct  121  DGFQGHREWLAEVNYLGQLYHPNLVRLIGYC  151



>ref|XP_010558327.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010558328.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
Length=392

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KA+       S   +S DGS   KS S  S    P+SEGEILQSPNLK+F+
Sbjct  1    MGACFSNRVKADISSSTWLSSRFLSRDGS---KSSSTTSFSHNPRSEGEILQSPNLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG+G+VIAVKRLN  G QGH 
Sbjct  58   FSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPGSGIVIAVKRLNQEGFQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_006429091.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
 ref|XP_006480830.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Citrus sinensis]
 gb|ESR42331.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
Length=398

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG C S RIKAE+P H  ++SK   S D   L  S  K S    PQTP+SEGEILQS N+
Sbjct  1    MGACCSNRIKAETPSHTDVNSKYS-SRDVKSLSSSSGKASSFSLPQTPRSEGEILQSSNI  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            K+F+++DLK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG++IAVKRLN  G 
Sbjct  60   KNFSYSDLKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLTSTRPGTGMLIAVKRLNQEGF  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWL E+NYLGQ  HPNLVKL+GYC
Sbjct  120  QGHKEWLTEINYLGQLHHPNLVKLVGYC  147



>ref|XP_008240890.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=396

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 108/145 (74%), Gaps = 6/145 (4%)
 Frame = +1

Query  220  MGICLSVRIKAE-SPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG+C S +IKAE S H G +SK     +GS      S  S P TP+SEGEILQS  LKS 
Sbjct  1    MGVCWSNKIKAETSSHTGFNSK-----NGSASNSKASSGSMPVTPRSEGEILQSTKLKSI  55

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F++LK ATR+FR DSVLG+GGFG VFKGWID++SL  TK GTG+VIAVKRLN  G+QGH
Sbjct  56   GFSELKNATRNFRPDSVLGDGGFGSVFKGWIDESSLIATKAGTGMVIAVKRLNQDGIQGH  115

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWL E+NYLG+  HPNLVKLIGYC
Sbjct  116  KEWLTEINYLGELHHPNLVKLIGYC  140



>gb|KEH34700.1| tyrosine kinase family protein [Medicago truncatula]
Length=407

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query  214  LMMGICLSVRIKAESP-HPGLSSKCVISTD--GSGLGKSDSKNSPPQTPKSEGEILQSPN  384
            +MMG C S ++KAESP H GL+SK V   +   SGL +  S +S   + ++EGEILQS  
Sbjct  1    MMMGCCFSAKVKAESPTHNGLNSKVVGREEDVSSGLSRRASSSSVLLSSRTEGEILQSNY  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            LK FT  +++ ATR+FR DS++GEGGFG VFKGWID+++L+PTKPGTG VIAVKRLN   
Sbjct  61   LKCFTINEVRAATRNFRPDSMIGEGGFGCVFKGWIDEHTLAPTKPGTGFVIAVKRLNQES  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             QGHSEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  121  SQGHSEWLTEINYLGQLHHPNLVKLIGYC  149



>gb|KHN47889.1| Protein kinase APK1B, chloroplastic [Glycine soja]
Length=413

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG C S RIK+ SP + G +S+ V S DG  +  S+S+NS    P TP+SEGEILQS NL
Sbjct  1    MGACWSSRIKSVSPSNTGFTSRSV-SRDGYDI-HSNSRNSSASIPMTPRSEGEILQSSNL  58

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KS+++ +LKMAT++F  DSVLGEGGFG VFKGWID++SL+ T+ GTG+V+AVK+LN    
Sbjct  59   KSYSYNELKMATKNFCPDSVLGEGGFGSVFKGWIDEHSLAVTRAGTGMVVAVKKLNQESF  118

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  119  QGHKEWLAEINYLGQLQHPNLVKLIGYC  146



>ref|XP_003522100.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Glycine max]
Length=414

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG C S RIK+ SP + G +S+ V S DG  +  S+S+NS    P TP+SEGEILQS NL
Sbjct  1    MGACWSSRIKSVSPSNTGFTSRSV-SRDGYDI-HSNSRNSSASIPMTPRSEGEILQSSNL  58

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KS+++ +LKMAT++F  DSVLGEGGFG VFKGWID++SL+ T+ GTG+V+AVK+LN    
Sbjct  59   KSYSYNELKMATKNFCPDSVLGEGGFGSVFKGWIDEHSLAVTRAGTGMVVAVKKLNQESF  118

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  119  QGHKEWLAEINYLGQLQHPNLVKLIGYC  146



>ref|XP_010920578.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Elaeis guineensis]
Length=420

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 114/158 (72%), Gaps = 15/158 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESPHP------------GLSSKCVISTDGSGLGKSDSKNSP--PQTPKS  357
            MG C   ++KAESP              G++SKC  S DG G   S   ++   P TP+S
Sbjct  1    MGNCWGAQVKAESPSNNVSASDIMFGCLGVNSKCS-SRDGKGSVSSSRVSAASVPPTPRS  59

Query  358  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  537
            EGEILQS N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKPGTG+VI
Sbjct  60   EGEILQSSNVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKPGTGIVI  119

Query  538  AVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            AVK+LN  G QGH EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  120  AVKKLNQEGFQGHREWLAEVNYLGQLAHPNLVKLIGYC  157



>ref|XP_010531641.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=366

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG CLS RIKAESP    ++    S+D  GL  S  K+      K+EGEILQS ++KSF+
Sbjct  1    MGSCLSSRIKAESPPRNEANSSEKSSDLYGLSLSSQKS----LVKTEGEILQSASVKSFS  56

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+F  DSV+GEGGFGPVF+G ID+++L+PTKPGTGL IAVKRL+  G QGH 
Sbjct  57   FNELKLATRNFGTDSVVGEGGFGPVFRGCIDEDTLTPTKPGTGLAIAVKRLSREGFQGHR  116

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  EWLTEINYLGQLSHPNLVKLIGYC  140



>ref|XP_007027015.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY07517.1| Kinase superfamily protein [Theobroma cacao]
Length=398

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLK  390
            MG C S RIK+ SP     +    S +G+ L  S S+ S    PQ P+SEGEILQS NLK
Sbjct  1    MGACWSNRIKSVSPSTTGVNSTSASRNGNNLSGSSSRVSSASVPQAPRSEGEILQSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
             FTF++L+ ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPGTG+VIA KRL   G Q
Sbjct  61   VFTFSELRTATRNFRPDSVLGEGGFGSVFKGWIDEHSLTATKPGTGIVIAAKRLKQEGFQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  GHKEWLAEINYLGQLHHPNLVKLIGYC  147



>ref|XP_010030960.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW50195.1| hypothetical protein EUGRSUZ_J00006 [Eucalyptus grandis]
Length=409

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 111/148 (75%), Gaps = 6/148 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  387
            MG CLS +I AESP H G++       DG+    + S+ S    PQTP++EGEILQS NL
Sbjct  1    MGSCLSSQIIAESPLHKGVN--FFNRGDGNDSSDASSRASSLSVPQTPRTEGEILQSSNL  58

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            KSF F DLK ATR+FR DSVLGEGGFG VFKGWID+ + +  +PGTGLVIAVKRLN  GL
Sbjct  59   KSFAFNDLKTATRNFRPDSVLGEGGFGCVFKGWIDEQTFTAARPGTGLVIAVKRLNQEGL  118

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  119  QGHKEWLAEINYLGQLYHPNLVKLIGFC  146



>ref|XP_002466186.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
 gb|EER93184.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
Length=418

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 107/146 (73%), Gaps = 5/146 (3%)
 Frame = +1

Query  229  CLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKS  393
            C   RIK  SPHPG S     S   DGS L    S+ S    P + K+E EILQS N+K 
Sbjct  6    CWGARIKDGSPHPGTSGMFSKSGGKDGSRLSGCSSRASSASMPTSAKTECEILQSANVKV  65

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVK+LN  GLQG
Sbjct  66   FTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKKLNPEGLQG  125

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  126  HREWLAEVNYLGQFCHPNLVKLIGYC  151



>ref|XP_011091519.1| PREDICTED: probable serine/threonine-protein kinase NAK [Sesamum 
indicum]
Length=397

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = +1

Query  220  MGICLSVRIKAE-SPH-PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG C SVRI+A+ SP   GLSS+ V S DG       S +S P TP++EGEIL S NLKS
Sbjct  1    MGSCCSVRIRADHSPRRDGLSSRFV-SVDGKDTSSRRSSSSMPLTPRNEGEILDSSNLKS  59

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F F DL++ATR+FR DSVLGEGGFG VFKGWID+++    KPGTG VIAVKRLN  G QG
Sbjct  60   FGFNDLRIATRNFRPDSVLGEGGFGCVFKGWIDEHTFKAAKPGTGTVIAVKRLNQEGFQG  119

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWL E+NYLGQ  HPNLVKL+GYC
Sbjct  120  HKEWLTEINYLGQLYHPNLVKLLGYC  145



>ref|XP_009130691.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=391

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 108/144 (75%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLKSFT
Sbjct  1    MGACFSNRIKTDIASSTWLSSRFLSRDGS---KGSSSTSFSHVPRTEGEILQNANLKSFT  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FRLDS++GEGGFG VFKGWID+ SL+P KPGTGLVIAVK+LN  GLQGH 
Sbjct  58   LSELKSATRNFRLDSMVGEGGFGRVFKGWIDETSLAPCKPGTGLVIAVKKLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLNHPNLVKLIGYC  141



>emb|CDY55560.1| BnaA03g54910D [Brassica napus]
Length=391

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 108/144 (75%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLKSFT
Sbjct  1    MGACFSNRIKTDIASSTWLSSRFLSRDGS---KGSSSTSFSHVPRTEGEILQNANLKSFT  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FRLDS++GEGGFG VFKGWID+ SL+P KPGTGLVIAVK+LN  GLQGH 
Sbjct  58   LSELKSATRNFRLDSMVGEGGFGRVFKGWIDETSLAPCKPGTGLVIAVKKLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLNHPNLVKLIGYC  141



>ref|XP_010507635.1| PREDICTED: serine/threonine-protein kinase BIK1-like, partial 
[Camelina sativa]
Length=183

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVKRLN  G QGH 
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKRLNKEGFQGHR  116

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  EWLTEINYLGQLSHPNLVKLIGYC  140



>ref|NP_001274846.1| protein kinase APK1B, chloroplastic-like [Solanum tuberosum]
 gb|ABN69037.1| protein kinase [Solanum tuberosum]
Length=416

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 7/150 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESP---HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSP  381
            MGICLS  IKAE+      G+ S+ V S +G+    S+SK    S P TP+SEGEILQS 
Sbjct  1    MGICLSNEIKAETTIFTGTGVGSRNV-SGNGTETSNSNSKVSSGSVPPTPRSEGEILQSS  59

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NL+SFTF +L+ +TR+FR DSVLG GGFG VFKGWID+ +L  +KPG G+VIAVK+LN  
Sbjct  60   NLRSFTFNELRASTRNFRPDSVLGGGGFGSVFKGWIDEQTLLASKPGAGIVIAVKKLNQE  119

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GLQGH EWLAE+NYLGQ  HPNLV+L+GYC
Sbjct  120  GLQGHREWLAEINYLGQLRHPNLVRLVGYC  149



>ref|XP_003567536.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=401

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 108/144 (75%), Gaps = 9/144 (6%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C   RI ++SP+     +   ++  SG    D+K++  + P+SEGEILQS  +KSF 
Sbjct  1    MGNCFGTRISSDSPY-----RSSAASPSSG----DAKSAELRAPRSEGEILQSAKVKSFA  51

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +L+ ATR+FR DSVLGEGGFG VFKGWID+N+ +P +PGTG+VIAVK+LN  G QGH 
Sbjct  52   FTELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAPARPGTGVVIAVKKLNQDGFQGHR  111

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  112  EWLAEVNYLGQLSHPNLVKLVGYC  135



>ref|XP_008784588.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=422

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 109/157 (69%), Gaps = 13/157 (8%)
 Frame = +1

Query  220  MGICLSVRIKAESPHP------------GLSSKCVISTDGSGLGKSDSKNSP-PQTPKSE  360
            MG C   R+KAESP              G++SKC           S    +  P TP+SE
Sbjct  1    MGNCWGARVKAESPSHNGFASDIMFGCLGMNSKCSSGDGKGSGSSSRVSAASVPPTPRSE  60

Query  361  GEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIA  540
            GEILQS N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKPGTG+VIA
Sbjct  61   GEILQSSNVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKPGTGIVIA  120

Query  541  VKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            VK+LN  G QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  121  VKKLNQEGFQGHREWLAEVNYLGQLSHPNLVKLIGYC  157



>gb|AAA18853.1| protein kinase [Arabidopsis thaliana]
Length=389

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTASFSYMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DSV+GEGGFG VFKGWID++SL+P+KPGTG+VIAVKRLN  G QGH 
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKRLNQEGFQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_008447952.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
melo]
Length=384

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLK  390
            MGIC S R K+ SP  GL+       DG     S SK S    P TP+SE EILQ  NLK
Sbjct  1    MGICWSDRSKSLSPPKGLTRFKSKRGDGEHSHISSSKVSSASIPVTPRSEDEILQCSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            +F+F +L+ ATR+FR DSV+GEGGFG VFKGWID++SL+PTK GTGLVIAVKRLN  G+Q
Sbjct  61   NFSFNELRTATRNFRPDSVVGEGGFGSVFKGWIDEHSLTPTKAGTGLVIAVKRLNRDGVQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  121  GHKEWLAEINYLGQLSHPNLVKLIGYC  147



>ref|NP_195849.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 ref|NP_850755.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 sp|P43293.2|NAK_ARATH RecName: Full=Probable serine/threonine-protein kinase NAK [Arabidopsis 
thaliana]
 emb|CAB85534.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 gb|AAM63816.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 dbj|BAF00769.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 gb|AED90455.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 gb|AED90456.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
Length=389

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTASFSYMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DSV+GEGGFG VFKGWID++SL+P+KPGTG+VIAVKRLN  G QGH 
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKRLNQEGFQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>gb|KHG15912.1| Protein kinase APK1A, chloroplastic [Gossypium arboreum]
Length=386

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 106/146 (73%), Gaps = 16/146 (11%)
 Frame = +1

Query  220  MGICLSVRIKA-ESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG C S RIKA ESP H G++                SK SP   P++EG+ILQ+ NLKS
Sbjct  1    MGSCFSSRIKAAESPLHHGVNL--------------SSKMSPVSVPRTEGDILQASNLKS  46

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ + +KPGTG+VIAVKRLN  G QG
Sbjct  47   FNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTFTASKPGTGMVIAVKRLNQEGFQG  106

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  107  HHEWLAEINYLGQLDHPNLVKLVGYC  132



>ref|XP_004142067.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
sativus]
 gb|KGN54255.1| hypothetical protein Csa_4G296090 [Cucumis sativus]
Length=384

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLK  390
            MG+C S R K+ SP  GL+       DG     S SK S    P TP+SE EILQ  NLK
Sbjct  1    MGVCWSDRSKSLSPPKGLTRFKSKRGDGEHSHISSSKVSSASIPVTPRSEDEILQCSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            +F+F +LK ATR+FR DSV+GEGGFG VFKGWID++SL+PTK GTGLVIAVKRLN  G+Q
Sbjct  61   NFSFNELKTATRNFRPDSVVGEGGFGSVFKGWIDEHSLTPTKAGTGLVIAVKRLNREGVQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  121  GHKEWLAEINYLGQLSHPNLVKLIGYC  147



>ref|XP_009124366.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X1 [Brassica 
rapa]
Length=419

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  268  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  441
            G+SSK + S   D   +G   S  S    P++EGEILQSPNLKSF+  +LK ATR+FR D
Sbjct  24   GVSSKYMSSEANDSQSMGSKCSSASIRTNPRTEGEILQSPNLKSFSLDELKSATRNFRQD  83

Query  442  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  621
            SVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQFSH
Sbjct  84   SVLGEGGFGCVFKGWIDEQSLAASKPGTGMVIAVKRLNQDGWQGHQEWLAEVNYLGQFSH  143

Query  622  PNLVKLIGYC  651
            PNLVKLIGYC
Sbjct  144  PNLVKLIGYC  153



>emb|CDX80814.1| BnaC03g00680D [Brassica napus]
Length=391

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLKSFT
Sbjct  1    MGACFSNRIKTDIASSTWLSSRFLSRDGS---KGSSSTSFSHVPRTEGEILQNANLKSFT  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR FRLDS++GEGGFG VFKGWID+ SL+P KPGTGLVIAVK+LN  GLQGH 
Sbjct  58   LSELKSATRSFRLDSMVGEGGFGRVFKGWIDETSLAPCKPGTGLVIAVKKLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLNHPNLVKLIGYC  141



>ref|XP_012089179.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Jatropha 
curcas]
 gb|KDP44953.1| hypothetical protein JCGZ_01453 [Jatropha curcas]
Length=415

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 106/147 (72%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKC--VISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG C SVRIKAESP H G   K       + S      S  + P TP++EGEILQS NLK
Sbjct  1    MGSCFSVRIKAESPFHHGADPKYGGRAGHEVSRSSSKYSSATVPSTPRTEGEILQSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SFTF++L+ ATR+FR DS+LGEGGFG VFKGWID+ +L+  KPG G VIAVKRLN  G Q
Sbjct  61   SFTFSELRAATRNFRPDSMLGEGGFGSVFKGWIDEQTLTAAKPGMGTVIAVKRLNQDGFQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWL E+NYLGQ  HPNLVKLIG+C
Sbjct  121  GHQEWLTEINYLGQLYHPNLVKLIGFC  147



>ref|XP_010490647.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
 ref|XP_010490648.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=400

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSNTSFSHMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  GLQGH 
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLAPSKPGTGIVIAVKRLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLG+  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGKLDHPNLVKLIGYC  141



>ref|XP_009414323.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 111/151 (74%), Gaps = 7/151 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQS  378
            MG C   ++KAESP  G  +  + S   S  GK         S  S P TP+SEGEILQS
Sbjct  1    MGNCWGAQVKAESPSDGFFASGLHSKSSSRDGKKLSGSSSKVSAASVPPTPRSEGEILQS  60

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
             N+KSFTF +L++ATR+FR DSV+GEGGFG VFKGWID+++L+  KPGTG+VIAVK+LN 
Sbjct  61   VNVKSFTFTELRIATRNFRPDSVVGEGGFGSVFKGWIDEHTLAAAKPGTGVVIAVKKLNQ  120

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             G QGH EWLAE+NYLGQ SHP+LVKLIGYC
Sbjct  121  EGHQGHREWLAEVNYLGQLSHPHLVKLIGYC  151



>ref|XP_011027201.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=415

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCV--ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG C S RIKAESP   G+++K       D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARIKAESPPRNGVNTKYAGKSGNDKSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+F++LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG VIAVKRLN    Q
Sbjct  61   SFSFSELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGTVIAVKRLNQESSQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  GHQEWLAEINYLGQLYHPNLVKLIGYC  147



>gb|EYU18976.1| hypothetical protein MIMGU_mgv1a007452mg [Erythranthe guttata]
Length=407

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 108/145 (74%), Gaps = 3/145 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHP-GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGIC S RIK+++P P GL+S+   S          SK S   T ++EGEILQS NLK F
Sbjct  1    MGICFSGRIKSQTPPPTGLNSQYASSNGNENSYVISSKVS--STLRTEGEILQSSNLKDF  58

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            TF+DLK ATR+FR DSVLG GGFG VFKGW+D+NS    KPGTG+++AVK+L+    QGH
Sbjct  59   TFSDLKNATRNFRPDSVLGGGGFGSVFKGWVDENSFIAAKPGTGMIVAVKKLHQESFQGH  118

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  119  REWLAEVNYLGQFSHPNLVKLIGYC  143



>ref|XP_010470021.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470022.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470023.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
Length=394

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  292  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  471
            + D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG 
Sbjct  5    ANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGS  64

Query  472  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  648
            VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  65   VFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGY  123



>ref|XP_010111458.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
 gb|EXC30981.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
Length=394

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 108/145 (74%), Gaps = 7/145 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKAESP H G +SK   S+         S  S P TP+SE +IL+SPN+KSF
Sbjct  1    MGACWSNRIKAESPYHTGFNSKSTNSS------GKSSSFSAPLTPRSEDDILRSPNIKSF  54

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F++LK ATR+FR DSVLGEGGFG VFKGWID+  L+  KPGTG+VIAVKRLN  G QGH
Sbjct  55   SFSELKTATRNFRPDSVLGEGGFGSVFKGWIDEQLLTAAKPGTGIVIAVKRLNQEGFQGH  114

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWL E+NYLGQ  HPNLVKLIGYC
Sbjct  115  KEWLTEINYLGQLHHPNLVKLIGYC  139



>gb|KJB73944.1| hypothetical protein B456_011G261900 [Gossypium raimondii]
Length=386

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 105/146 (72%), Gaps = 16/146 (11%)
 Frame = +1

Query  220  MGICLSVRIKA-ESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG C S RIKA ESP H G++                SK SP   P +EGEILQ+ NLKS
Sbjct  1    MGSCFSSRIKAAESPLHHGVNL--------------SSKMSPVSVPITEGEILQASNLKS  46

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ + +KPGTG+VIAVKRLN  G QG
Sbjct  47   FNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTFTASKPGTGMVIAVKRLNQEGFQG  106

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  107  HHEWLAEINYLGQLDHPNLVKLVGYC  132



>ref|XP_010937617.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Elaeis guineensis]
Length=415

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 107/154 (69%), Gaps = 14/154 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSK----------NSPPQTPKSEGEI  369
            MG C   ++KAES     S     S   S   K D K           S P TP+SEGEI
Sbjct  1    MGNCWGAQVKAESS----SHSVFASGANSRYSKRDGKLSGSSSRVSAASVPPTPRSEGEI  56

Query  370  LQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKR  549
            LQ+ N+KSFTF +LK ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPGTG+VIAVK+
Sbjct  57   LQASNVKSFTFNELKNATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKPGTGIVIAVKK  116

Query  550  LNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LN  G QGH EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  LNQEGFQGHREWLTEVNYLGQLSHPNLVKLIGYC  150



>ref|XP_002873046.1| hypothetical protein ARALYDRAFT_487008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49305.1| hypothetical protein ARALYDRAFT_487008 [Arabidopsis lyrata subsp. 
lyrata]
Length=389

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTTSFSYMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  G QGH 
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLTPSKPGTGIVIAVKRLNQEGFQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLLGYC  141



>emb|CDY10453.1| BnaCnng03540D [Brassica napus]
Length=390

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S +IK +       S   +S +GS    S S  S   TP++EGEIL++ NLKSFT
Sbjct  1    MGACFSNQIKTDIASSSWLSSKFLSREGSK--GSASATSFSHTPRTEGEILKNANLKSFT  58

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
              +LK ATR FR DS++GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  GLQGH 
Sbjct  59   LGELKSATRSFRPDSMVGEGGFGCVFKGWIDETSLAPSKPGTGIVIAVKRLNQEGLQGHR  118

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  119  EWLAEINYLGQLDHPNLVKLVGYC  142



>emb|CDY04848.1| BnaAnng00300D [Brassica napus]
Length=388

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S +I+ +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DS++GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH 
Sbjct  58   LSELKSATRNFRPDSMVGEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_002316286.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
 gb|EEF02457.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
Length=415

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 110/152 (72%), Gaps = 13/152 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ--------TPKSEGEILQ  375
            MG C S RIKAESP     S+   +T  +G G +D   S  +        TP+++GEILQ
Sbjct  1    MGSCFSARIKAESP-----SRNGGNTKYAGKGGNDKSGSSSKVSSSTVPSTPRTQGEILQ  55

Query  376  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  555
            S NLKSF+F++LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG VIAVKRLN
Sbjct  56   SSNLKSFSFSELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGTVIAVKRLN  115

Query  556  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
                QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  116  QESSQGHQEWLAEINYLGQLYHPNLVKLIGYC  147



>ref|XP_008810614.1| PREDICTED: protein kinase APK1A, chloroplastic [Phoenix dactylifera]
Length=415

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 108/150 (72%), Gaps = 6/150 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP------PQTPKSEGEILQSP  381
            MG C S ++KAES      +  V S   +  GK    +S       P TP+SEGEILQ+ 
Sbjct  1    MGNCCSAQVKAESTSYSAFASGVNSKYSNRDGKGSGSSSRVSAASVPPTPRSEGEILQAS  60

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            N+KSF F +LK ATR+FR DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVK+LN  
Sbjct  61   NVKSFAFNELKSATRNFRPDSVLGEGGFGSVFKGWIDEHSFAATKPGTGIVIAVKKLNQE  120

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  121  GFQGHREWLAEVNYLGQLSHPNLVKLIGYC  150



>emb|CDY20465.1| BnaC04g05790D [Brassica napus]
Length=386

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KAE+P     S  +      GL  S  K++     K+EGEIL+S  +K+FT
Sbjct  1    MGSCFSSRVKAENPFNDGKSSVLY-----GLSMSSGKSTVAAAQKTEGEILESTPVKNFT  55

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVK+LN  GLQGH 
Sbjct  56   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETNLTPTKPGTGLVIAVKKLNREGLQGHR  115

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLG+ SHPNLVKL+GYC
Sbjct  116  EWLTEINYLGRLSHPNLVKLVGYC  139



>emb|CDY48100.1| BnaC02g03570D [Brassica napus]
Length=388

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S +I+ +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DS++GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH 
Sbjct  58   LSELKSATRNFRPDSMVGEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_009125442.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=388

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S +I+ +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DS++GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH 
Sbjct  58   LSELKSATRNFRPDSMVGEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_011030315.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Populus 
euphratica]
Length=415

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAES-PHPGLSSKCV--ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG C S R+KAES P  G+++K       D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARVKAESLPCNGVNTKYAGRSGNDRSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRLN    Q
Sbjct  61   SFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLNQESFQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  GHQEWLAEINYLGQLYHPNLVKLIGYC  147



>ref|XP_007140532.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
 gb|ESW12526.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
Length=410

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  390
            MG C S RIKA SP + G++S+ V S  G  +  +   +S     T +SEGEILQS NLK
Sbjct  1    MGACWSNRIKAVSPSNTGITSRSV-SRSGHDISSTSRNSSASVSVTSRSEGEILQSSNLK  59

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF++++L++ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPG G+++AVKRLN  G Q
Sbjct  60   SFSYSELRVATRNFRPDSVLGEGGFGSVFKGWIDEHSLTATKPGIGMIVAVKRLNQEGFQ  119

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  GHREWLAEINYLGQLQHPNLVKLIGYC  146



>ref|XP_010452061.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010452062.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
Length=398

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSNTSFSHMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH 
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLAPSKPGAGIVIAVKRLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLG+  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGKLDHPNLVKLIGYC  141



>ref|NP_001288898.1| protein kinase APK1B, chloroplastic-like [Brassica rapa]
 gb|ABP01775.1| MLPK isoform 2 [Brassica rapa]
Length=410

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 107/149 (72%), Gaps = 9/149 (6%)
 Frame = +1

Query  205  WWSLMMGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPN  384
            + + + G+C+    K  S           + D   +G   S  S   +P++EGEILQSPN
Sbjct  14   YVNYLFGVCIGASPKYMSSE---------ANDTQSMGSKCSSVSVRTSPRTEGEILQSPN  64

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            LK F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  65   LKCFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEG  124

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  125  WQGHQEWLAEVNYLGRLSHPNLVKLIGYC  153



>ref|XP_009122790.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=389

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S +IK +       S   +S +GS    S S  S   TP++EGEIL++ NLKSFT
Sbjct  1    MGACFSNQIKTDIASSTWLSSKFMSREGSK--GSASATSFSHTPRTEGEILKNANLKSFT  58

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
              +LK ATR FR DS++GEGGFG VFKGWID+ SLSP+KPGTG+VIAVK+LN  GLQGH 
Sbjct  59   LGELKSATRSFRPDSMVGEGGFGCVFKGWIDETSLSPSKPGTGIVIAVKKLNQEGLQGHR  118

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  119  EWLAEINYLGQLDHPNLVKLVGYC  142



>emb|CDY40347.1| BnaA10g27210D [Brassica napus]
Length=390

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S +IK +       S   +S +GS    S S  S   TP++EGEIL++ NLKSFT
Sbjct  1    MGACFSNQIKTDIASSTWLSSKFMSREGSK--GSASATSFSHTPRTEGEILKNANLKSFT  58

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
              +LK ATR FR DS++GEGGFG VFKGWID+ SLSP+KPGTG+VIAVK+LN  GLQGH 
Sbjct  59   LGELKSATRSFRPDSMVGEGGFGCVFKGWIDETSLSPSKPGTGIVIAVKKLNQEGLQGHR  118

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  119  EWLAEINYLGQLDHPNLVKLVGYC  142



>ref|XP_002534306.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF28074.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=389

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  340  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  519
            PQTP+SEGEILQS NLK+F+FA+L+ ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKP
Sbjct  41   PQTPRSEGEILQSSNLKNFSFAELRNATRNFRPDSVLGEGGFGSVFKGWIDEQSLTATKP  100

Query  520  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G+G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  101  GSGVVIAVKRLNQEGFQGHREWLAEINYLGQLQHPNLVKLIGYC  144



>ref|XP_004239839.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=409

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MGICLS +IKAE+      GL S+ V S +G+ +  S+SK+SP  TP+SEGEILQS NL+
Sbjct  1    MGICLSNQIKAETTFYTVSGLDSRNV-SGNGTDISNSNSKHSPT-TPRSEGEILQSSNLR  58

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SFT ++L+ ATR+F  DSV+ EGGFG VFKGW+D+++L+ + PGTG+VIAVK L+  G Q
Sbjct  59   SFTLSELRSATRNFHRDSVVVEGGFGSVFKGWVDEHTLAASMPGTGIVIAVKNLDQEGWQ  118

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNL  LIGYC
Sbjct  119  GHREWLAEINYLGQLHHPNLENLIGYC  145



>ref|XP_002283701.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Vitis 
vinifera]
 emb|CBI31685.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP----PQTPKSEGEILQSPN  384
            MG CLS +IKAE+  + G+ S+C  S DG  L  S S        P TP+++GEILQS N
Sbjct  1    MGGCLSSQIKAENLLYIGIKSRCG-SNDGKYLSGSSSSKVSSASVPTTPRTDGEILQSSN  59

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            LKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+ + +  KPGTG+VIAVK+LN  G
Sbjct  60   LKSFFFSELRTATRNFRPDSVLGEGGFGCVFKGWIDEKAFTAAKPGTGMVIAVKKLNQEG  119

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  FQGHKEWLAEINYLGQLYHPNLVKLIGYC  148



>ref|XP_009414410.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 6/150 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCV----ISTDGSGLGKSDSKNSP--PQTPKSEGEILQSP  381
            MG C S R+KAESP    S+  V    +S D +G   S S++S   P TP++E +ILQS 
Sbjct  1    MGSCWSSRVKAESPFNSASASEVNCRSVSRDRNGSSGSSSRSSASVPLTPRTEVDILQSS  60

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            NLKSF+F++L+ ATR+FR DSV+GEGGFG VFKGWID+ +L+ +KPG+G+V+AVKRLN  
Sbjct  61   NLKSFSFSELRAATRNFRPDSVVGEGGFGSVFKGWIDERTLTASKPGSGIVVAVKRLNQE  120

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GLQGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  GLQGHKEWLAEINYLGQLRHPNLVKLIGYC  150



>ref|XP_002311169.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|EEE88536.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAES-PHPGLSSKCV--ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG C S R+KAES P  GL++K       D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARVKAESLPCNGLNTKYAGRSGNDRSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRL+    Q
Sbjct  61   SFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLSQESFQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  GHQEWLAEINYLGQLYHPNLVKLIGYC  147



>ref|NP_180459.2| protein kinase APK1B [Arabidopsis thaliana]
 gb|ABM06025.1| At2g28930 [Arabidopsis thaliana]
 gb|AEC08189.1| protein kinase APK1B [Arabidopsis thaliana]
Length=423

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  349  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  528
            P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG
Sbjct  53   PRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTG  112

Query  529  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            +VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  113  VVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYC  153



>ref|NP_001241128.1| probable serine/threonine-protein kinase NAK-like [Glycine max]
 ref|XP_006601852.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Glycine max]
 ref|XP_006601853.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X2 [Glycine max]
 gb|ACM89535.1| protein kinase [Glycine max]
 gb|KHN13986.1| Putative serine/threonine-protein kinase NAK [Glycine soja]
Length=410

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  390
            MG C S RIKA SP + G++S+ V S  G  +  +   +S   P T +SEGEILQS NLK
Sbjct  1    MGACWSNRIKAVSPSNTGITSRSV-SRSGHDISSNSRSSSASIPVTSRSEGEILQSSNLK  59

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF++ +L+ ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPG G ++AVK+LN  GLQ
Sbjct  60   SFSYHELRAATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKPGIGKIVAVKKLNQDGLQ  119

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  GHREWLAEINYLGQLQHPNLVKLIGYC  146



>ref|XP_002879189.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55448.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  349  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  528
            P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG
Sbjct  55   PRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTG  114

Query  529  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            +VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  115  VVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYC  155



>ref|XP_004246420.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Solanum lycopersicum]
Length=416

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP---HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPN  384
            MGICLS  IKAE+      G+ S+ V    T+ S      S  S P TP+SEGEILQS N
Sbjct  1    MGICLSNEIKAETTIFTGTGVGSRNVSGNGTENSNSNSKVSSGSVPPTPRSEGEILQSSN  60

Query  385  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  564
            L+SFTF +L+ +TR+FR DSVLGEGGFG VFKGW+D+ +L  +KPG G+VIAVK+LN  G
Sbjct  61   LRSFTFNELRASTRNFRPDSVLGEGGFGSVFKGWVDEQTLLASKPGAGIVIAVKKLNQEG  120

Query  565  LQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LQGH EWLAE+NYLGQ  HPNLV+L+GYC
Sbjct  121  LQGHREWLAEINYLGQLRHPNLVRLLGYC  149



>gb|EYU26593.1| hypothetical protein MIMGU_mgv1a007265mg [Erythranthe guttata]
Length=413

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 8/152 (5%)
 Frame = +1

Query  220  MGICLSVRIKAES-----PHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQ  375
            MGIC S +IKAES        G +S  ++S DG+ L  S SK S    P TP+SEGEIL 
Sbjct  1    MGICWSNQIKAESNFLSGTDVGATSSKMVSGDGTELSNSSSKTSSASIPPTPRSEGEILN  60

Query  376  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  555
            S N+KSF   DLK ATR+FR DSV+GEGGFG VFKGWID++SL+ ++ G+G+VIAVKRLN
Sbjct  61   SSNMKSFQLFDLKAATRNFRPDSVIGEGGFGSVFKGWIDEHSLAASRAGSGIVIAVKRLN  120

Query  556  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  121  QDGWQGHKEWLAEINYLGQLRHPNLVKLIGYC  152



>gb|EPS63220.1| protein kinase 1b, partial [Genlisea aurea]
Length=346

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 106/145 (73%), Gaps = 12/145 (8%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MGIC S  IK +SP H G+      +T G         +S     ++EGEILQSPNL+SF
Sbjct  1    MGICWSSNIKDQSPVHTGMYD----ATHGE-------VSSAAIVSRTEGEILQSPNLRSF  49

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
            +F+DLK ATR+FRLDS LG GGFG V+KGWID NS +P KPG+GLV+AVK+LN    QGH
Sbjct  50   SFSDLKAATRNFRLDSNLGGGGFGTVYKGWIDANSSAPAKPGSGLVVAVKKLNQESFQGH  109

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWLAE+N+LGQFSHPNLVKLIGYC
Sbjct  110  EEWLAEVNHLGQFSHPNLVKLIGYC  134



>ref|XP_010517317.1| PREDICTED: serine/threonine-protein kinase BIK1 [Camelina sativa]
Length=394

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVKRLN  G QGH 
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKRLNKEGFQGHR  116

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  EWLTEINYLGQMSHPNLVKLIGYC  140



>ref|XP_010937616.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Elaeis guineensis]
Length=423

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 110/158 (70%), Gaps = 14/158 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVIST---DGSGLGKSDSK----------NSPPQTPKS  357
            MG C   ++KAES  H   +S  +I       S   K D K           S P TP+S
Sbjct  1    MGNCWGAQVKAESSSHSVFASVHIIFGCIGANSRYSKRDGKLSGSSSRVSAASVPPTPRS  60

Query  358  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  537
            EGEILQ+ N+KSFTF +LK ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPGTG+VI
Sbjct  61   EGEILQASNVKSFTFNELKNATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKPGTGIVI  120

Query  538  AVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            AVK+LN  G QGH EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  121  AVKKLNQEGFQGHREWLTEVNYLGQLSHPNLVKLIGYC  158



>gb|AAO18450.1| putative protein kinase [Oryza sativa Japonica Group]
Length=416

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +1

Query  220  MGICLS--VRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSP---PQTPKSEGEILQS  378
            MG C     RIK  SP PG S     S   DGS L    S+ S    P T K+E EILQS
Sbjct  1    MGNCCGWGARIKDGSPQPGASGMFSRSGAKDGSRLSGCSSRASSASMPPTAKTECEILQS  60

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
             N+K F+F+DL++ATR+FR DSVLGEGGFG V+KGWID+N+LS  KPGTG+ +AVKRLN 
Sbjct  61   ANVKIFSFSDLRIATRNFRPDSVLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLNQ  120

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              LQGH EWLAE+NYLGQF HPNLVKL GYC
Sbjct  121  ESLQGHREWLAEVNYLGQFCHPNLVKLFGYC  151



>ref|NP_001051730.1| Os03g0821900 [Oryza sativa Japonica Group]
 gb|ABF99600.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13644.1| Os03g0821900 [Oryza sativa Japonica Group]
 dbj|BAG92171.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76429.1| hypothetical protein OsI_14109 [Oryza sativa Indica Group]
 gb|EEE60197.1| hypothetical protein OsJ_13155 [Oryza sativa Japonica Group]
Length=424

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +1

Query  220  MGICLS--VRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSP---PQTPKSEGEILQS  378
            MG C     RIK  SP PG S     S   DGS L    S+ S    P T K+E EILQS
Sbjct  1    MGNCCGWGARIKDGSPQPGASGMFSRSGAKDGSRLSGCSSRASSASMPPTAKTECEILQS  60

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
             N+K F+F+DL++ATR+FR DSVLGEGGFG V+KGWID+N+LS  KPGTG+ +AVKRLN 
Sbjct  61   ANVKIFSFSDLRIATRNFRPDSVLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLNQ  120

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              LQGH EWLAE+NYLGQF HPNLVKL GYC
Sbjct  121  ESLQGHREWLAEVNYLGQFCHPNLVKLFGYC  151



>ref|XP_006650809.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Oryza brachyantha]
Length=423

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 106/151 (70%), Gaps = 7/151 (5%)
 Frame = +1

Query  220  MGICLS--VRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTP---KSEGEILQS  378
            MG C     RIK  SPHPG S     S   DGS L    S+ S    P   K+E EILQS
Sbjct  1    MGNCWGWGARIKDGSPHPGASGMFSRSGAKDGSRLSGCSSRASSASMPPMGKTECEILQS  60

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
             N+K F+F DL++ATR+FR DSVLGEGGFG V+KGWID+N+LS  KPGTG+ +AVKRLN 
Sbjct  61   ANVKIFSFTDLRVATRNFRPDSVLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLNQ  120

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
              LQGH EWLAE+NYLGQF HPNLVKL GYC
Sbjct  121  ESLQGHREWLAEVNYLGQFCHPNLVKLFGYC  151



>ref|XP_010508995.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Camelina 
sativa]
Length=394

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVKRLN  G QGH 
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKRLNKEGFQGHR  116

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  EWLTEINYLGQMSHPNLVKLIGYC  140



>ref|XP_010423878.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
 ref|XP_010423879.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=398

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S     ++EGEILQ+ NLK+++
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSNTSFSHMSRTEGEILQNANLKNYS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  GLQGH 
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLAPSKPGTGIVIAVKRLNQEGLQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLG+  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGKLDHPNLVKLIGYC  141



>ref|XP_006573305.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Glycine 
max]
 gb|KHN19150.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=413

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  390
            MG C S RIKA SP + G +S+ V S DG  +  S   +S   P TP+SEGEILQ  NLK
Sbjct  1    MGACWSSRIKAVSPSNTGFTSRSV-SRDGHDIQSSSRNSSASIPMTPRSEGEILQFSNLK  59

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            S+++ +LKMAT++F  DSVLGEGGFG VFKGWID++SL+ T+PGTG+VIAVK+LN    Q
Sbjct  60   SYSYNELKMATKNFCPDSVLGEGGFGSVFKGWIDEHSLAVTRPGTGMVIAVKKLNQDSFQ  119

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  +PNLVKLIGYC
Sbjct  120  GHKEWLAEINYLGQLQNPNLVKLIGYC  146



>ref|XP_009133858.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Brassica rapa]
Length=381

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  292  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  471
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRL SVLGEGGFG 
Sbjct  5    ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLYSVLGEGGFGC  64

Query  472  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  65   VFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQGHQEWLAEVNYLGRLSHPNLVKLIGYC  124



>ref|XP_006294362.1| hypothetical protein CARUB_v10023379mg [Capsella rubella]
 gb|EOA27260.1| hypothetical protein CARUB_v10023379mg [Capsella rubella]
Length=393

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PT+PGTGLVIAVKRLN  G QGH 
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTRPGTGLVIAVKRLNKEGFQGHR  116

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  EWLTEINYLGQLSHPNLVKLIGYC  140



>ref|XP_009414322.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVI-----------STDGSGLGKSDSKNSP---PQTPKS  357
            MG C   ++KAESP  G  +   +           S DG  L  S SK S    P TP+S
Sbjct  1    MGNCWGAQVKAESPSDGFFASGDVFSCLGLHSKSSSRDGKKLSGSSSKVSAASVPPTPRS  60

Query  358  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  537
            EGEILQS N+KSFTF +L++ATR+FR DSV+GEGGFG VFKGWID+++L+  KPGTG+VI
Sbjct  61   EGEILQSVNVKSFTFTELRIATRNFRPDSVVGEGGFGSVFKGWIDEHTLAAAKPGTGVVI  120

Query  538  AVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            AVK+LN  G QGH EWLAE+NYLGQ SHP+LVKLIGYC
Sbjct  121  AVKKLNQEGHQGHREWLAEVNYLGQLSHPHLVKLIGYC  158



>gb|KHG15911.1| Protein kinase APK1A, chloroplastic [Gossypium arboreum]
Length=596

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 106/146 (73%), Gaps = 16/146 (11%)
 Frame = +1

Query  220  MGICLSVRIKA-ESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  393
            MG C S RIKA ESP H G++                SK SP   P++EG+ILQ+ NLKS
Sbjct  1    MGSCFSSRIKAAESPLHHGVNLS--------------SKMSPVSVPRTEGDILQASNLKS  46

Query  394  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQG  573
            F F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ + +KPGTG+VIAVKRLN  G QG
Sbjct  47   FNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTFTASKPGTGMVIAVKRLNQEGFQG  106

Query  574  HSEWLAELNYLGQFSHPNLVKLIGYC  651
            H EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  107  HHEWLAEINYLGQLDHPNLVKLVGYC  132



>emb|CDY39519.1| BnaC04g15180D [Brassica napus]
Length=396

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  349  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  528
            P++EGEILQSPNLKSF+  +LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG
Sbjct  24   PRTEGEILQSPNLKSFSLDELKSATRNFRQDSVLGEGGFGCVFKGWIDEQSLTASKPGTG  83

Query  529  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            +VIAVKRLN  G QGH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  84   MVIAVKRLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYC  124



>ref|NP_181496.1| serine/threonine-protein kinase BIK1 [Arabidopsis thaliana]
 sp|O48814.1|BIK1_ARATH RecName: Full=Serine/threonine-protein kinase BIK1; AltName: 
Full=Protein BOTRYTIS-INDUCED KINASE 1 [Arabidopsis thaliana]
 gb|AAK17154.1|AF325086_1 putative protein kinase [Arabidopsis thaliana]
 gb|AAB97121.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL32571.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL57667.1| At2g39660/F12L6.32 [Arabidopsis thaliana]
 gb|AAM14921.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM13277.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM16258.1| At2g39660/F12L6.32 [Arabidopsis thaliana]
 gb|AEC09703.1| serine/threonine-protein kinase BIK1 [Arabidopsis thaliana]
Length=395

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADIFHNGKSSDLY----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+++L+PTKPGTGLVIAVK+LN  G QGH 
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHR  116

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  EWLTEINYLGQLSHPNLVKLIGYC  140



>ref|NP_001141912.1| uncharacterized LOC100274061 [Zea mays]
 gb|ACF87298.1| unknown [Zea mays]
 gb|AFW67139.1| putative protein kinase superfamily protein [Zea mays]
Length=418

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTP---KSEGEILQSPNL  387
            MG C   RIK  S    G+ SK     DGS L    S+ S    P   K+E EILQS N+
Sbjct  1    MGNCWGARIKDGSAGASGMFSKSG-GKDGSRLSGCSSRASSASMPPSVKTECEILQSANV  59

Query  388  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGL  567
            K FTF +LK ATR+FR DSVLGEGGFG V+KGW+D+N+LSP +PGTG+ +AVKRLNH GL
Sbjct  60   KIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWVDENTLSPCRPGTGIAVAVKRLNHEGL  119

Query  568  QGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            QGH EW AE+NYLGQF HPNLVKLIGYC
Sbjct  120  QGHREWWAEVNYLGQFCHPNLVKLIGYC  147



>ref|XP_002879808.1| botrytis-induced kinase1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56067.1| botrytis-induced kinase1 [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADIFHNGKSSDLY----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVK+LN  G QGH 
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKKLNQEGFQGHR  116

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  117  EWLTEINYLGQLSHPNLVKLIGYC  140



>ref|XP_007133997.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
 gb|ESW05991.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
Length=413

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 110/147 (75%), Gaps = 4/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  390
            MG C S R KA SP   G +S+ V S +G  +  S   +S   P TP+SEGEILQS NLK
Sbjct  1    MGSCWSSRTKAVSPSSAGFTSRSV-SREGYDIHSSSRNSSSSMPMTPRSEGEILQSSNLK  59

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            S+++ +L++AT+ F  D+VLGEGGFG VFKGWID++SLS TKPG G+V+AVKRLN  G Q
Sbjct  60   SYSYNELRIATKHFSPDNVLGEGGFGSVFKGWIDEHSLSVTKPGIGMVVAVKRLNQEGFQ  119

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  120  GHKEWLAEINYLGQLQHPNLVKLIGYC  146



>gb|KFK24748.1| hypothetical protein AALP_AA8G019600 [Arabis alpina]
Length=389

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK ATR FR DS++GEGGFG VFKGWID+ + +P+K GTG+VIAVKRLN  G+QGH 
Sbjct  58   LSELKSATRSFRPDSMVGEGGFGCVFKGWIDETTFAPSKRGTGIVIAVKRLNLEGMQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_009384873.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=412

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP-------PQTPKSEGEILQS  378
            MG C   ++KAE+P   + +    S  GS  G   S +S        P TP+SEGEIL S
Sbjct  1    MGNCWGAKVKAENPSHDVFASGEDSPHGSRKGNVLSSSSSRVSASSVPPTPRSEGEILTS  60

Query  379  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  558
             NLKSFTF +L+ ATR+FR DSVLGEGGFG VFKGWI++++L+  KPGTG+VIAVK+LN 
Sbjct  61   SNLKSFTFNELRTATRNFRPDSVLGEGGFGSVFKGWINEHTLAAAKPGTGMVIAVKKLNQ  120

Query  559  GGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
             G QGH EWLAE+NYL Q SHPNLVKLIGYC
Sbjct  121  EGFQGHKEWLAEVNYLSQLSHPNLVKLIGYC  151



>ref|NP_001184929.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28145.1| protein kinase APK1A [Arabidopsis thaliana]
Length=424

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  292  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  471
            + D   LG   S  S   +P++EGEILQSPNLKSF+FA+LK ATR+FR DSVLGEGGFG 
Sbjct  36   AKDIGSLGSKASSVSVRPSPRTEGEILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGC  95

Query  472  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  96   VFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYC  155



>ref|XP_008371735.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
 ref|XP_008371743.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=402

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 105/145 (72%), Gaps = 12/145 (8%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLS RIKA+SP H GL S   +S+                TP++EGEILQS NLK+F
Sbjct  1    MGSCLSSRIKADSPLHNGLHSNSKVSSVSVP-----------STPRTEGEILQSSNLKNF  49

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F +LK ATR+FR DSV+GEGGFG VFKGW+D+NSL+  KPGTGLVIA KRLN  G+QGH
Sbjct  50   CFNELKNATRNFRPDSVVGEGGFGCVFKGWVDENSLTAAKPGTGLVIAAKRLNQEGIQGH  109

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWL E+NYLGQ  H NLV+LIGYC
Sbjct  110  KEWLTEINYLGQLHHENLVRLIGYC  134



>ref|XP_006379595.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|ERP57392.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query  220  MGICLSVRIKAES-PHPGLSSKCVIST--DGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG C S R+KAES P  GL++K    +  D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARVKAESLPCNGLNTKYAGRSGNDRSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            SF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRL+    Q
Sbjct  61   SFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLSQESFQ  120

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWL ++NYLGQ  HPNLVKLIGYC
Sbjct  121  GHQEWLVKINYLGQLYHPNLVKLIGYC  147



>gb|EEC78387.1| hypothetical protein OsI_18165 [Oryza sativa Indica Group]
Length=395

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C   +I +ESP    SS    ++  +      + + PP TP+SEGEIL++ N+K+F 
Sbjct  1    MGNCWGAKISSESPCRSASSPSGGTSKYASNSSVSAASVPP-TPRSEGEILEAANVKAFA  59

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PTKPGTG+VIAVK+LN  G QGH 
Sbjct  60   FNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLAPTKPGTGMVIAVKKLNQEGHQGHR  119

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ SHP LV+L+GYC
Sbjct  120  EWLAEVNYLGQLSHPYLVRLVGYC  143



>ref|XP_010067409.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW65537.1| hypothetical protein EUGRSUZ_G02935 [Eucalyptus grandis]
Length=392

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 101/144 (70%), Gaps = 5/144 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG CLS RI       G            GL    S  S PQTP++E EILQS NLKSF+
Sbjct  1    MGCCLSARITDNLFRTGGRPNV-----SGGLSGRVSSYSGPQTPRTEDEILQSTNLKSFS  55

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            + +L++ATR+FR DSVLGEGGFG V+KGW+D+ + + TKPGTG+VIAVKRLN  G QGH 
Sbjct  56   YTELRVATRNFRPDSVLGEGGFGSVYKGWVDEQTFAATKPGTGIVIAVKRLNQEGFQGHK  115

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ  HPNLVKLIG+C
Sbjct  116  EWLTEINYLGQLYHPNLVKLIGFC  139



>ref|XP_010558329.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Tarenaya hassleriana]
Length=345

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  343  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  522
              P+SEGEILQSPNLK+F+F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG
Sbjct  53   HNPRSEGEILQSPNLKNFSFSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPG  112

Query  523  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            +G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  113  SGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNLVKLIGYC  155



>dbj|BAJ87345.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +1

Query  292  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  471
            +TD S  GKS S + PP TP+SE EILQS NL+ FTF++LK  TR+FR DS+LGEGGFG 
Sbjct  27   ATDTSTFGKSSSSSVPP-TPRSEKEILQSSNLRKFTFSELKSCTRNFRTDSLLGEGGFGS  85

Query  472  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            VFKGWID+ + +P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  86   VFKGWIDERTFTPVKPGTGMIVAVKKLKLDSFQGHKEWLAEVNYLGQLSHPNLVKLIGYC  145



>ref|XP_010231839.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Brachypodium 
distachyon]
Length=393

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 110/147 (75%), Gaps = 4/147 (3%)
 Frame = +1

Query  220  MGICLSVRIKAESPHP---GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
            MG C   +I +++      G +SK   S +G+ L  S S  S    P+SEGEIL+S N+K
Sbjct  1    MGNCWGAKISSDNSSSSPSGATSKFA-SRNGATLSNSSSYVSVASVPRSEGEILESANVK  59

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            +FTF +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PTKPGTG+VIAVK+LN  G Q
Sbjct  60   AFTFNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLTPTKPGTGMVIAVKKLNQEGYQ  119

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  120  GHREWLAEVNYLGQLSHPNLVKLVGYC  146



>ref|XP_006398693.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
 gb|ESQ40146.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
Length=396

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 3/144 (2%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S +I+ +       S   +S D S   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDTS---KGSSNTSFSHMPRTEGEILQNANLKNFS  57

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
             ++LK +TR+FR DSV+GEGGFG VFKGWID+ + +P+KPGTG+VIAVKRLN  G QGH 
Sbjct  58   LSELKSSTRNFRPDSVVGEGGFGCVFKGWIDETTFAPSKPGTGIVIAVKRLNQEGFQGHR  117

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  118  EWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_009343547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=402

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 103/144 (72%), Gaps = 10/144 (7%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG CLS RIKA+SPH           +G       S  S   TP++E EILQS NLKSF 
Sbjct  1    MGSCLSSRIKADSPH----------HNGLHSNSKVSSVSVTSTPRTEDEILQSCNLKSFA  50

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK ATR+FR DS++GEGGFG V+KGW+D+NSL+  KPGTG+VIAVKRLN  GLQGH 
Sbjct  51   FNELKTATRNFRPDSMVGEGGFGSVYKGWVDENSLTAAKPGTGMVIAVKRLNQEGLQGHK  110

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWL E+NYLGQ  H NLV+LIGYC
Sbjct  111  EWLTEINYLGQLHHENLVRLIGYC  134



>ref|XP_009384872.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=419

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 110/158 (70%), Gaps = 14/158 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVI------STDGSGLGKSDSKNSP-------PQTPKS  357
            MG C   ++KAE+P H   +S  V       S  GS  G   S +S        P TP+S
Sbjct  1    MGNCWGAKVKAENPSHDVFASDTVFECLGEDSPHGSRKGNVLSSSSSRVSASSVPPTPRS  60

Query  358  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  537
            EGEIL S NLKSFTF +L+ ATR+FR DSVLGEGGFG VFKGWI++++L+  KPGTG+VI
Sbjct  61   EGEILTSSNLKSFTFNELRTATRNFRPDSVLGEGGFGSVFKGWINEHTLAAAKPGTGMVI  120

Query  538  AVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            AVK+LN  G QGH EWLAE+NYL Q SHPNLVKLIGYC
Sbjct  121  AVKKLNQEGFQGHKEWLAEVNYLSQLSHPNLVKLIGYC  158



>ref|XP_009357737.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=402

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 105/145 (72%), Gaps = 12/145 (8%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG CLS RIKA+SP H GL S   +S+                TP++EGEILQS NLK+F
Sbjct  1    MGSCLSSRIKADSPLHNGLHSNSRVSSVSVP-----------STPRTEGEILQSSNLKNF  49

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F +LK ATR+FR DSV+GEGGFG VFKGW+D+NSL+  KPGTGLVIA KRLN  G+QGH
Sbjct  50   CFNELKNATRNFRPDSVVGEGGFGCVFKGWVDENSLTAAKPGTGLVIAAKRLNQEGIQGH  109

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWL E+NYLGQ  H NLV+L+GYC
Sbjct  110  KEWLTEINYLGQLHHENLVRLVGYC  134



>gb|KJB76054.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=397

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  349  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  528
            P++EGEILQS NLKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG
Sbjct  30   PRTEGEILQSSNLKSFNFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTG  89

Query  529  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            LVIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  90   LVIAVKRLNQEGFQGHQEWLAEINYLGQLHHPNLVKLIGYC  130



>gb|EMT08269.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=298

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  340  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  519
            P TP+SEGEILQS N+KSF F +LK ATR+FR DSVLGEGGFG VFKGW+D+ + +P +P
Sbjct  54   PPTPRSEGEILQSANVKSFAFNELKTATRNFRPDSVLGEGGFGSVFKGWVDETTFAPARP  113

Query  520  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLV+L+GYC
Sbjct  114  GTGMVIAVKKLNQEGFQGHREWLAEVNYLGQLSHPNLVRLVGYC  157



>ref|XP_004307510.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 102/144 (71%), Gaps = 11/144 (8%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C S RIKA+SP                     S  S P TP++EGEIL S NLK+F 
Sbjct  1    MGSCFSSRIKADSP-----------LRNGNSNSKVSSVSVPSTPRTEGEILMSSNLKNFF  49

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +LK ATR+FR DS++GEGGFG VFKGW+D+N+L+  KPGTG+VIAVKRLN  GLQGH 
Sbjct  50   FNELKTATRNFRPDSMVGEGGFGCVFKGWVDENALTAAKPGTGMVIAVKRLNQEGLQGHK  109

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  110  EWLAEINYLGQLRHPNLVKLIGYC  133



>ref|XP_010558326.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Tarenaya hassleriana]
Length=406

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  343  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  522
              P+SEGEILQSPNLK+F+F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG
Sbjct  53   HNPRSEGEILQSPNLKNFSFSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPG  112

Query  523  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            +G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  113  SGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNLVKLIGYC  155



>gb|KJB76739.1| hypothetical protein B456_012G104300 [Gossypium raimondii]
Length=273

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = +1

Query  277  SKCVISTDGSGLG---KSDSKN------------SPPQTPKSEGEILQSPNLKSFTFADL  411
            S C+ S   SG G   +S S+N            S  QTP+SEGEI QS NLK+FTF++L
Sbjct  6    SNCIKSVSSSGTGVDSRSRSRNGNNFSSSRVSSASISQTPRSEGEIWQSSNLKTFTFSEL  65

Query  412  KMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLA  591
            K ATR+F  D+VLG GGFG VFKGWID++SL+ TKPGTG+V AVKRLN  G QGH EWLA
Sbjct  66   KTATRNFSPDTVLGAGGFGSVFKGWIDEHSLTATKPGTGIVTAVKRLNKEGFQGHKEWLA  125

Query  592  ELNYLGQFSHPNLVKLIGYC  651
            E+NYLGQ  HPNLVKLIGYC
Sbjct  126  EINYLGQLHHPNLVKLIGYC  145



>gb|EPS69141.1| hypothetical protein M569_05623, partial [Genlisea aurea]
Length=365

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 6/150 (4%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HP-----GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSP  381
            MG C S RI+A++P H       L SK  ++ D +    S   +S  ++P SE EIL+S 
Sbjct  1    MGSCFSARIRADAPPHRDGSLISLCSKNGVAVDTATESSSRRSSSGARSPVSEAEILESA  60

Query  382  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  561
            +LKSFTF DLK++TR+FR DS+LGEGGFG VFKGWID+++    KPGTGLVIAVKRLN  
Sbjct  61   SLKSFTFIDLKVSTRNFRPDSLLGEGGFGCVFKGWIDEHTFKAAKPGTGLVIAVKRLNQE  120

Query  562  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G+QGH EWL E+NYL Q  HPNLVKLIGYC
Sbjct  121  GVQGHREWLTEINYLSQLKHPNLVKLIGYC  150



>gb|KJB76738.1| hypothetical protein B456_012G104300 [Gossypium raimondii]
Length=301

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = +1

Query  277  SKCVISTDGSGLG---KSDSKN------------SPPQTPKSEGEILQSPNLKSFTFADL  411
            S C+ S   SG G   +S S+N            S  QTP+SEGEI QS NLK+FTF++L
Sbjct  6    SNCIKSVSSSGTGVDSRSRSRNGNNFSSSRVSSASISQTPRSEGEIWQSSNLKTFTFSEL  65

Query  412  KMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLA  591
            K ATR+F  D+VLG GGFG VFKGWID++SL+ TKPGTG+V AVKRLN  G QGH EWLA
Sbjct  66   KTATRNFSPDTVLGAGGFGSVFKGWIDEHSLTATKPGTGIVTAVKRLNKEGFQGHKEWLA  125

Query  592  ELNYLGQFSHPNLVKLIGYC  651
            E+NYLGQ  HPNLVKLIGYC
Sbjct  126  EINYLGQLHHPNLVKLIGYC  145



>dbj|BAJ95924.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97649.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 105/159 (66%), Gaps = 15/159 (9%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSK---------------NSPPQTPK  354
            MG C   RI ++SP+   S     S+      +   K                + P TP+
Sbjct  1    MGNCFGSRIGSDSPYKTTSGSASPSSSSGWAWRRKGKGGVSVSSSRVSSSPSTTVPPTPR  60

Query  355  SEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLV  534
            SEGEILQS N+KSF F +LK ATR+FR DSVLGEGGFG VFKGW+D+ + +P +PGTG+V
Sbjct  61   SEGEILQSANVKSFAFTELKTATRNFRPDSVLGEGGFGSVFKGWVDETTFAPARPGTGMV  120

Query  535  IAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            IAVK+LN  G QGH EWLAE+NYLGQ SHPNLV+L+GYC
Sbjct  121  IAVKKLNQEGFQGHREWLAEVNYLGQLSHPNLVRLVGYC  159



>ref|XP_008369907.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=441

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 111/147 (76%), Gaps = 6/147 (4%)
 Frame = +1

Query  214  LMMGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  390
             +MG C S +IKAESP + G +SK      GSG    +S  S P TP+SEGEILQS  LK
Sbjct  46   FLMGACWSNKIKAESPLNTGFNSK-----QGSGSSGRNSSTSMPVTPRSEGEILQSTTLK  100

Query  391  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQ  570
            S +F++LK ATR+FR DSVLG+GGFG VFKGWID++SL  +K GTG+VIAVK+LN  G Q
Sbjct  101  SISFSELKTATRNFRPDSVLGDGGFGSVFKGWIDESSLIASKAGTGMVIAVKKLNQDGFQ  160

Query  571  GHSEWLAELNYLGQFSHPNLVKLIGYC  651
            GH EWLAE+NYLG+  HPNLVKLIGYC
Sbjct  161  GHKEWLAEINYLGELHHPNLVKLIGYC  187



>ref|XP_008233629.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=401

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 104/145 (72%), Gaps = 12/145 (8%)
 Frame = +1

Query  220  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  396
            MG C S RIKA+S  H GL S   +S+                TP++EGEILQS NLKSF
Sbjct  1    MGSCFSSRIKADSHLHNGLHSNSKVSSVSVP-----------STPRTEGEILQSSNLKSF  49

Query  397  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGH  576
             F +LK ATR+FR DS++GEGGFG VFKGW+D+NSL+  KPGTG+VIAVKRLN  GLQGH
Sbjct  50   AFNELKTATRNFRPDSMVGEGGFGCVFKGWVDENSLTAAKPGTGMVIAVKRLNQEGLQGH  109

Query  577  SEWLAELNYLGQFSHPNLVKLIGYC  651
             EWL E+NYLGQ  H NLV+LIGYC
Sbjct  110  KEWLTEINYLGQLHHENLVRLIGYC  134



>ref|XP_006827147.1| PREDICTED: protein kinase 2B, chloroplastic [Amborella trichopoda]
 gb|ERM94384.1| hypothetical protein AMTR_s00010p00251410 [Amborella trichopoda]
Length=409

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 109/154 (71%), Gaps = 12/154 (8%)
 Frame = +1

Query  220  MGICLSVRIKAESPH------PGLSSKCVI----STDGSGLGKSDSKNSPPQTPKSEGEI  369
            MG C      A++ H      P  SS   +     T GS  GKS+ +N P  TP++EGEI
Sbjct  1    MGNCFDKGGSAQTAHNSEISRPSNSSALTVPPSMQTSGSDSGKSNIENPP--TPRTEGEI  58

Query  370  LQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKR  549
            L SPNLK+FTF +LK ATR+FR DS++GEGGFG VFKGWID+ SLS +KPG+G+V+AVK+
Sbjct  59   LSSPNLKAFTFNELKNATRNFRPDSLIGEGGFGYVFKGWIDQQSLSASKPGSGMVVAVKK  118

Query  550  LNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            L   G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  119  LKPEGYQGHKEWLAEVNYLGQLHHPNLVKLIGYC  152



>ref|NP_001054444.1| Os05g0110900 [Oryza sativa Japonica Group]
 gb|AAK73157.1|AC079022_30 putative protein kinase [Oryza sativa]
 gb|AAU44204.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16358.1| Os05g0110900 [Oryza sativa Japonica Group]
 dbj|BAG93323.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62074.1| hypothetical protein OsJ_16858 [Oryza sativa Japonica Group]
Length=395

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = +1

Query  220  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  399
            MG C   +I +ESP    SS    ++  +      + + PP TP+SE EIL++ N+K+F 
Sbjct  1    MGNCWGAKISSESPCRSASSPSGGTSKYASNSSVSAASVPP-TPRSEDEILEAANVKAFA  59

Query  400  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHS  579
            F +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PTKPGTG+VIAVK+LN  G QGH 
Sbjct  60   FNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLAPTKPGTGMVIAVKKLNQEGHQGHR  119

Query  580  EWLAELNYLGQFSHPNLVKLIGYC  651
            EWLAE+NYLGQ SHP LV+L+GYC
Sbjct  120  EWLAEVNYLGQLSHPYLVRLVGYC  143



>ref|XP_006646742.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Oryza brachyantha]
Length=421

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  346  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  525
            TP+SEG+ILQS N++SF F +LK ATR+FR DSVLGEGGFG VFKGW+D+N+  PT+PGT
Sbjct  47   TPRSEGDILQSANVRSFAFTELKTATRNFRPDSVLGEGGFGSVFKGWVDENTFVPTRPGT  106

Query  526  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  651
            G++IAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  107  GMIIAVKKLNQDGFQGHREWLAEVNYLGQLSHPNLVKLVGYC  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1021470116141