BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1558

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234618.1|  acid beta-fructofuranosidase precursor             226   7e-67   
ref|XP_009794076.1|  PREDICTED: acid beta-fructofuranosidase AIV-18     228   8e-67   Nicotiana sylvestris
sp|P29000.1|INVA_SOLLC  RecName: Full=Acid beta-fructofuranosidas...    228   1e-66   Solanum lycopersicum
gb|ABX55832.1|  soluble acid invertase                                  228   1e-66   Cucumis melo [Oriental melon]
prf||1905419A  invertase                                                228   1e-66
ref|NP_001234843.1|  acid invertase                                     228   1e-66   
gb|ADE44160.1|  acid invertase                                          227   2e-66   Solanum lycopersicum var. cerasiforme [cherry tomato]
gb|ACC93585.1|  beta-fructofuranosidase                                 227   3e-66   Solanum tuberosum [potatoes]
ref|NP_001274993.1|  beta-fructosidase                                  227   3e-66   Solanum tuberosum [potatoes]
gb|AEV46296.1|  vacuolar invertase                                      227   3e-66   Solanum tuberosum [potatoes]
gb|AFH77956.1|  vacuolar invertase                                      226   3e-66   Manihot esculenta [manioc]
ref|XP_004143623.1|  PREDICTED: acid beta-fructofuranosidase-like       226   4e-66   Cucumis sativus [cucumbers]
gb|AAL75450.1|AF465613_1  minor allergen beta-fructofuranosidase ...    226   4e-66   Solanum lycopersicum
gb|ACC93584.1|  beta-fructofuranosidase                                 226   8e-66   Solanum tuberosum [potatoes]
gb|ADM47340.1|  vacuolar invertase                                      226   8e-66   Solanum tuberosum [potatoes]
gb|AAA50305.1|  beta-fructosidase                                       226   8e-66   Solanum tuberosum [potatoes]
gb|AEV46294.1|  vacuolar invertase                                      225   9e-66   Solanum tuberosum [potatoes]
gb|AEV46289.1|  vacuolar invertase                                      225   9e-66   Solanum tuberosum [potatoes]
gb|ABF18956.1|  acid invertase                                          225   9e-66   Solanum tuberosum [potatoes]
gb|AEV46287.1|  vacuolar invertase                                      225   1e-65   Solanum tuberosum [potatoes]
gb|AAQ17074.1|  acid invertase                                          225   1e-65   Solanum tuberosum [potatoes]
ref|XP_009619840.1|  PREDICTED: acid beta-fructofuranosidase AIV-...    223   6e-65   Nicotiana tomentosiformis
gb|AAK71504.1|  soluble acid invertase FRUCT2                           223   1e-64   Ipomoea batatas [batate]
ref|XP_002265534.1|  PREDICTED: beta-fructofuranosidase, soluble ...    223   1e-64   Vitis vinifera
ref|XP_011101190.1|  PREDICTED: beta-fructofuranosidase, soluble ...    222   1e-64   Sesamum indicum [beniseed]
ref|NP_001284469.1|  acid beta-fructofuranosidase-like                  222   2e-64   Cucumis melo [Oriental melon]
ref|XP_011000150.1|  PREDICTED: beta-fructofuranosidase, soluble ...    222   2e-64   Populus euphratica
sp|P93761.1|INV1_CAPAN  RecName: Full=Acid beta-fructofuranosidas...    221   3e-64   Capsicum annuum
emb|CAA49831.1|  beta-fructofuranosidase                                221   5e-64   Solanum tuberosum [potatoes]
gb|AFU25743.1|  truncated soluble acid invertase 1                      216   7e-64   Rhododendron hybrid cultivar
ref|XP_012090431.1|  PREDICTED: beta-fructofuranosidase, soluble ...    219   1e-63   Jatropha curcas
gb|AAB47171.1|  vacuolar invertase 1, GIN1                              219   2e-63   Vitis vinifera
gb|AAD10239.1|  invertase                                               219   2e-63   Oryza sativa Japonica Group [Japonica rice]
gb|AFP23357.1|  soluble acid invertase                                  219   3e-63   Litchi chinensis [litchi]
gb|AFU25742.1|  soluble acid invertase 2                                219   3e-63   Rhododendron hybrid cultivar
ref|XP_011101120.1|  PREDICTED: beta-fructofuranosidase, soluble ...    218   5e-63   Sesamum indicum [beniseed]
ref|XP_002446857.1|  hypothetical protein SORBIDRAFT_06g023760          218   8e-63   Sorghum bicolor [broomcorn]
gb|KJB19681.1|  hypothetical protein B456_003G114000                    217   1e-62   Gossypium raimondii
sp|P80065.2|INVB_DAUCA  RecName: Full=Beta-fructofuranosidase, so...    217   2e-62   Daucus carota [carrots]
emb|CAA53098.1|  beta-fructofuranosidase                                217   2e-62   Daucus carota [carrots]
emb|CAA53099.1|  beta-fructofuranosidase                                217   2e-62   Daucus carota [carrots]
ref|XP_011076337.1|  PREDICTED: beta-fructofuranosidase, soluble ...    216   2e-62   Sesamum indicum [beniseed]
gb|ABI17894.1|  vacuolar invertase                                      215   3e-62   Coffea canephora [robusta coffee]
ref|XP_010536536.1|  PREDICTED: acid beta-fructofuranosidase-like       216   3e-62   Tarenaya hassleriana [spider flower]
gb|AAK83982.1|AF393810_1  vacuolar invertase-like protein               204   3e-62   Apium graveolens
ref|XP_010672026.1|  PREDICTED: beta-fructofuranosidase, soluble ...    216   4e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|AGU12782.1|  vacuolar invertase 2a                                   214   7e-62   Gossypium hirsutum [American cotton]
gb|ACZ05614.1|  vacuolar invertase 2                                    214   8e-62   Gossypium hirsutum [American cotton]
ref|XP_009370474.1|  PREDICTED: beta-fructofuranosidase, soluble ...    215   1e-61   Pyrus x bretschneideri [bai li]
dbj|BAF35858.1|  Soluble acid invertase                                 215   1e-61   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_008376436.1|  PREDICTED: beta-fructofuranosidase, soluble ...    214   1e-61   Malus domestica [apple tree]
sp|P49175.1|INV1_MAIZE  RecName: Full=Beta-fructofuranosidase 1; ...    215   1e-61   Zea mays [maize]
ref|XP_007038396.1|  Glycosyl hydrolases family 32 protein isoform 2    210   1e-61   
dbj|BAG30919.1|  soluble acid invertase                                 214   1e-61   Pyrus pyrifolia [sha li]
gb|AFV59227.2|  vacuolar invertase NvINV                                214   1e-61   Elsholtzia haichowensis
ref|XP_008668436.1|  PREDICTED: uncharacterized protein LOC100383...    214   2e-61   Zea mays [maize]
gb|AFV59228.1|  vacuolar invertase CvINV                                214   2e-61   Elsholtzia haichowensis
ref|XP_003533514.1|  PREDICTED: beta-fructofuranosidase, soluble ...    214   2e-61   Glycine max [soybeans]
gb|KJB51448.1|  hypothetical protein B456_008G216800                    212   2e-61   Gossypium raimondii
gb|AFD62256.1|  acid invertase                                          214   3e-61   Kummerowia stipulacea
dbj|BAP47496.1|  invertase                                              214   3e-61   Gentiana triflora
ref|XP_007148711.1|  hypothetical protein PHAVU_005G008200g             213   3e-61   Phaseolus vulgaris [French bean]
gb|KJB51449.1|  hypothetical protein B456_008G216800                    210   4e-61   Gossypium raimondii
gb|KJB51450.1|  hypothetical protein B456_008G216800                    213   4e-61   Gossypium raimondii
ref|XP_010264216.1|  PREDICTED: beta-fructofuranosidase, soluble ...    213   5e-61   Nelumbo nucifera [Indian lotus]
gb|ACQ82802.1|  vacuolar invertase                                      213   5e-61   Gossypium hirsutum [American cotton]
ref|XP_007038395.1|  Glycosyl hydrolases family 32 protein isoform 1    213   6e-61   
gb|KJB51452.1|  hypothetical protein B456_008G216800                    213   6e-61   Gossypium raimondii
gb|KHN32440.1|  Beta-fructofuranosidase, soluble isoenzyme I            211   8e-61   Glycine soja [wild soybean]
sp|Q43857.1|INVA_VICFA  RecName: Full=Acid beta-fructofuranosidas...    212   8e-61   Vicia faba [broad bean]
gb|KJB51451.1|  hypothetical protein B456_008G216800                    213   9e-61   Gossypium raimondii
ref|XP_002321831.2|  hypothetical protein POPTR_0015s14790g             212   9e-61   
emb|CAD41525.3|  OSJNBb0020O11.6                                        212   1e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KDO65465.1|  hypothetical protein CISIN_1g006523mg                   208   1e-60   Citrus sinensis [apfelsine]
emb|CAH67112.1|  H0502G05.3                                             212   1e-60   Oryza sativa [red rice]
gb|EEC77707.1|  hypothetical protein OsI_16783                          212   1e-60   Oryza sativa Indica Group [Indian rice]
ref|NP_001053422.1|  Os04g0535600                                       212   1e-60   
gb|KDO65464.1|  hypothetical protein CISIN_1g006523mg                   209   1e-60   Citrus sinensis [apfelsine]
gb|KDO65463.1|  hypothetical protein CISIN_1g006523mg                   210   2e-60   Citrus sinensis [apfelsine]
ref|XP_003540575.1|  PREDICTED: beta-fructofuranosidase, soluble ...    211   2e-60   Glycine max [soybeans]
ref|XP_002510944.1|  Beta-fructofuranosidase, soluble isoenzyme I...    211   2e-60   
gb|AFD62255.1|  acid invertase                                          211   2e-60   Kummerowia stipulacea
ref|XP_004499664.1|  PREDICTED: beta-fructofuranosidase, soluble ...    211   2e-60   Cicer arietinum [garbanzo]
ref|XP_004976364.1|  PREDICTED: beta-fructofuranosidase 1-like          212   2e-60   Setaria italica
gb|ADP08983.1|  vacuolar invertase 1                                    211   2e-60   Gossypium hirsutum [American cotton]
gb|KDO65462.1|  hypothetical protein CISIN_1g006523mg                   210   2e-60   Citrus sinensis [apfelsine]
gb|KHN04338.1|  Acid beta-fructofuranosidase                            209   2e-60   Glycine soja [wild soybean]
gb|AAM52063.1|  vacuolar acid invertase PsI-1                           200   2e-60   Pisum sativum [garden pea]
gb|KDO65459.1|  hypothetical protein CISIN_1g006523mg                   211   3e-60   Citrus sinensis [apfelsine]
gb|AAM52062.1|  vacuolar acid invertase PsI-1                           211   3e-60   Pisum sativum [garden pea]
gb|AAL27709.3|AF433643_1  vacuolar invertase                            209   4e-60   Citrus sinensis [apfelsine]
gb|AES90955.2|  soluble acid invertase FRUCT2                           210   5e-60   Medicago truncatula
gb|AAK71505.2|  soluble acid invertase Ib2FRUCT3                        210   6e-60   Ipomoea batatas [batate]
ref|XP_010476187.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    210   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006421676.1|  hypothetical protein CICLE_v10004465mg             210   9e-60   
ref|XP_007218853.1|  hypothetical protein PRUPE_ppa002732mg             209   9e-60   
emb|CAA77268.1|  Inv*Dc4' protein                                       208   9e-60   Daucus carota [carrots]
ref|NP_001275874.1|  beta-fructofuranosidase, soluble isoenzyme I...    209   1e-59   Citrus sinensis [apfelsine]
ref|XP_003525803.1|  PREDICTED: acid beta-fructofuranosidase-like       209   1e-59   Glycine max [soybeans]
ref|XP_009374489.1|  PREDICTED: beta-fructofuranosidase, soluble ...    209   1e-59   Pyrus x bretschneideri [bai li]
gb|AHK05786.1|  vacuolar invertase                                      209   2e-59   Eriobotrya japonica [loquat]
ref|XP_007131343.1|  hypothetical protein PHAVU_011G005900g             208   2e-59   Phaseolus vulgaris [French bean]
gb|AFO84092.1|  vacuolar invertase                                      208   2e-59   Actinidia chinensis
ref|XP_010062212.1|  PREDICTED: beta-fructofuranosidase, soluble ...    209   2e-59   Eucalyptus grandis [rose gum]
gb|KHN09790.1|  Acid beta-fructofuranosidase                            208   2e-59   Glycine soja [wild soybean]
ref|NP_001284386.1|  acid beta-fructofuranosidase-like                  209   2e-59   Cucumis melo [Oriental melon]
gb|AAD01606.1|  beta-fructofuranosidase                                 208   2e-59   Ipomoea batatas [batate]
ref|XP_010106222.1|  hypothetical protein L484_003380                   208   3e-59   
gb|EPS61897.1|  soluble acid invertase 1                                206   3e-59   Genlisea aurea
ref|XP_004147588.1|  PREDICTED: acid beta-fructofuranosidase-like       208   3e-59   Cucumis sativus [cucumbers]
gb|AFU56882.1|  vacuolar invertase                                      208   3e-59   Malus domestica [apple tree]
ref|XP_003549902.1|  PREDICTED: acid beta-fructofuranosidase-like...    208   4e-59   Glycine max [soybeans]
ref|XP_004307805.1|  PREDICTED: beta-fructofuranosidase, soluble ...    207   4e-59   Fragaria vesca subsp. vesca
ref|NP_001275813.1|  acid beta-fructofuranosidase-like                  208   4e-59   Citrus sinensis [apfelsine]
ref|XP_011081205.1|  PREDICTED: beta-fructofuranosidase, soluble ...    207   5e-59   Sesamum indicum [beniseed]
ref|XP_008234397.1|  PREDICTED: beta-fructofuranosidase, soluble ...    207   5e-59   Prunus mume [ume]
ref|XP_007210314.1|  hypothetical protein PRUPE_ppa002334mg             207   6e-59   Prunus persica
ref|XP_004515737.1|  PREDICTED: acid beta-fructofuranosidase-like       207   6e-59   Cicer arietinum [garbanzo]
dbj|BAD91192.1|  soluble acid invertase                                 196   7e-59   Pyrus communis
gb|AES68467.2|  soluble acid invertase FRUCT2                           207   7e-59   Medicago truncatula
emb|CAA06839.1|  invertase                                              207   7e-59   Allium cepa
gb|KDO48371.1|  hypothetical protein CISIN_1g0052792mg                  205   9e-59   Citrus sinensis [apfelsine]
ref|XP_010458650.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    207   9e-59   Camelina sativa [gold-of-pleasure]
gb|ADF27779.1|  soluble acid invertase 1                                207   9e-59   Phelipanche ramosa
ref|XP_008794813.1|  PREDICTED: beta-fructofuranosidase 1-like          207   1e-58   Phoenix dactylifera
ref|XP_010493951.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    207   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_012087134.1|  PREDICTED: acid beta-fructofuranosidase-like       207   1e-58   Jatropha curcas
ref|XP_007039920.1|  Glycosyl hydrolases family 32 protein              208   1e-58   
gb|AJW82912.1|  acid invertase                                          206   1e-58   Dimocarpus longan [longan]
ref|XP_009775767.1|  PREDICTED: acid beta-fructofuranosidase-like       206   1e-58   Nicotiana sylvestris
ref|XP_006573732.1|  PREDICTED: acid beta-fructofuranosidase-like       207   1e-58   Glycine max [soybeans]
ref|XP_009630517.1|  PREDICTED: acid beta-fructofuranosidase-like       206   1e-58   Nicotiana tomentosiformis
gb|KHN42709.1|  Acid beta-fructofuranosidase                            206   1e-58   Glycine soja [wild soybean]
ref|XP_010259021.1|  PREDICTED: beta-fructofuranosidase, soluble ...    205   2e-58   Nelumbo nucifera [Indian lotus]
dbj|BAB82419.1|  acid invertase                                         206   2e-58   Citrus unshiu [satsuma mandarin]
ref|XP_003526374.1|  PREDICTED: beta-fructofuranosidase, soluble ...    206   2e-58   Glycine max [soybeans]
gb|KHN11662.1|  Beta-fructofuranosidase, soluble isoenzyme I            204   2e-58   Glycine soja [wild soybean]
ref|XP_010941127.1|  PREDICTED: beta-fructofuranosidase 1-like          206   2e-58   Elaeis guineensis
ref|XP_010259020.1|  PREDICTED: beta-fructofuranosidase, soluble ...    206   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009340588.1|  PREDICTED: beta-fructofuranosidase, soluble ...    205   3e-58   Pyrus x bretschneideri [bai li]
gb|AGW23637.1|  soluble acid invertase                                  205   3e-58   Lilium davidii
ref|XP_004298661.1|  PREDICTED: acid beta-fructofuranosidase-like       206   3e-58   Fragaria vesca subsp. vesca
gb|ACT21538.1|  acid invertase                                          204   4e-58   Vigna radiata [mung bean]
ref|XP_008373808.1|  PREDICTED: acid beta-fructofuranosidase            206   4e-58   
gb|AFH77957.1|  vacuolar invertase                                      205   4e-58   Manihot esculenta [manioc]
ref|XP_011033927.1|  PREDICTED: acid beta-fructofuranosidase            205   4e-58   Populus euphratica
ref|XP_003580229.1|  PREDICTED: beta-fructofuranosidase 1-like          205   5e-58   Brachypodium distachyon [annual false brome]
gb|AEB66649.1|  vacuole invertase                                       203   6e-58   
ref|XP_010430328.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    204   6e-58   Camelina sativa [gold-of-pleasure]
gb|AEB66648.1|  vacuole invertase                                       203   6e-58   
gb|AEY79729.1|  vacuolar invertase isoform 1                            203   7e-58   Rosa hybrid cultivar
ref|XP_003635662.2|  PREDICTED: acid beta-fructofuranosidase-like       196   7e-58   
ref|XP_003538727.1|  PREDICTED: acid beta-fructofuranosidase-like       204   8e-58   Glycine max [soybeans]
ref|XP_007157332.1|  hypothetical protein PHAVU_002G061200g             204   8e-58   Phaseolus vulgaris [French bean]
ref|XP_009350311.1|  PREDICTED: acid beta-fructofuranosidase-like       204   8e-58   Pyrus x bretschneideri [bai li]
dbj|BAF35859.1|  soluble acid invertase                                 205   8e-58   Pyrus pyrifolia var. culta [Asian pear]
emb|CDY30056.1|  BnaC05g09640D                                          204   9e-58   Brassica napus [oilseed rape]
ref|XP_009343902.1|  PREDICTED: acid beta-fructofuranosidase-like       204   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_008238615.1|  PREDICTED: acid beta-fructofuranosidase-like       204   1e-57   Prunus mume [ume]
gb|AFV94412.1|  soluble acid invertase 1                                204   1e-57   Saccharum hybrid cultivar GT28
gb|KJB51894.1|  hypothetical protein B456_008G236700                    201   1e-57   Gossypium raimondii
gb|KJB51889.1|  hypothetical protein B456_008G236700                    204   1e-57   Gossypium raimondii
sp|P29001.1|INVA_VIGRR  RecName: Full=Acid beta-fructofuranosidas...    204   1e-57   Vigna radiata var. radiata [golden gram]
emb|CDY39804.1|  BnaA09g10560D                                          203   1e-57   Brassica napus [oilseed rape]
ref|NP_001234069.1|  invertase                                          204   1e-57   Solanum lycopersicum
ref|XP_009112697.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    204   1e-57   Brassica rapa
gb|AFV94469.1|  soluble acid invertase 6                                204   2e-57   Saccharum hybrid cultivar GT28
ref|XP_007155629.1|  hypothetical protein PHAVU_003G217900g             203   2e-57   Phaseolus vulgaris [French bean]
ref|XP_010053435.1|  PREDICTED: acid beta-fructofuranosidase-like       203   2e-57   Eucalyptus grandis [rose gum]
sp|O24509.1|INVA_PHAVU  RecName: Full=Acid beta-fructofuranosidas...    203   2e-57   Phaseolus vulgaris [French bean]
emb|CDY03265.1|  BnaC09g10830D                                          203   2e-57   
gb|AFJ21575.1|  vacuolar invertase                                      203   2e-57   Agave tequilana
gb|KFK40589.1|  hypothetical protein AALP_AA2G015400                    203   2e-57   Arabis alpina [alpine rockcress]
ref|XP_002889923.1|  beta-fructosidase                                  203   2e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_006355490.1|  PREDICTED: acid beta-fructofuranosidase-like       203   2e-57   Solanum tuberosum [potatoes]
ref|XP_010418267.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    203   2e-57   Camelina sativa [gold-of-pleasure]
gb|AAP59436.1|  soluble acid invertase                                  202   3e-57   Saccharum hybrid cultivar Pindar
gb|AAG36943.1|AF274299_1  acid invertase                                203   3e-57   Brassica oleracea
gb|AAB71136.1|  acid invertase                                          203   3e-57   Asparagus officinalis
ref|XP_002303519.1|  vacuolar invertase family protein                  203   3e-57   Populus trichocarpa [western balsam poplar]
gb|AAM77272.1|AF519809_1  acid invertase                                203   3e-57   Lagenaria siceraria [bottle gourd]
ref|XP_006391837.1|  hypothetical protein EUTSA_v10023331mg             203   3e-57   Eutrema salsugineum [saltwater cress]
gb|AFV94413.1|  soluble acid invertase 2                                203   3e-57   Saccharum hybrid cultivar GT28
emb|CDX98080.1|  BnaA06g08310D                                          202   3e-57   
ref|XP_009401797.1|  PREDICTED: beta-fructofuranosidase 1-like          202   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFR69121.1|  vacuolar invertase                                      202   4e-57   Manihot esculenta [manioc]
gb|AFS17280.1|  acid vacuolar invertase                                 202   5e-57   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
ref|XP_009148607.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    202   5e-57   Brassica rapa
gb|AEY79730.1|  vacuolar invertase isoform 2                            202   5e-57   Rosa hybrid cultivar
gb|AFV94472.1|  soluble acid invertase 9                                202   5e-57   Saccharum hybrid cultivar GT28
gb|AFV94468.1|  soluble acid invertase 4                                202   6e-57   Saccharum hybrid cultivar GT28
ref|XP_006300839.1|  hypothetical protein CARUB_v10019930mg             202   7e-57   Capsella rubella
gb|AFV94414.1|  soluble acid invertase 3                                202   8e-57   Saccharum hybrid cultivar GT28
ref|XP_002888009.1|  predicted protein                                  201   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010473488.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    201   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010676175.1|  PREDICTED: acid beta-fructofuranosidase-like...    201   1e-56   Beta vulgaris subsp. vulgaris [field beet]
emb|CAD19321.1|  acid vacuolar invertase                                201   1e-56   Beta vulgaris [beet]
ref|XP_008787011.1|  PREDICTED: beta-fructofuranosidase 1               201   1e-56   Phoenix dactylifera
ref|NP_001292789.1|  invertase2                                         201   1e-56   Zea mays [maize]
gb|AFV94471.1|  soluble acid invertase 8                                201   2e-56   Saccharum hybrid cultivar GT28
gb|KJB37599.1|  hypothetical protein B456_006G212600                    197   2e-56   Gossypium raimondii
gb|AGR51646.1|  soluble acid invertase                                  200   2e-56   Saccharum hybrid cultivar Pindar
emb|CDY46906.1|  BnaA09g12880D                                          201   2e-56   Brassica napus [oilseed rape]
ref|XP_010919478.1|  PREDICTED: beta-fructofuranosidase 1 isoform X1    201   2e-56   Elaeis guineensis
ref|XP_010676174.1|  PREDICTED: acid beta-fructofuranosidase-like...    201   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009113064.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    201   2e-56   Brassica rapa
gb|AFV94470.1|  soluble acid invertase 7                                201   2e-56   Saccharum hybrid cultivar GT28
ref|XP_010906620.1|  PREDICTED: beta-fructofuranosidase 1-like          200   2e-56   Elaeis guineensis
ref|NP_563901.1|  acid beta-fructofuranosidase 4                        201   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653622.1|  PREDICTED: beta-fructofuranosidase 1-like          200   2e-56   
emb|CAA66330.1|  beta-fructosidase                                      200   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAG36942.1|AF274298_1  acid invertase                                200   3e-56   Brassica oleracea
ref|XP_004511663.1|  PREDICTED: acid beta-fructofuranosidase-like       200   3e-56   Cicer arietinum [garbanzo]
gb|AAF87245.1|AF276703_1  vacuolar acid invertase                       200   3e-56   Oryza sativa [red rice]
emb|CDY26548.1|  BnaA09g47290D                                          200   3e-56   Brassica napus [oilseed rape]
ref|XP_009118103.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    200   3e-56   Brassica rapa
gb|AGO03823.1|  soluble acid invertase                                  200   3e-56   Sorghum bicolor [broomcorn]
gb|KJB37601.1|  hypothetical protein B456_006G212600                    199   4e-56   Gossypium raimondii
gb|AAF87246.1|AF276704_1  vacuolar acid invertase                       200   4e-56   Oryza sativa [red rice]
ref|NP_001045626.1|  Os02g0106100                                       200   4e-56   
gb|AFV94475.1|  soluble acid invertase 12                               200   4e-56   Saccharum hybrid cultivar GT28
gb|AAK62665.1|  At1g62660/F23N19_3                                      199   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ21424.1|  hypothetical protein OsJ_05029                          198   4e-56   Oryza sativa Japonica Group [Japonica rice]
emb|CAA64781.1|  beta-fructosidase                                      199   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|ACY78467.1|  soluble acid invertase                                  198   4e-56   Sorghum bicolor [broomcorn]
gb|AAB47172.1|  vacuolar invertase 2, GIN2                              199   5e-56   Vitis vinifera
ref|NP_564798.1|  acid beta-fructofuranosidase 3                        199   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933713.1|  PREDICTED: beta-fructofuranosidase 1               199   5e-56   Elaeis guineensis
gb|KJB37598.1|  hypothetical protein B456_006G212600                    199   5e-56   Gossypium raimondii
ref|XP_008796841.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    199   6e-56   
emb|CDY31826.1|  BnaC09g13230D                                          199   6e-56   Brassica napus [oilseed rape]
gb|AFV94467.1|  soluble acid invertase 5                                200   6e-56   Saccharum hybrid cultivar GT28
gb|AFV94473.1|  soluble acid invertase 10                               199   7e-56   Saccharum hybrid cultivar GT28
ref|XP_006646767.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    199   7e-56   Oryza brachyantha
ref|XP_004951208.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose:sucr...    199   1e-55   Setaria italica
ref|XP_010093687.1|  Acid beta-fructofuranosidase                       199   1e-55   Morus notabilis
emb|CAA61624.1|  beta-fructofuranosidase                                197   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417255.1|  hypothetical protein EUTSA_v10007016mg             198   1e-55   Eutrema salsugineum [saltwater cress]
ref|XP_003608758.1|  Acid beta-fructofuranosidase                       198   1e-55   
gb|AAC16654.1|  soluble acid invertase                                  197   2e-55   Saccharum robustum
gb|AAS88729.1|  vacuolar invertase1                                     198   2e-55   Triticum monococcum [einkorn wheat]
gb|AAC16655.1|  soluble acid invertase                                  196   2e-55   Saccharum officinarum [noble cane]
gb|ACJ04701.1|  invertase 1                                             198   2e-55   Cucumis melo [Oriental melon]
ref|XP_010546426.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    198   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_011623822.1|  PREDICTED: beta-fructofuranosidase, soluble ...    197   2e-55   Amborella trichopoda
gb|AAK72493.2|  soluble acid invertase bfruct3                          198   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|ABB77251.1|  vacuolar invertase BObetaFRUCT3                         197   2e-55   Bambusa oldhamii
gb|AGO03820.1|  soluble acid invertase                                  197   3e-55   Sorghum bicolor [broomcorn]
gb|AFH57543.1|  soluble acid invertase                                  197   3e-55   Sorghum bicolor [broomcorn]
emb|CBI24585.3|  unnamed protein product                                196   3e-55   Vitis vinifera
gb|EMT19916.1|  Beta-fructofuranosidase 1                               197   3e-55   
gb|KHN42772.1|  Beta-fructofuranosidase, soluble isoenzyme I            195   3e-55   Glycine soja [wild soybean]
emb|CDP09916.1|  unnamed protein product                                197   3e-55   Coffea canephora [robusta coffee]
ref|XP_009384549.1|  PREDICTED: beta-fructofuranosidase 1-like          197   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACY78465.1|  soluble acid invertase                                  196   4e-55   Sorghum bicolor [broomcorn]
gb|ACY78464.1|  soluble acid invertase                                  196   4e-55   Sorghum bicolor [broomcorn]
gb|AEX15265.1|  vacuolar invertase                                      197   4e-55   Musa acuminata AAA Group [Cavendish banana]
emb|CBI14850.3|  unnamed protein product                                185   4e-55   Vitis vinifera
emb|CAA47636.1|  soluble beta-fructosidase                              197   4e-55   Daucus carota [carrots]
gb|AJO70155.1|  invertase 5                                             196   6e-55   Camellia sinensis [black tea]
dbj|BAJ93214.1|  predicted protein                                      196   6e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFV94474.1|  soluble acid invertase 11                               197   6e-55   Saccharum hybrid cultivar GT28
ref|XP_008680035.1|  PREDICTED: beta-fructofuranosidase 1-like          194   7e-55   Zea mays [maize]
ref|XP_002532576.1|  Acid beta-fructofuranosidase precursor, puta...    196   7e-55   Ricinus communis
gb|AAL92880.1|  fructosyltransferase                                    196   1e-54   Lolium perenne [perennial ryegrass]
ref|XP_010533769.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    196   1e-54   Tarenaya hassleriana [spider flower]
dbj|BAM74660.1|  acid invertase                                         184   1e-54   Ipomoea batatas [batate]
ref|XP_010259194.1|  PREDICTED: beta-fructofuranosidase, soluble ...    194   1e-54   Nelumbo nucifera [Indian lotus]
gb|AFW66816.1|  hypothetical protein ZEAMMB73_813171                    194   1e-54   
gb|AAK72492.2|  soluble acid invertase bfruct2                          196   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011070162.1|  PREDICTED: beta-fructofuranosidase, soluble ...    195   2e-54   
ref|XP_010259193.1|  PREDICTED: beta-fructofuranosidase, soluble ...    195   2e-54   Nelumbo nucifera [Indian lotus]
emb|CAD58681.1|  putative soluble acid invertase                        195   2e-54   Lolium temulentum
emb|CAG25609.1|  acid beta-fructofuranosidase precursor                 195   3e-54   Triticum aestivum [Canadian hard winter wheat]
gb|AFN66440.1|  soluble acid invertase                                  193   4e-54   Saccharum hybrid cultivar [sugarcane]
gb|EMT19915.1|  Beta-fructofuranosidase 1                               194   4e-54   
dbj|BAJ94230.1|  predicted protein                                      194   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD91193.1|  soluble acid invertase                                 183   5e-54   Pyrus communis
dbj|BAK03249.1|  predicted protein                                      194   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFN66439.1|  soluble acid invertase                                  192   5e-54   
dbj|BAJ87063.1|  predicted protein                                      194   6e-54   
emb|CAF22241.1|  soluble acid invertase                                 193   7e-54   
ref|XP_003571181.2|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    194   8e-54   
gb|KJB25624.1|  hypothetical protein B456_004G200800                    192   3e-53   
gb|EMT19913.1|  Beta-fructofuranosidase 1                               192   3e-53   
gb|ERM94735.1|  hypothetical protein AMTR_s00011p00252750               191   3e-53   
emb|CAD58684.1|  putative soluble acid invertase                        182   3e-53   
gb|KHN34956.1|  Acid beta-fructofuranosidase                            192   3e-53   
gb|KJB51893.1|  hypothetical protein B456_008G236700                    191   3e-53   
pdb|3UGF|A  Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachy...    189   9e-53   
emb|CAA06838.1|  sucrose sucrose 1-fructosyltransferase                 189   1e-52   
emb|CBM41476.2|  sucrose:(sucrose/fructan) 6-fructosyltransferase...    190   2e-52   
dbj|BAD91194.1|  soluble acid invertase                                 179   3e-52   
ref|XP_008778382.1|  PREDICTED: beta-fructofuranosidase 1-like          187   4e-52   
ref|XP_010919479.1|  PREDICTED: beta-fructofuranosidase 1 isoform X2    188   5e-52   
gb|AAL87233.1|AF481763_1  fructosyltransferase                          188   6e-52   
ref|XP_011022761.1|  PREDICTED: acid beta-fructofuranosidase-like       187   1e-51   
ref|XP_002272809.3|  PREDICTED: acid beta-fructofuranosidase-like       187   1e-51   
gb|EYU30506.1|  hypothetical protein MIMGU_mgv1a0199921mg               186   1e-51   
gb|AAF19535.1|AC007190_3  F23N19.3                                      187   2e-51   
gb|EMT19914.1|  Beta-fructofuranosidase 1                               185   3e-51   
gb|AAM21931.1|  sucrose:sucrose 1-fructosyltransferase                  186   3e-51   
gb|AAD43622.1|AC005698_21  T3P18.21                                     186   3e-51   
emb|CAA66238.1|  invertase 6                                            186   4e-51   
ref|XP_002303584.2|  hypothetical protein POPTR_0003s12640g             185   4e-51   
ref|XP_010419461.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    180   5e-51   
gb|ACS92722.1|  vacuolar invertase                                      186   5e-51   
gb|ADF27780.1|  soluble acid invertase 2                                184   7e-51   
emb|CDY15984.1|  BnaC08g41390D                                          185   1e-50   
emb|CAA64953.1|  invertase                                              184   1e-50   
emb|CAD58683.1|  putative soluble acid invertase                        182   4e-50   
emb|CDY39805.1|  BnaA09g10570D                                          182   4e-50   
ref|XP_010430330.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    183   4e-50   
emb|CAD12104.1|  beta-fructofuranosidase                                183   4e-50   
ref|XP_010473489.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    183   5e-50   
gb|EMS61371.1|  Acid beta-fructofuranosidase                            182   5e-50   
dbj|BAM66575.1|  sucrose:sucrose 1-fructosyltransferase                 182   1e-49   
emb|CDY03264.1|  BnaC09g10840D                                          181   1e-49   
emb|CAA70855.1|  sucrose sucrose 1-fructosyltransferase                 181   2e-49   
ref|XP_009406946.1|  PREDICTED: beta-fructofuranosidase 1-like          179   3e-49   
emb|CAA66237.1|  invertase 5                                            181   3e-49   
gb|AAZ29516.1|  fructosyltransferase-like protein                       180   7e-49   
dbj|BAK04106.1|  predicted protein                                      179   8e-49   
dbj|BAJ91277.1|  predicted protein                                      179   9e-49   
dbj|BAJ88350.1|  predicted protein                                      179   1e-48   
gb|AFP72238.1|  sucrose:sucrose 1-fructosyltransferase                  179   1e-48   
dbj|BAJ97223.1|  predicted protein                                      179   1e-48   
sp|Q9FSV7.1|SST_FESAR  RecName: Full=Sucrose:sucrose 1-fructosylt...    178   2e-48   
gb|AFP72241.1|  vacuolar invertase                                      178   3e-48   
dbj|BAB82470.1|  sucrose:sucrose 1-fructosytransferase                  178   3e-48   
dbj|BAF99808.1|  fructan:fructan 6G-fructosyltransferase 2              177   4e-48   
gb|AFP72239.1|  fructan-fructan 1-fructosyltransferase                  177   4e-48   
dbj|BAJ85557.1|  predicted protein                                      177   4e-48   
emb|CAD98793.2|  sucrose-sucrose-1-fructosyltransferase                 177   6e-48   
ref|XP_006300852.1|  hypothetical protein CARUB_v10019944mg             177   6e-48   
gb|ACH73196.1|  sucrose:sucrose 1-fructosyltransferase                  177   6e-48   
gb|AFB83198.1|  sucrose:sucrose 1-fructosyl transferase                 175   2e-47   
gb|AAB58909.1|  sucrose:sucrose 1-fructosyl transferase                 175   3e-47   
emb|CAB60153.1|  sucrose:sucrose 1-fructosyl transferase                175   3e-47   
gb|AFK29572.1|  sucrose: sucrose-1-fructosyltransferase                 175   3e-47   
gb|ACL13556.1|  sucrose:sucrose 1-fructosyltransferase                  175   4e-47   
gb|ABD72592.1|  fructosyltransferase FTa                                174   5e-47   
emb|CAL51273.1|  putative sucrose:sucrose 1-fructosyltransferase        174   5e-47   
gb|AAO86693.1|  sucrose:sucrose 1-fructosyltransferase                  174   6e-47   
dbj|BAF99807.1|  sucrose:sucrose fructosyltransferase                   174   6e-47   
emb|CAL51272.1|  putative fructan:fructan 6G-fructosyltransferase       174   7e-47   
gb|AAM13671.1|AF492836_1  fructan:fructan 6G-fructosyltransferase       174   8e-47   
gb|ABX90019.1|  sucrose:sucrose 1-fructosyltransferase                  174   1e-46   
gb|ACL13558.1|  sucrose:sucrose 1-fructosyltransferase                  174   1e-46   
gb|AFJ21570.1|  sucrose:sucrose 1-fructosyltransferase                  173   1e-46   
gb|ABG00265.1|  sucrose:sucrose 1-fructosyltransferase                  173   1e-46   
gb|EMT14935.1|  Beta-fructofuranosidase 1                               172   1e-46   
gb|EMT16812.1|  6(G)-fructosyltransferase                               172   2e-46   
gb|AFJ21576.1|  sucrose:sucrose 1-fructosyltransferase                  172   2e-46   
gb|EMS56293.1|  Beta-fructofuranosidase 1                               172   2e-46   
gb|ACH73188.1|  fructan:fructan 1-fructosyltransferase                  172   2e-46   
gb|ACH73189.1|  fructan:fructan 1-fructosyltransferase                  172   2e-46   
gb|AFJ21571.1|  sucrose:sucrose 1-fructosyltransferase                  172   3e-46   
gb|ACL13557.1|  sucrose:sucrose 1-fructosyltransferase                  172   3e-46   
gb|ACH73190.1|  fructan:fructan 1-fructosyltransferase                  172   3e-46   
gb|AFU35318.1|  soluble acid beta-fructofuranosidase                    165   3e-46   
dbj|BAE19752.1|  fructan:fructan 1-fructosyltransferase                 172   4e-46   
dbj|BAD26613.1|  putative fructosyltransferase2                         172   5e-46   
gb|EMS52383.1|  Beta-fructofuranosidase 1                               171   6e-46   
emb|CAA08812.1|  sucrose 1F-fructosyltransferase                        171   8e-46   
gb|ACH73191.1|  fructan:fructan 1-fructosyltransferase                  171   1e-45   
dbj|BAE19751.1|  fructan:fructan 1-fructosyltransferase                 170   2e-45   
gb|EMT11750.1|  Beta-fructofuranosidase 1                               169   3e-45   
emb|CAA72109.1|  vacuolar invertase                                     160   3e-45   
emb|CAA72114.1|  vacuolar invertase                                     160   5e-45   
ref|XP_011010942.1|  PREDICTED: beta-fructofuranosidase, soluble ...    167   8e-45   
gb|ACL14897.1|  fructan:fructan 1-fructosyltransferase                  168   9e-45   
gb|EMT23832.1|  6(G)-fructosyltransferase                               167   1e-44   
emb|CAA72112.1|  vacuolar invertase                                     159   1e-44   
gb|KEH31660.1|  soluble acid invertase FRUCT2                           165   5e-44   
gb|KHG24404.1|  Beta-fructofuranosidase, soluble isoenzyme I            160   6e-44   
emb|CAA72113.1|  vacuolar invertase                                     157   6e-44   
gb|EMT24081.1|  Beta-fructofuranosidase 1                               166   8e-44   
gb|AFJ21573.1|  fructan:fructan 6G-fructosyltransferase                 165   1e-43   
gb|AFJ21579.1|  fructan:fructan 6G-fructosyltransferase                 165   1e-43   
gb|AFP72242.1|  vacuolar invertase                                      164   1e-43   
dbj|BAK05319.1|  predicted protein                                      164   1e-43   
dbj|BAO09621.1|  fructosyltransferase                                   164   2e-43   
gb|KHG09862.1|  Beta-fructofuranosidase, soluble isoenzyme I            163   2e-43   
sp|Q5FC15.1|GFT_ASPOF  RecName: Full=6(G)-fructosyltransferase; A...    164   3e-43   
emb|CAA72111.1|  vacuolar invertase                                     155   3e-43   
gb|ACN93835.1|  putative sucrose:fructan 6-fructosyltransferase         163   5e-43   
dbj|BAB82420.1|  acid invertase                                         153   1e-42   
emb|CDP05324.1|  unnamed protein product                                161   2e-42   
gb|EMS55535.1|  Beta-fructofuranosidase 1                               160   2e-42   
gb|AFP72240.1|  sucrose:fructan 6-fructosyltransferase                  161   2e-42   
emb|CAA58235.1|  sucrose:fructan 6-fructosyltransferase                 161   3e-42   
pir||JC7905  fructan 6-fructosyltransferase - wheat                     160   5e-42
dbj|BAB82469.1|  sucrose:fructan 6-fructosyltransferase                 160   5e-42   
gb|KDO65460.1|  hypothetical protein CISIN_1g006523mg                   159   6e-42   
gb|ACH73193.1|  sucrose:fructan 6-fructosyltransferase                  160   6e-42   
dbj|BAH30252.1|  sucrose: fructan 6-fructosyltransferase                160   7e-42   
gb|EMT14599.1|  Beta-fructofuranosidase, soluble isoenzyme I            159   1e-41   
emb|CDP08273.1|  unnamed protein product                                159   2e-41   
gb|ABS72186.1|  fructan:fructan 1-fructosyltransferase                  159   2e-41   
gb|ADP38058.1|  putative sucrose:fructan fructosyl transferase 2        158   2e-41   
gb|AAK27319.1|AF211253_1  sucrose:fructan 6-fructosyltransferase        158   2e-41   
dbj|BAH30253.1|  putative fructosyltransferase                          152   3e-41   
ref|XP_006647344.1|  PREDICTED: beta-fructofuranosidase, insolubl...    158   3e-41   
dbj|BAM74659.1|  acid invertase                                         149   3e-41   
gb|AFK29573.1|  sucrose: fructan 6-fructosyltransferase                 158   3e-41   
gb|AAG36767.1|AF192394_1  sucrose:fructan 6-fructosyltransferase        157   5e-41   
emb|CAH25486.1|  1,2-beta-fructan 1F-fructosyltransferase               157   5e-41   
dbj|BAM74038.1|  cell wall invertase                                    157   6e-41   
ref|XP_007029650.1|  Glycosyl hydrolases family 32 protein, putative    155   7e-41   
gb|ACH73195.1|  sucrose:fructan 6-fructosyltransferase                  157   7e-41   
ref|XP_002976640.1|  hypothetical protein SELMODRAFT_10966              156   7e-41   
emb|CAA08811.1|  1,2-beta-fructan 1F-fructosyltransferase               156   1e-40   
dbj|BAJ88320.1|  predicted protein                                      156   1e-40   
ref|XP_007218855.1|  hypothetical protein PRUPE_ppa002732mg             155   1e-40   
ref|XP_003598216.1|  Acid beta-fructofuranosidase                       155   1e-40   
emb|CAA04120.2|  fructan fructan 1-fructosyltransferase                 156   1e-40   
gb|EMT09009.1|  Beta-fructofuranosidase, soluble isoenzyme I            156   2e-40   
gb|ACH73194.1|  sucrose:fructan 6-fructosyltransferase                  156   2e-40   
sp|A2X5P7.2|INV1_ORYSI  RecName: Full=Beta-fructofuranosidase, in...    155   2e-40   
ref|XP_001783601.1|  predicted protein                                  155   2e-40   
gb|ACH73192.1|  sucrose:fructan 6-fructosyltransferase                  155   2e-40   
ref|NP_001047034.1|  Os02g0534400                                       155   2e-40   
dbj|BAB90855.1|  cell wall invertase                                    155   2e-40   
ref|XP_002278880.2|  PREDICTED: beta-fructofuranosidase, insolubl...    155   2e-40   
gb|AAL05427.2|  vacuolar acid invertase                                 155   2e-40   
gb|ACI43225.3|  sucrose:fructan 6-fructosyltransferase                  155   2e-40   
emb|CAC81826.1|  beta-fructofuranosidase                                150   2e-40   
gb|ADE60637.1|  CIN1                                                    155   3e-40   
emb|CAH25487.1|  1,2-beta-fructan 1F-fructosyltransferase               155   3e-40   
gb|EMT23831.1|  hypothetical protein F775_52102                         154   4e-40   
ref|XP_002973210.1|  hypothetical protein SELMODRAFT_98949              155   4e-40   
gb|ADP38057.1|  putative sucrose:fructan fructosyl transferase 1        155   4e-40   
gb|ABX90020.1|  fructan:fructan 1-fructosyltransferase                  154   5e-40   
ref|XP_004975575.1|  PREDICTED: beta-fructofuranosidase, insolubl...    154   6e-40   
ref|XP_001764172.1|  predicted protein                                  154   6e-40   
dbj|BAJ24841.1|  fructan:fructan 1-fructosyltransferase                 154   7e-40   
gb|ADE60661.1|  CIN1                                                    154   7e-40   
gb|AFB83199.1|  fructan-fructan 1-fructosyltransferase                  154   7e-40   
emb|CDP08274.1|  unnamed protein product                                154   8e-40   
ref|XP_004141427.1|  PREDICTED: beta-fructofuranosidase, insolubl...    153   9e-40   
emb|CAA72110.1|  vacuolar invertase                                     146   1e-39   
gb|EMT29525.1|  6(G)-fructosyltransferase                               153   1e-39   
tpg|DAA37899.1|  TPA: miniature seed1                                   153   1e-39   
dbj|BAJ95733.1|  predicted protein                                      153   1e-39   
ref|XP_006652264.1|  PREDICTED: beta-fructofuranosidase, insolubl...    153   1e-39   
gb|ACG47298.1|  beta-fructofuranosidase, insoluble isoenzyme 2 pr...    153   1e-39   
gb|AAF06992.1|AF165180_1  cell wall invertase 2                         153   1e-39   
ref|XP_003575078.1|  PREDICTED: beta-fructofuranosidase, insolubl...    153   1e-39   
ref|XP_008452732.1|  PREDICTED: beta-fructofuranosidase, insolubl...    153   1e-39   
gb|KJB65535.1|  hypothetical protein B456_010G099300                    151   1e-39   
gb|AAF06991.1|AF165179_1  cell wall invertase 2                         153   1e-39   
gb|AAD02510.1|  cell wall invertase Incw2                               153   1e-39   
ref|NP_001105596.1|  miniature seed1 precursor                          153   1e-39   
gb|ABB77250.1|  cell wall invertase BObetaFRUCT2                        153   2e-39   
sp|P92916.1|GFT_ALLCE  RecName: Full=Bifunctional 6(G)-fructosylt...    153   2e-39   
gb|KJB65537.1|  hypothetical protein B456_010G099300                    153   2e-39   
gb|AAD00558.1|  fructan-fructan 1-fructosyltransferase                  153   2e-39   
ref|XP_007012302.1|  Glycosyl hydrolases family 32 protein, putative    152   2e-39   
gb|ADE60654.1|  CIN1                                                    152   2e-39   
gb|ADE60636.1|  CIN1                                                    152   3e-39   
ref|NP_001151535.1|  beta-fructofuranosidase, insoluble isoenzyme...    152   4e-39   
emb|CDP08275.1|  unnamed protein product                                152   4e-39   
ref|XP_010262079.1|  PREDICTED: beta-fructofuranosidase, insolubl...    152   4e-39   
gb|AFW58192.1|  beta-fructofuranosidase, insoluble isoenzyme 2          152   4e-39   
dbj|BAM66574.1|  fructan:fructan 1-fructosyltransferase                 152   4e-39   
ref|XP_011019433.1|  PREDICTED: beta-fructofuranosidase, insolubl...    151   5e-39   
ref|XP_002466502.1|  hypothetical protein SORBIDRAFT_01g008910          151   6e-39   
gb|ADE60629.1|  CIN1                                                    151   6e-39   
emb|CAH18892.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    151   6e-39   
ref|XP_002309496.1|  invertase family protein                           151   7e-39   
gb|AFJ21578.1|  fructan:fructan 6G-fructosyltransferase                 151   8e-39   
gb|ADP38056.1|  putative sucrose:fructan fructosyl transferase          150   1e-38   
emb|CAH18891.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    150   1e-38   
gb|AFH77950.1|  cell wall invertase                                     150   1e-38   
dbj|BAF93492.1|  putative cell wall invertase                           150   1e-38   
ref|XP_004975572.1|  PREDICTED: beta-fructofuranosidase, insolubl...    150   1e-38   
dbj|BAM74664.1|  acid invertase                                         141   1e-38   
gb|AAV70979.1|  vacuolar invertase                                      144   2e-38   
emb|CAH18937.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    150   2e-38   
gb|EMS57418.1|  Beta-fructofuranosidase, soluble isoenzyme I            152   2e-38   
emb|CDM80288.1|  unnamed protein product                                150   2e-38   
ref|XP_011628522.1|  PREDICTED: beta-fructofuranosidase, insolubl...    150   2e-38   
gb|AAF06993.1|AF165181_1  cell wall invertase                           150   2e-38   
ref|XP_010049203.1|  PREDICTED: beta-fructofuranosidase, insolubl...    149   2e-38   
ref|XP_009404355.1|  PREDICTED: beta-fructofuranosidase, insolubl...    149   3e-38   
ref|XP_010648345.1|  PREDICTED: beta-fructofuranosidase, insolubl...    149   3e-38   
ref|XP_011623827.1|  PREDICTED: beta-fructofuranosidase, insolubl...    149   3e-38   
gb|AAZ29515.1|  cell wall invertase                                     149   3e-38   
emb|CDM80514.1|  unnamed protein product                                149   4e-38   
ref|XP_010648344.1|  PREDICTED: beta-fructofuranosidase, insolubl...    149   4e-38   
gb|AGT16261.1|  beta-fructofuranosidase                                 149   4e-38   
ref|XP_003546695.1|  PREDICTED: beta-fructofuranosidase, cell wal...    149   4e-38   
emb|CAC81921.1|  cell wall invertase                                    148   5e-38   
ref|XP_010097051.1|  Beta-fructofuranosidase, insoluble isoenzyme...    149   5e-38   
ref|XP_004952653.1|  PREDICTED: beta-fructofuranosidase, cell wal...    149   5e-38   
gb|ADE60650.1|  CIN1                                                    149   5e-38   
ref|XP_010912306.1|  PREDICTED: beta-fructofuranosidase, insolubl...    149   5e-38   
emb|CAD19323.1|  exocellular acid invertase 2                           149   5e-38   
ref|XP_010669385.1|  PREDICTED: beta-fructofuranosidase, insolubl...    149   5e-38   



>ref|NP_001234618.1| acid beta-fructofuranosidase precursor [Solanum lycopersicum]
 gb|AAL75449.1|AF465612_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
 dbj|BAA01954.1| beta-fructosidase [Solanum lycopersicum]
Length=553

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A    V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W 
Sbjct  84   DVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-  142

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQ
Sbjct  143  GNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQ  202

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPANLSDPLL
Sbjct  203  VQNLAYPANLSDPLL  217



>ref|XP_009794076.1| PREDICTED: acid beta-fructofuranosidase AIV-18 [Nicotiana sylvestris]
Length=643

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 167/228 (73%), Gaps = 16/228 (7%)
 Frame = +1

Query  16   MATGSSSYKPP-----YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnh  180
            MAT  S Y P      YT L D+ ESAGA    R+SLK  +  L+S   ++  V V+LN 
Sbjct  1    MATHHSHYDPENSTTHYTVLPDQPESAGAGR--RKSLKVVSGILLSSFFLLSLVFVILNQ  58

Query  181  sselvKD--ETSQQPSPSLK---AAGDVIPSVEEAAGDGVPYS-WTNRMLSWQRTAFHFQ  342
            SS+L ++   +S+  +P+L    + G    + ++ +G  + Y  WTN ML+WQRTA+HFQ
Sbjct  59   SSDLSQENSRSSETLTPALSRGVSQGVSEKTFKDVSGRSLSYYPWTNAMLTWQRTAYHFQ  118

Query  343  PPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQ  522
            P K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGHA+S D+IHWL+LP+AM+PDQ
Sbjct  119  PQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGHAISTDLIHWLYLPFAMVPDQ  177

Query  523  PYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             YD+ GVWTGSAT LPDGQIMM+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  178  WYDINGVWTGSATILPDGQIMMLYTGDTNDYVQVQNLAYPANLSDPLL  225



>sp|P29000.1|INVA_SOLLC RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Solanum 
lycopersicum]
 pir||S31157 beta-fructofuranosidase (EC 3.2.1.26) precursor - currant tomato
 emb|CAA78060.1| vacuolar invertase precursor [Solanum lycopersicum]
 emb|CAA78061.1| vacuolar invertase precursor [Solanum pimpinellifolium]
 emb|CAA78062.1| beta-fructofuranosidase [Solanum lycopersicum]
 emb|CAA78063.1| beta-fructofuranosidase [Solanum pimpinellifolium]
 gb|AAA34132.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A    V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W 
Sbjct  84   DVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-  142

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQ
Sbjct  143  GNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQ  202

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPANLSDPLL
Sbjct  203  VQNLAYPANLSDPLL  217



>gb|ABX55832.1| soluble acid invertase [Cucumis melo]
Length=636

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A    V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W 
Sbjct  84   DVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-  142

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQ
Sbjct  143  GNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQ  202

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPANLSDPLL
Sbjct  203  VQNLAYPANLSDPLL  217



>prf||1905419A invertase
Length=635

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A    V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W 
Sbjct  84   DVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-  142

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQ
Sbjct  143  GNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQ  202

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPANLSDPLL
Sbjct  203  VQNLAYPANLSDPLL  217



>ref|NP_001234843.1| acid invertase [Solanum lycopersicum]
 gb|AAB30874.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A    V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W 
Sbjct  84   DVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-  142

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQ
Sbjct  143  GNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQ  202

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPANLSDPLL
Sbjct  203  VQNLAYPANLSDPLL  217



>gb|ADE44160.1| acid invertase [Solanum lycopersicum var. cerasiforme]
Length=636

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A    V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W 
Sbjct  84   DVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-  142

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQ
Sbjct  143  GNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQ  202

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPANLSDPLL
Sbjct  203  VQNLAYPANLSDPLL  217



>gb|ACC93585.1| beta-fructofuranosidase [Solanum tuberosum]
Length=639

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 117/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            VPY+W+N MLSWQR+A+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VPYAWSNAMLSWQRSAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>ref|NP_001274993.1| beta-fructosidase [Solanum tuberosum]
 gb|AEV46297.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
            ANLSDPLL
Sbjct  213  ANLSDPLL  220



>gb|AEV46296.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
            ANLSDPLL
Sbjct  213  ANLSDPLL  220



>gb|AFH77956.1| vacuolar invertase [Manihot esculenta]
Length=639

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 151/220 (69%), Gaps = 17/220 (8%)
 Frame = +1

Query  46   PYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDETSQQPSP  225
            PYT L  +  +AG P  LRR LK F+ T  S + ++  V +++N S E +    ++ PSP
Sbjct  13   PYTSLRGQPSTAGPPIKLRRPLKVFSVTFASFIFLLSLVTLIINQSQEPLP-TPNKNPSP  71

Query  226  SL-------------KAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMND  366
            S               A G    S      DGV Y+WTN M  WQRTA+HFQP ++WMN 
Sbjct  72   STPKATSFAKREPRGVAEGVSAKSNPSFFSDGVSYNWTNAMFYWQRTAYHFQPERNWMNG  131

Query  367  PNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVW  546
            P+GPL+H GWYHLFYQYNP SAVW  NITWGHAVSRD+IHW HLP+AM+PDQ YD+ GVW
Sbjct  132  PDGPLFHMGWYHLFYQYNPDSAVW-GNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVW  190

Query  547  TGSATTLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            TGSAT LPDGQIMM+YTG+T   VQVQNLAYPANLSDPLL
Sbjct  191  TGSATLLPDGQIMMLYTGDTIDSVQVQNLAYPANLSDPLL  230



>ref|XP_004143623.1| PREDICTED: acid beta-fructofuranosidase-like [Cucumis sativus]
 gb|KGN50433.1| hypothetical protein Csa_5G174590 [Cucumis sativus]
Length=630

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 154/223 (69%), Gaps = 14/223 (6%)
 Frame = +1

Query  19   ATGSSSYKPPYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvK  198
            +T S    PPY+ L DR  S   P   R+SL F T T++    +++S+L + +++     
Sbjct  3    STSSDLIPPPYSALPDRHPS---PPLSRKSLNFTTTTILISFLLIVSLLTLFSYNHPPSP  59

Query  199  DETSQQPSPSLKAAGDVIPSVEEAAG-------DGVPYSWTNRMLSWQRTAFHFQPPKSW  357
            D      +   + A  V   V   +        DG  ++WTN M SWQRTAFHFQP  +W
Sbjct  60   DSAKLPENTQSRLARGVAEGVSAKSNPYFSDSVDG-SFNWTNAMFSWQRTAFHFQPEGNW  118

Query  358  MNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLR  537
            MNDPNGPLYHKGWYHLFYQYNP SAVW  NI+WGHAVSRD+IHWL+LPYAM+PDQPYD+ 
Sbjct  119  MNDPNGPLYHKGWYHLFYQYNPESAVW-GNISWGHAVSRDLIHWLYLPYAMVPDQPYDVN  177

Query  538  GVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            GVWTGSAT LPDG+I+M+YTG+T   VQVQNLAYPANLSDPLL
Sbjct  178  GVWTGSATILPDGRIVMLYTGDTIDGVQVQNLAYPANLSDPLL  220



>gb|AAL75450.1|AF465613_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
Length=636

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A    V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W 
Sbjct  84   DVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-  142

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQ
Sbjct  143  GNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIIMLYTGDTDDYVQ  202

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPANLSDPLL
Sbjct  203  VQNLAYPANLSDPLL  217



>gb|ACC93584.1| beta-fructofuranosidase, partial [Solanum tuberosum]
Length=635

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  90   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  148

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  149  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  208

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  209  TNLSDPLL  216



>gb|ADM47340.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46290.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46291.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46292.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46293.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>gb|AAA50305.1| beta-fructosidase [Solanum tuberosum]
Length=639

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>gb|AEV46294.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46295.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>gb|AEV46289.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>gb|ABF18956.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   VSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>gb|AEV46287.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46288.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            + Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   ISYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>gb|AAQ17074.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            + Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  94   ISYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  152

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDGQIMM+YTG+TD  VQVQNLAYP
Sbjct  153  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYP  212

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  213  TNLSDPLL  220



>ref|XP_009619840.1| PREDICTED: acid beta-fructofuranosidase AIV-18-like [Nicotiana 
tomentosiformis]
 emb|CAC83577.2| vacuolar invertase [Nicotiana tabacum]
Length=643

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 165/228 (72%), Gaps = 16/228 (7%)
 Frame = +1

Query  16   MATGSSSYKPP-----YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnh  180
            MAT  S Y P      YT L D+ ESAG+    R+SLK  +  L+S   ++  V V++N 
Sbjct  1    MATHHSHYDPENSTTHYTVLPDQPESAGSGH--RKSLKVVSGILLSSFFLLSLVFVIVNQ  58

Query  181  sselvKDET--SQQPSPSLK---AAGDVIPSVEEAAGDGVPYS-WTNRMLSWQRTAFHFQ  342
            SS+L +  +  S+  +P+L    + G    +  + +G  + Y  WTN ML+WQRTA+HFQ
Sbjct  59   SSDLSQKNSHSSETLTPALSRGVSQGVSEKTFRDVSGGSLSYYPWTNAMLTWQRTAYHFQ  118

Query  343  PPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQ  522
            P K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGHA+S D+IHWL+LP+A++PDQ
Sbjct  119  PQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGHAISTDLIHWLYLPFALVPDQ  177

Query  523  PYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             YD+ GVWTGSAT LPDGQIMM+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  178  WYDINGVWTGSATFLPDGQIMMLYTGDTNDYVQVQNLAYPANLSDPLL  225



>gb|AAK71504.1| soluble acid invertase FRUCT2 [Ipomoea batatas]
Length=657

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 3/133 (2%)
 Frame = +1

Query  268  AAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVEN  447
             AG+GV ++W+N MLSWQRT++HFQP K+WMNDPNGPLY+KGWYHLFYQYNP SAVW  N
Sbjct  106  GAGNGVSFAWSNLMLSWQRTSYHFQPVKNWMNDPNGPLYYKGWYHLFYQYNPDSAVW-GN  164

Query  448  ITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQ  621
            ITWGHAVS D+I+WLHLP+AM+PDQ YD+ GVWTGSAT LPDG+I+M+YTG+TD  VQVQ
Sbjct  165  ITWGHAVSTDLINWLHLPFAMVPDQWYDVNGVWTGSATILPDGRIVMLYTGDTDDYVQVQ  224

Query  622  NLAYPANLSDPLL  660
            NLA+PANLSDPLL
Sbjct  225  NLAFPANLSDPLL  237



>ref|XP_002265534.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Vitis vinifera]
Length=649

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 154/219 (70%), Gaps = 11/219 (5%)
 Frame = +1

Query  31   SSYKP-PYTPLSDRTESAGAPE-NLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDE  204
             +Y P PY+PL D    AGAP    RR LK F  TL SL+ +   V +V++ S +     
Sbjct  15   EAYAPLPYSPLPDHPVPAGAPALGQRRPLKVFAVTLASLMFLASLVALVIHQSPQTPVTV  74

Query  205  TSQQPSPSLKAAGDVIPSVEEAA-----GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDP  369
             +  PS   +  G V   V E +     G  + Y+WT  M +WQRTAFHFQP K+WMNDP
Sbjct  75   DNDGPSMEREGRG-VAQGVSEKSFLGFSGRRLSYNWTTAMFAWQRTAFHFQPEKNWMNDP  133

Query  370  NGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWT  549
            +GPL+H GWYHLFYQYNP SAVW  NITWGHAVSRDMIHWL+LP AM+PD+ +DL GVWT
Sbjct  134  DGPLFHMGWYHLFYQYNPDSAVW-GNITWGHAVSRDMIHWLYLPLAMVPDRWFDLNGVWT  192

Query  550  GSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            GSAT LP+GQI+M+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  193  GSATILPNGQIIMLYTGDTNDSVQVQNLAYPANLSDPLL  231



>ref|XP_011101190.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=621

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = +1

Query  280  GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWG  459
            G+ +SWTN MLSWQRTA+HFQP K+WMNDPNGPL+HKGWYHLFYQYN  SA+W  NITWG
Sbjct  68   GLTFSWTNIMLSWQRTAYHFQPEKNWMNDPNGPLFHKGWYHLFYQYNQDSAIW-SNITWG  126

Query  460  HAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAY  633
            HAVSRD+IHWLHLP AMLPDQ YD+ GVWTGSAT LPDG+IMM+YTGNT   VQVQ LAY
Sbjct  127  HAVSRDLIHWLHLPCAMLPDQWYDINGVWTGSATILPDGRIMMLYTGNTHDLVQVQCLAY  186

Query  634  PANLSDPLL  660
            PANLSDPLL
Sbjct  187  PANLSDPLL  195



>ref|NP_001284469.1| acid beta-fructofuranosidase-like [Cucumis melo]
 gb|ACJ04702.1| invertase 2 [Cucumis melo]
Length=630

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 152/223 (68%), Gaps = 14/223 (6%)
 Frame = +1

Query  19   ATGSSSYKPPYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvK  198
            +T S    PPY+ L DR  S   P   R+S  F T T++    +++S+  + ++++    
Sbjct  3    STSSDLIPPPYSALPDRHPSPALP---RKSRNFTTTTILISFLLLVSLFALFSYTNTSSP  59

Query  199  DETSQQPSPSLKAAGDVIPSVEEAAG-------DGVPYSWTNRMLSWQRTAFHFQPPKSW  357
            +      +   + A  V   V   +        DG  ++WTN M SWQRTAFHFQP  +W
Sbjct  60   ESVKLPENTQSRLARGVAEGVSAKSNPYFSDSVDG-SFNWTNAMFSWQRTAFHFQPEGNW  118

Query  358  MNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLR  537
            MNDPNGPLYH+GWYHLFYQYNP SAVW  NI+WGHAVSRD+IHWL+LPYAM+PDQ YD+ 
Sbjct  119  MNDPNGPLYHRGWYHLFYQYNPESAVW-GNISWGHAVSRDLIHWLYLPYAMVPDQSYDVN  177

Query  538  GVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            GVWTGSAT LPDG+I+M+YTG+T   VQVQNLAYPANL+DPLL
Sbjct  178  GVWTGSATILPDGRIIMLYTGDTIDGVQVQNLAYPANLTDPLL  220



>ref|XP_011000150.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
 ref|XP_011000151.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
Length=642

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 153/228 (67%), Gaps = 20/228 (9%)
 Frame = +1

Query  22   TGSSSYKPPYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKD  201
            T S     PYTPL D      +P  +RR  K F   L SL+ ++  V +++N S E + +
Sbjct  8    TSSDLEHAPYTPLLDNP----SPARIRRHFKGFAAILASLIFLLSLVALIINQSQESLPE  63

Query  202  -------------ETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQ  342
                         E+  +P P   A G    S      D V Y+WTN M SWQRTA+HFQ
Sbjct  64   KNHNRSPSTSRPTESFSEPEPRGVAQGVSPKSNPSFFSDKVSYNWTNAMFSWQRTAYHFQ  123

Query  343  PPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQ  522
            P K+WMNDP+GPL+HKGWYHLFYQYNP SAVW  NITWGHAVS D+IHWL+LP+AM+PD 
Sbjct  124  PEKNWMNDPDGPLFHKGWYHLFYQYNPDSAVW-GNITWGHAVSPDLIHWLYLPFAMVPDH  182

Query  523  PYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             YD+ GVWTGSAT LPDGQIMM+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  183  WYDINGVWTGSATLLPDGQIMMLYTGSTNESVQVQNLAYPANLSDPLL  230



>sp|P93761.1|INV1_CAPAN RecName: Full=Acid beta-fructofuranosidase AIV-18; AltName: Full=Acid 
invertase; AltName: Full=Acid sucrose hydrolase [Capsicum 
annuum]
 gb|AAB48484.1| acid beta-fructosidase [Capsicum annuum]
Length=640

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+W+N ML+WQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  99   VSYTWSNAMLNWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  157

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS D+IHWL+LP+AM+PDQ YD+ GVWTGSAT LPDG IMM+YTG+TD  VQVQNLAYP
Sbjct  158  AVSTDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGLIMMLYTGDTDDYVQVQNLAYP  217

Query  637  ANLSDPLL  660
            ANLSDPLL
Sbjct  218  ANLSDPLL  225



>emb|CAA49831.1| beta-fructofuranosidase [Solanum tuberosum]
Length=634

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            + Y+W+N MLSWQRTA+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  89   ISYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIW-GNITWGH  147

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD+ GVWTGSA+ LPDGQIMM+YTG +D  VQVQNLAYP
Sbjct  148  AVSKDLIHWLYLPFAMVPDQWYDINGVWTGSASILPDGQIMMLYTGVSDDYVQVQNLAYP  207

Query  637  ANLSDPLL  660
             NLSDPLL
Sbjct  208  TNLSDPLL  215



>gb|AFU25743.1| truncated soluble acid invertase 1 [Rhododendron hybrid cultivar]
Length=434

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 128/169 (76%), Gaps = 15/169 (9%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIP------------SVEEAAGDGVPYSWTNRMLSWQRTAFHF  339
             D+  +  SPS+     ++P            +V E +G G  + WTN ML+WQRT++HF
Sbjct  66   NDDQRESTSPSMPVPDSLMPPSRGVAQGVSEKAVREFSGSGPVFPWTNAMLAWQRTSYHF  125

Query  340  QPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPD  519
            QP K+WMNDP+GPL+H GWYHLFYQYNP SA+W  NITWGHAVSRD+IHWL+LP AM+PD
Sbjct  126  QPEKNWMNDPDGPLHHMGWYHLFYQYNPDSAIW-GNITWGHAVSRDLIHWLYLPIAMVPD  184

Query  520  QPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
              +DL GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPANLSDPLL
Sbjct  185  HWFDLNGVWTGSATLLPDGQIIMLYTGDTDNAVQVQNLAYPANLSDPLL  233



>ref|XP_012090431.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Jatropha curcas]
 gb|KDP22418.1| hypothetical protein JCGZ_26249 [Jatropha curcas]
Length=627

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  214  QPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKG  393
             P P   A G    S   +  +GV Y+WTN M SWQRTAFHFQP ++WMNDP+GPL+H G
Sbjct  66   NPEPRGVAEGVSAKSNPSSFNNGVSYNWTNAMFSWQRTAFHFQPQQNWMNDPDGPLFHLG  125

Query  394  WYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPD  573
            WYHLFYQYNP SAVW  NITWGHAVS+D+IHWL+LP AM+PD+ YD+ G+WTGSAT LPD
Sbjct  126  WYHLFYQYNPDSAVW-GNITWGHAVSKDLIHWLYLPLAMVPDKWYDINGMWTGSATLLPD  184

Query  574  GQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            GQIMM+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  185  GQIMMLYTGDTNASVQVQNLAYPANLSDPLL  215



>gb|AAB47171.1| vacuolar invertase 1, GIN1 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 642 aa]
Length=642

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 152/220 (69%), Gaps = 20/220 (9%)
 Frame = +1

Query  31   SSYKP-PYTPLSDRTESAGAPE-NLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDE  204
             +Y P PY+PL D    AGAP    RR LK   C  +SL+ +V  V  +  H        
Sbjct  15   EAYAPLPYSPLPDHPVPAGAPALGQRRPLK--VCVTLSLMFLVSLVSFIRVHV-------  65

Query  205  TSQQPSPSLKAAG-DVIPSVEEAA-----GDGVPYSWTNRMLSWQRTAFHFQPPKSWMND  366
            T     PS++  G  V   V E +     G  + Y+WT  ML+WQRTAFHFQP K+WMND
Sbjct  66   TVDNDGPSMEREGRGVAQGVSEKSFLGFSGRRLSYNWTTAMLAWQRTAFHFQPEKNWMND  125

Query  367  PNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVW  546
            P+GPL+H GWYHLFYQYNP SAVW  NITWGHAVSRDMIHWL+LP AM+PD+ +DL GVW
Sbjct  126  PDGPLFHMGWYHLFYQYNPDSAVW-GNITWGHAVSRDMIHWLYLPLAMVPDRWFDLNGVW  184

Query  547  TGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            TGSAT LP+GQI+M+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  185  TGSATILPNGQIIMLYTGDTNDSVQVQNLAYPANLSDPLL  224



>gb|AAD10239.1| invertase [Oryza sativa Japonica Group]
Length=654

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 119/133 (89%), Gaps = 3/133 (2%)
 Frame = +1

Query  268  AAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVEN  447
             AG+GV ++W+N MLSWQRT++HFQP K+WMNDPNGPLY+KGWYHLFYQYNP SAVW  N
Sbjct  101  GAGNGVSFAWSNLMLSWQRTSYHFQPVKNWMNDPNGPLYYKGWYHLFYQYNPDSAVW-GN  159

Query  448  ITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQ  621
            ITWGHAVS D+I+WLHLP+AM+PDQ YD+ GVWTGSAT LPDG+I+M+YTG+TD  VQ Q
Sbjct  160  ITWGHAVSTDLINWLHLPFAMVPDQWYDVNGVWTGSATILPDGRIVMLYTGDTDDYVQDQ  219

Query  622  NLAYPANLSDPLL  660
            NLA+PANLSDPLL
Sbjct  220  NLAFPANLSDPLL  232



>gb|AFP23357.1| soluble acid invertase [Litchi chinensis]
Length=643

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 152/237 (64%), Gaps = 35/237 (15%)
 Frame = +1

Query  28   SSSYKPPYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDET  207
            S  + P YTPL +   + G P  LRR LK F   L S++ ++  V +++           
Sbjct  7    SHLHAPYYTPLPEHPSTGGPPATLRRPLKGFALILASVIFLLSLVGLIII--------NQ  58

Query  208  SQQPSPSLKAAGDVIPS-----------VEEAAGDGVP-------------YSWTNRMLS  315
            S+QP  +  +  ++              V     +GV              Y+WTN M S
Sbjct  59   SRQPLQNSTSNVNIPSLLSPPPPSFSRRVPRGVEEGVSAKSNPSPFDQESSYNWTNAMFS  118

Query  316  WQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLH  495
            WQRT+FHFQP ++WMNDP+GPLYH GWYHLFYQYNP SAVW  NITWGHAVSRD+IHWL+
Sbjct  119  WQRTSFHFQPTRNWMNDPDGPLYHMGWYHLFYQYNPDSAVW-GNITWGHAVSRDLIHWLY  177

Query  496  LPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            LP AM+PDQPYD+ GVWTGSAT LPDGQI+M+YTG+T   VQVQNLAYPANLSDPLL
Sbjct  178  LPIAMVPDQPYDINGVWTGSATLLPDGQIVMLYTGDTAELVQVQNLAYPANLSDPLL  234



>gb|AFU25742.1| soluble acid invertase 2 [Rhododendron hybrid cultivar]
Length=643

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 128/169 (76%), Gaps = 15/169 (9%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIP------------SVEEAAGDGVPYSWTNRMLSWQRTAFHF  339
             D+  +  SPS+     ++P            +V E +G G  + WTN ML+WQRT++HF
Sbjct  66   NDDQRESTSPSMPVPDSLMPPSRGVAQGVSEKAVREFSGSGPVFPWTNAMLAWQRTSYHF  125

Query  340  QPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPD  519
            QP K+WMNDP+GPL+H GWYHLFYQYNP SA+W  NITWGHAVSRD+IHWL+LP AM+PD
Sbjct  126  QPEKNWMNDPDGPLHHMGWYHLFYQYNPDSAIW-GNITWGHAVSRDLIHWLYLPIAMVPD  184

Query  520  QPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
              +DL GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPANLSDPLL
Sbjct  185  HWFDLNGVWTGSATLLPDGQIIMLYTGDTDNAVQVQNLAYPANLSDPLL  233



>ref|XP_011101120.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 116/135 (86%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
               +G  + +SW+N MLSWQRTA+HFQP K+WMNDPNGPL+HKGWYHLFYQYN  SAVW 
Sbjct  102  RRVSGGELTFSWSNVMLSWQRTAYHFQPEKNWMNDPNGPLFHKGWYHLFYQYNQESAVW-  160

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             NITWGHAVSRD+IHWLHLPYAM+PDQ YD+ GVWTGSAT LPDG+IMM+YTG+T   VQ
Sbjct  161  GNITWGHAVSRDLIHWLHLPYAMVPDQWYDVNGVWTGSATILPDGRIMMLYTGDTHDVVQ  220

Query  616  VQNLAYPANLSDPLL  660
            VQ LAYPA+LSDPLL
Sbjct  221  VQCLAYPADLSDPLL  235



>ref|XP_002446857.1| hypothetical protein SORBIDRAFT_06g023760 [Sorghum bicolor]
 gb|EES11185.1| hypothetical protein SORBIDRAFT_06g023760 [Sorghum bicolor]
Length=679

 Score =   218 bits (556),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 116/138 (84%), Gaps = 3/138 (2%)
 Frame = +1

Query  253  PSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSA  432
            P +   AG    +SWTN ML+WQRTAFHFQPPK+WMNDPNGPLYHKGWYHLFYQ+NP SA
Sbjct  115  PLLGAGAGAVEDFSWTNAMLAWQRTAFHFQPPKNWMNDPNGPLYHKGWYHLFYQWNPDSA  174

Query  433  VWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--  606
            VW  NITWGHAVSRD++HWLHLP AM+PD PYD  GVW+GSAT LPDG+I+M+YTG+T  
Sbjct  175  VW-GNITWGHAVSRDLLHWLHLPLAMVPDHPYDANGVWSGSATRLPDGRIVMLYTGSTAE  233

Query  607  DVQVQNLAYPANLSDPLL  660
             VQVQNLA PA+ SDPLL
Sbjct  234  SVQVQNLAEPADASDPLL  251



>gb|KJB19681.1| hypothetical protein B456_003G114000 [Gossypium raimondii]
Length=618

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            VP++WTN M SWQR+A+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  77   VPFNWTNAMFSWQRSAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPYSAIW-GNITWGH  135

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVSRD+IHWL+LP A++PD  YD++GVWTGSAT LPDGQI+M+YTG T+  VQVQNLAYP
Sbjct  136  AVSRDLIHWLYLPLALVPDHWYDIKGVWTGSATILPDGQIIMLYTGETNESVQVQNLAYP  195

Query  637  ANLSDPLL  660
            AN+SDPLL
Sbjct  196  ANVSDPLL  203



>sp|P80065.2|INVB_DAUCA RecName: Full=Beta-fructofuranosidase, soluble isoenzyme I; AltName: 
Full=Invertase; AltName: Full=Saccharase; AltName: Full=Sucrose 
hydrolase; Flags: Precursor [Daucus carota]
 emb|CAA53097.1| beta-fructofuranosidase [Daucus carota]
 emb|CAA77267.1| beta-fructofuranosidase, isoform I [Daucus carota]
Length=661

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN MLSWQRT+FHFQP ++WMNDPNGPL+H GWYHLFYQYNP SA+W  NITWGHA+
Sbjct  120  YPWTNDMLSWQRTSFHFQPQENWMNDPNGPLFHMGWYHLFYQYNPDSAIW-GNITWGHAI  178

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+I+WLHLP+AM PDQ YD+ GVWTGSAT LPDG+I+M+YTG+TD  VQVQNLAYPAN
Sbjct  179  SRDLINWLHLPFAMQPDQWYDINGVWTGSATVLPDGKIVMLYTGDTDDLVQVQNLAYPAN  238

Query  643  LSDPLL  660
            LSDPLL
Sbjct  239  LSDPLL  244



>emb|CAA53098.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN MLSWQRT+FHFQP ++WMNDPNGPL+H GWYHLFYQYNP SA+W  NITWGHA+
Sbjct  120  YPWTNDMLSWQRTSFHFQPQENWMNDPNGPLFHMGWYHLFYQYNPDSAIW-GNITWGHAI  178

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+I+WLHLP+AM PDQ YD+ GVWTGSAT LPDG+I+M+YTG+TD  VQVQNLAYPAN
Sbjct  179  SRDLINWLHLPFAMQPDQWYDINGVWTGSATILPDGKIVMLYTGDTDDLVQVQNLAYPAN  238

Query  643  LSDPLL  660
            LSDPLL
Sbjct  239  LSDPLL  244



>emb|CAA53099.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN MLSWQRT+FHFQP ++WMNDPNGPL+H GWYHLFYQYNP SA+W  NITWGHA+
Sbjct  120  YPWTNDMLSWQRTSFHFQPQENWMNDPNGPLFHMGWYHLFYQYNPDSAIW-GNITWGHAI  178

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+I+WLHLP+AM PDQ YD+ GVWTGSAT LPDG+I+M+YTG+TD  VQVQNLAYPAN
Sbjct  179  SRDLINWLHLPFAMQPDQWYDINGVWTGSATILPDGKIVMLYTGDTDDLVQVQNLAYPAN  238

Query  643  LSDPLL  660
            LSDPLL
Sbjct  239  LSDPLL  244



>ref|XP_011076337.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=657

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +    +G  + ++WTN MLSWQ+TA+HFQP K+WMNDP+GPLY+ GWYHLFYQYNP SAV
Sbjct  103  AFRRVSGGNLSFAWTNVMLSWQKTAYHFQPEKNWMNDPDGPLYYNGWYHLFYQYNPDSAV  162

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--D  609
            W  NITWGHAVSRD+IHWLHLPYAM+PDQ YD+ GVWTGSAT LPDG+I+M+YTG+T   
Sbjct  163  W-GNITWGHAVSRDLIHWLHLPYAMVPDQWYDINGVWTGSATILPDGRIIMLYTGDTYDV  221

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQ LAYPANLSDPLL
Sbjct  222  VQVQCLAYPANLSDPLL  238



>gb|ABI17894.1| vacuolar invertase [Coffea canephora]
Length=586

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN MLSWQRT++HFQP K+WMNDPNGPL+H GWYHLFYQYNP SA+W  NITWGHAV
Sbjct  46   YPWTNAMLSWQRTSYHFQPEKNWMNDPNGPLFHMGWYHLFYQYNPDSAIW-GNITWGHAV  104

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHWL+LP+AM+PD+P+D+ GVWTGSAT LP GQI+++YTG+T   VQVQNLAYPAN
Sbjct  105  SRDLIHWLYLPFAMVPDRPFDINGVWTGSATILPGGQIVILYTGDTADLVQVQNLAYPAN  164

Query  643  LSDPLL  660
            LSDPLL
Sbjct  165  LSDPLL  170



>ref|XP_010536536.1| PREDICTED: acid beta-fructofuranosidase-like [Tarenaya hassleriana]
Length=650

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 141/218 (65%), Gaps = 15/218 (7%)
 Frame = +1

Query  49   YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDETSQQPSPS  228
            YTPL +   +  +P   RR  K  +  + SL+ +   V +V+                PS
Sbjct  17   YTPLPENPTAGESPTISRRPFKGLSSIIFSLITISSFVALVMMMVMTSPHQGHDHDHDPS  76

Query  229  LKAAGDVIPSVEEAAG------------DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPN  372
              +  DV   V E               DGV + WTN M SWQR+AFHFQP K+WMNDP+
Sbjct  77   SSSYDDVARGVREGVSAKSNPASYRGGEDGVSFDWTNAMFSWQRSAFHFQPEKNWMNDPD  136

Query  373  GPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTG  552
            GPLY+KGWYHLFYQYNP SAVW  NI+WGHAVS DMIHW++LP+AM+PDQ YD+ GVWTG
Sbjct  137  GPLYYKGWYHLFYQYNPESAVW-GNISWGHAVSTDMIHWMYLPFAMVPDQWYDVNGVWTG  195

Query  553  SATTLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            SAT LP+G IMM+YTG+T   VQVQNLAYP NLSDPLL
Sbjct  196  SATILPNGMIMMLYTGSTVGSVQVQNLAYPVNLSDPLL  233



>gb|AAK83982.1|AF393810_1 vacuolar invertase-like protein [Apium graveolens]
Length=179

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN MLS QRT+FHFQP ++WMNDPNGPL+H GWYHLFYQYNP SA+W  NITWGHA+
Sbjct  34   YPWTNDMLSQQRTSFHFQPQENWMNDPNGPLFHMGWYHLFYQYNPDSAIW-GNITWGHAI  92

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+I+WLHLP+AM PDQ YD+ GVWTGSAT LPDG+I+M+YTG+TD  VQVQNLAYPAN
Sbjct  93   STDLINWLHLPFAMQPDQWYDINGVWTGSATILPDGKIVMLYTGDTDDLVQVQNLAYPAN  152

Query  643  LSDPLL  660
            LSDPLL
Sbjct  153  LSDPLL  158



>ref|XP_010672026.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Beta vulgaris subsp. vulgaris]
Length=645

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 123/157 (78%), Gaps = 6/157 (4%)
 Frame = +1

Query  205  TSQQPSPSLKAAGD---VIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNG  375
            +S++  P++ + G    V   +      G+ ++WTN ML WQR+ FHFQP K+WMNDPNG
Sbjct  80   SSEKVGPAVVSRGKKEGVSEKISRVGESGISFAWTNDMLRWQRSGFHFQPEKNWMNDPNG  139

Query  376  PLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGS  555
            PLY+KG+YHLFYQYNP SAVW  NITWGHA+S D+IHW +LP +M PDQ YD+ GVWTGS
Sbjct  140  PLYYKGFYHLFYQYNPDSAVW-GNITWGHAISTDLIHWKYLPISMKPDQWYDINGVWTGS  198

Query  556  ATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            AT LPDG+IMMVYTG+TD  VQVQNLAYPANLSDPLL
Sbjct  199  ATILPDGKIMMVYTGDTDKFVQVQNLAYPANLSDPLL  235



>gb|AGU12782.1| vacuolar invertase 2a [Gossypium hirsutum]
Length=618

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            VP++WTN M SWQR+A+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  77   VPFNWTNAMFSWQRSAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPYSAIW-GNITWGH  135

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVSRD+IHWL+LP A++PD  YD++GVWTGSAT L DGQI+M+YTG T+  VQVQNLAYP
Sbjct  136  AVSRDLIHWLYLPLALVPDHWYDIKGVWTGSATILADGQIIMLYTGETNESVQVQNLAYP  195

Query  637  ANLSDPLL  660
            AN+SDPLL
Sbjct  196  ANVSDPLL  203



>gb|ACZ05614.1| vacuolar invertase 2 [Gossypium hirsutum]
Length=618

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            VP++WTN M SWQR+A+HFQP K+WMNDPNGPLYHKGWYHLFYQYNP SA+W  NITWGH
Sbjct  77   VPFNWTNAMFSWQRSAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPYSAIW-GNITWGH  135

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVSRD+IHWL+LP A++PD  YD++GVWTGSAT L DGQI+M+YTG T+  VQVQNLAYP
Sbjct  136  AVSRDLIHWLYLPLALVPDHWYDIKGVWTGSATILADGQIIMLYTGETNESVQVQNLAYP  195

Query  637  ANLSDPLL  660
            AN+SDPLL
Sbjct  196  ANVSDPLL  203



>ref|XP_009370474.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
 ref|XP_009372889.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=645

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M SWQRTAFHFQP K+W+NDPNGPL+HKGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  108  YNWTNAMFSWQRTAFHFQPEKNWINDPNGPLFHKGWYHLFYQYNPDSAVW-GNITWGHAV  166

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S DMIHWL+LP AM+PD+ +D  GVWTGSAT LPDGQI+M+YTG+T+  VQVQNLAYPAN
Sbjct  167  STDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPDGQIIMLYTGSTNESVQVQNLAYPAN  226

Query  643  LSDPLL  660
            LSDPLL
Sbjct  227  LSDPLL  232



>dbj|BAF35858.1| Soluble acid invertase [Pyrus pyrifolia var. culta]
Length=645

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M SWQRTAFHFQP K+W+NDPNGPL+HKGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  108  YNWTNAMFSWQRTAFHFQPEKNWINDPNGPLFHKGWYHLFYQYNPDSAVW-GNITWGHAV  166

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S DMIHWL+LP AM+PD+ +D  GVWTGSAT LPDGQI+M+YTG+T+  VQVQNLAYPAN
Sbjct  167  STDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPDGQIIMLYTGSTNESVQVQNLAYPAN  226

Query  643  LSDPLL  660
            LSDPLL
Sbjct  227  LSDPLL  232



>ref|XP_008376436.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Malus domestica]
Length=645

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M SWQRTAFHFQP K+W+NDPNGPL+HKGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  108  YNWTNAMFSWQRTAFHFQPEKNWINDPNGPLFHKGWYHLFYQYNPDSAVW-GNITWGHAV  166

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S DMIHWL+LP AM+PD+ +D  GVWTGSAT LPDGQI+M+YTG+T+  VQVQNLAYPAN
Sbjct  167  STDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPDGQIIMLYTGSTNDSVQVQNLAYPAN  226

Query  643  LSDPLL  660
            LSDPLL
Sbjct  227  LSDPLL  232



>sp|P49175.1|INV1_MAIZE RecName: Full=Beta-fructofuranosidase 1; AltName: Full=Invertase 
1; AltName: Full=Sucrose 1; Flags: Precursor [Zea mays]
 gb|AAA83439.1| invertase [Zea mays]
Length=670

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 111/127 (87%), Gaps = 4/127 (3%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            +SWTN ML+WQRTAFHFQPPK+WMNDPNGPLYHKGWYHLFYQ+NP SAVW  NITWGHAV
Sbjct  114  FSWTNAMLAWQRTAFHFQPPKNWMNDPNGPLYHKGWYHLFYQWNPDSAVW-GNITWGHAV  172

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT---DVQVQNLAYPA  639
            SRD++HWLHLP AM+PD PYD  GVW+GSAT LPDG+I+M+YTG+T     QVQNLA PA
Sbjct  173  SRDLLHWLHLPLAMVPDHPYDANGVWSGSATRLPDGRIVMLYTGSTAESSAQVQNLAEPA  232

Query  640  NLSDPLL  660
            + SDPLL
Sbjct  233  DASDPLL  239



>ref|XP_007038396.1| Glycosyl hydrolases family 32 protein isoform 2 [Theobroma cacao]
 gb|EOY22897.1| Glycosyl hydrolases family 32 protein isoform 2 [Theobroma cacao]
Length=445

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            ++WTN M SWQR+A+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITWGHAV
Sbjct  43   FNWTNAMFSWQRSAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITWGHAV  101

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHWL+LP AM+PD  YD+ GVWTGSAT LPDGQI+M+YTG+T+   QVQNLAYPAN
Sbjct  102  SRDLIHWLYLPLAMVPDCWYDINGVWTGSATLLPDGQIVMLYTGSTNESAQVQNLAYPAN  161

Query  643  LSDPLL  660
            LSDPLL
Sbjct  162  LSDPLL  167



>dbj|BAG30919.1| soluble acid invertase [Pyrus pyrifolia]
Length=645

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M SWQRTAFHFQP K+W+NDPNGPL+HKGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  108  YNWTNAMFSWQRTAFHFQPEKNWINDPNGPLFHKGWYHLFYQYNPDSAVW-GNITWGHAV  166

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S DMIHWL+LP AM+PD+ +D  GVWTGSAT LPDGQI+M+YTG+T+  VQVQNLAYPAN
Sbjct  167  STDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPDGQIIMLYTGSTNESVQVQNLAYPAN  226

Query  643  LSDPLL  660
            LSDPLL
Sbjct  227  LSDPLL  232



>gb|AFV59227.2| vacuolar invertase NvINV [Elsholtzia haichowensis]
Length=637

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIPSV-EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPN  372
            K  TS   +PS   A  V   V    +G    ++WTN MLSWQ TA+HFQP K+WMNDPN
Sbjct  63   KLNTSPAEAPSRGVAQGVSEKVFRRVSGGNSSFAWTNVMLSWQTTAYHFQPEKNWMNDPN  122

Query  373  GPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTG  552
            GPL++ GWYHLFYQYNP SAVW   ITWGHAVSRD+IHWLHLP+AM+PDQ YD++GVWTG
Sbjct  123  GPLFYNGWYHLFYQYNPESAVW-GLITWGHAVSRDLIHWLHLPFAMVPDQWYDIKGVWTG  181

Query  553  SATTLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            SAT LPDG+I+M+YTG+T  +VQVQ LAYPANLSDPLL
Sbjct  182  SATFLPDGRIVMLYTGDTYDEVQVQCLAYPANLSDPLL  219



>ref|XP_008668436.1| PREDICTED: uncharacterized protein LOC100383472 isoform X1 [Zea 
mays]
 tpg|DAA36680.1| TPA: invertase1 [Zea mays]
Length=670

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 111/127 (87%), Gaps = 4/127 (3%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            +SWTN ML+WQRTAFHFQPPK+WMNDPNGPLYHKGWYHLFYQ+NP SAVW  NITWGHAV
Sbjct  114  FSWTNAMLAWQRTAFHFQPPKNWMNDPNGPLYHKGWYHLFYQWNPDSAVW-GNITWGHAV  172

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT---DVQVQNLAYPA  639
            SRD++HWLHLP AM+PD PYD  GVW+GSAT LPDG+I+M+YTG+T     QVQNLA PA
Sbjct  173  SRDLLHWLHLPLAMVPDHPYDANGVWSGSATRLPDGRIVMLYTGSTAESSAQVQNLAEPA  232

Query  640  NLSDPLL  660
            + SDPLL
Sbjct  233  DASDPLL  239



>gb|AFV59228.1| vacuolar invertase CvINV [Elsholtzia haichowensis]
Length=637

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIPSV-EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPN  372
            K  TS   +PS   A  V   V    +G    ++WTN MLSWQ TA+HFQP K+WMNDPN
Sbjct  63   KLNTSPAEAPSRGVAQGVSEKVFRRVSGGNSSFAWTNVMLSWQTTAYHFQPQKNWMNDPN  122

Query  373  GPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTG  552
            GPL++ GWYHLFYQYNP SAVW   ITWGHAVSRD+IHWLHLP+AM+PDQ YD++GVWTG
Sbjct  123  GPLFYNGWYHLFYQYNPESAVW-GLITWGHAVSRDLIHWLHLPFAMVPDQWYDIKGVWTG  181

Query  553  SATTLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            SAT LPDG+I+M+YTG+T  +VQVQ LAYPANLSDPLL
Sbjct  182  SATFLPDGRIVMLYTGDTYDEVQVQCLAYPANLSDPLL  219



>ref|XP_003533514.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=630

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN MLSWQRTAFHFQP ++WMNDPNGPL++ GWYH+FYQYNP SAVW  NITWGHAV
Sbjct  91   YNWTNAMLSWQRTAFHFQPQRNWMNDPNGPLFYMGWYHIFYQYNPDSAVW-GNITWGHAV  149

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHWL+LP A++PD+ +D+ GVW+GSAT LPDG+I+M+YTGNTD  VQVQNLAYPAN
Sbjct  150  SRDLIHWLYLPIALVPDKWFDISGVWSGSATLLPDGKILMLYTGNTDRNVQVQNLAYPAN  209

Query  643  LSDPLL  660
            LSDPLL
Sbjct  210  LSDPLL  215



>gb|KJB51448.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=552

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D V ++WTN M  WQRTA+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITW
Sbjct  97   DKVGFNWTNAMFYWQRTAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHW +LP AM+PDQ YD+ G WTGSAT LPDG+I+M+YTG+T+  VQVQNLA
Sbjct  156  GHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPDGRIVMLYTGSTNDSVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>gb|AFD62256.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +V+E A +  P  W N MLSWQRTAFHFQP K+WMNDPNGPLY+KGWYH FYQYNP+ AV
Sbjct  93   AVKEGASEAFP--WDNSMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNGAV  150

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YDL+GVWTGSAT LPDGQ++M+YTG+T+  
Sbjct  151  W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDLQGVWTGSATILPDGQLIMLYTGSTNES  209

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPA+ SDPLL
Sbjct  210  VQVQNLAYPADPSDPLL  226



>dbj|BAP47496.1| invertase [Gentiana triflora]
Length=658

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G+ V +SWTN MLSWQRT +HFQP K+WMNDP+GPL+HKGWYHLFYQYNP SAVW  NI+
Sbjct  111  GEDVIFSWTNAMLSWQRTGYHFQPEKNWMNDPDGPLFHKGWYHLFYQYNPDSAVW-GNIS  169

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVS D+IHWLHLP + +PD+ YD  GVWTGSAT LPDG I+M+YTG+TD  VQVQNL
Sbjct  170  WGHAVSTDLIHWLHLPISFIPDKWYDSNGVWTGSATILPDGSIVMLYTGSTDDLVQVQNL  229

Query  628  AYPANLSDPLL  660
            AYPANLSDPLL
Sbjct  230  AYPANLSDPLL  240



>ref|XP_007148711.1| hypothetical protein PHAVU_005G008200g [Phaseolus vulgaris]
 gb|ESW20705.1| hypothetical protein PHAVU_005G008200g [Phaseolus vulgaris]
Length=633

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = +1

Query  220  SPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            SP+   A  V P         V Y+WTN M SWQRTAFHFQP K+WMNDP+GPL+H GWY
Sbjct  76   SPARGVAQGVSPKSIPTLFHKVSYNWTNAMFSWQRTAFHFQPQKNWMNDPDGPLFHMGWY  135

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            HLFYQYNP SAVW  NITWGHAVSRDMIHWL+LP AM+P+  YD+ GVWTGSAT LP G+
Sbjct  136  HLFYQYNPDSAVW-GNITWGHAVSRDMIHWLYLPIAMVPNDWYDINGVWTGSATILPGGK  194

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            I+M+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  195  IIMLYTGDTNHYVQVQNLAYPANLSDPLL  223



>gb|KJB51449.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=504

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D V ++WTN M  WQRTA+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITW
Sbjct  97   DKVGFNWTNAMFYWQRTAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHW +LP AM+PDQ YD+ G WTGSAT LPDG+I+M+YTG+T+  VQVQNLA
Sbjct  156  GHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPDGRIVMLYTGSTNDSVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>gb|KJB51450.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=630

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D V ++WTN M  WQRTA+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITW
Sbjct  97   DKVGFNWTNAMFYWQRTAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHW +LP AM+PDQ YD+ G WTGSAT LPDG+I+M+YTG+T+  VQVQNLA
Sbjct  156  GHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPDGRIVMLYTGSTNDSVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>ref|XP_010264216.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Nelumbo nucifera]
Length=660

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 151/226 (67%), Gaps = 27/226 (12%)
 Frame = +1

Query  49   YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhssel------------  192
            Y PL+D  E   AP + RRS+K    TL+S + ++  V+V++                  
Sbjct  20   YNPLTDEAE---APASDRRSIKVILSTLLSGVFLLALVMVLIGDQRSEDPTVVAVKGDYQ  76

Query  193  --vKDETSQQPSPSLKAAGDVIPSVEE------AAGDGVPYSWTNRMLSWQRTAFHFQPP  348
                 +TS+   P+ K +  V   V E      +A DG  + W+N MLSWQRTAFHFQP 
Sbjct  77   PYSSSKTSEILKPA-KVSRGVSEGVSEKTYRLFSAEDGASFPWSNLMLSWQRTAFHFQPE  135

Query  349  KSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPY  528
             +WMNDPNGPLY+KGWYHLFYQYNP  AVW  NITWGHAVS+D+IHWL+LP AM+PDQ Y
Sbjct  136  NNWMNDPNGPLYYKGWYHLFYQYNPDGAVW-GNITWGHAVSKDLIHWLYLPLAMIPDQWY  194

Query  529  DLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            D+ GVWTGSAT LPDG I+++YTG+TD  VQVQNLAYPA+ SDPLL
Sbjct  195  DINGVWTGSATQLPDGSIVVLYTGSTDKMVQVQNLAYPADPSDPLL  240



>gb|ACQ82802.1| vacuolar invertase [Gossypium hirsutum]
Length=645

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D V ++WTN M  WQRTA+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITW
Sbjct  94   DKVGFNWTNAMFYWQRTAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITW  152

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHW +LP AM+PDQ YD+ G WTGSAT LPDG+I+M+YTG+T+  VQVQNLA
Sbjct  153  GHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPDGRIVMLYTGSTNESVQVQNLA  212

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  213  YPANLSDPLL  222



>ref|XP_007038395.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
 gb|EOY22896.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
Length=646

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 145/227 (64%), Gaps = 33/227 (15%)
 Frame = +1

Query  49   YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDETSQQPSPS  228
            Y PL +   S GAP    R LK F   L S++ ++  V +++           SQ+P P 
Sbjct  16   YAPLPEHPSSGGAPATRSRPLKGFVVILASVVFLLSLVALII---------NQSQEPLPM  66

Query  229  LKAAGDVIP-----SVEEAAGDGVP----------------YSWTNRMLSWQRTAFHFQP  345
                    P     S  EA   GV                 ++WTN M SWQR+A+HFQP
Sbjct  67   PNRVPSASPTSKPASFSEAEPRGVAEGVSAKSNPSLLNEASFNWTNAMFSWQRSAYHFQP  126

Query  346  PKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQP  525
             K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITWGHAVSRD+IHWL+LP AM+PD  
Sbjct  127  QKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITWGHAVSRDLIHWLYLPLAMVPDCW  185

Query  526  YDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            YD+ GVWTGSAT LPDGQI+M+YTG+T+   QVQNLAYPANLSDPLL
Sbjct  186  YDINGVWTGSATLLPDGQIVMLYTGSTNESAQVQNLAYPANLSDPLL  232



>gb|KJB51452.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=648

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D V ++WTN M  WQRTA+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITW
Sbjct  97   DKVGFNWTNAMFYWQRTAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHW +LP AM+PDQ YD+ G WTGSAT LPDG+I+M+YTG+T+  VQVQNLA
Sbjct  156  GHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPDGRIVMLYTGSTNDSVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>gb|KHN32440.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=579

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 125/164 (76%), Gaps = 16/164 (10%)
 Frame = +1

Query  211  QQPSPSLKAAGDVIPSVEEAAGDGVP------------YSWTNRMLSWQRTAFHFQPPKS  354
            Q   PSL+    +IP     A +GV             Y+WTN MLSWQRTAFHFQP ++
Sbjct  12   QSHEPSLENNITLIPKARGVA-EGVSAKSNPYLSHKASYNWTNAMLSWQRTAFHFQPQRN  70

Query  355  WMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDL  534
            WMNDPNGPL++ GWYH+FYQYNP SAVW  NITWGHAVSRD+IHWL+LP A+ PD+ +D+
Sbjct  71   WMNDPNGPLFYMGWYHVFYQYNPDSAVW-GNITWGHAVSRDLIHWLYLPIALFPDKWFDV  129

Query  535  RGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             GVW+GSAT LPDG+I+M+YTG+TD  VQVQNLAYPANLSDPLL
Sbjct  130  NGVWSGSATLLPDGKILMLYTGSTDQNVQVQNLAYPANLSDPLL  173



>sp|Q43857.1|INVA_VICFA RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Vicia faba]
 emb|CAA89992.1| vacuolar invertase; beta-fructofuranosidase [Vicia faba var. 
minor]
Length=642

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
             G+G  + W N MLSWQRTAFHFQP K+WMNDPNGPLY+KGWYH FYQYNP+ AVW  +I
Sbjct  91   VGEGGSFPWNNTMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNGAVW-GDI  149

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQN  624
             WGHAVSRD+IHWLHLP AM+ DQ YD  GVWTGSAT LPDGQ++M+YTG+T+  VQVQN
Sbjct  150  VWGHAVSRDLIHWLHLPLAMVADQWYDSNGVWTGSATILPDGQVIMLYTGSTNEFVQVQN  209

Query  625  LAYPANLSDPLL  660
            LAYPA+L+DPLL
Sbjct  210  LAYPADLNDPLL  221



>gb|KJB51451.1| hypothetical protein B456_008G216800 [Gossypium raimondii]
Length=681

 Score =   213 bits (541),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D V ++WTN M  WQRTA+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITW
Sbjct  97   DKVGFNWTNAMFYWQRTAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHW +LP AM+PDQ YD+ G WTGSAT LPDG+I+M+YTG+T+  VQVQNLA
Sbjct  156  GHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPDGRIVMLYTGSTNDSVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>ref|XP_002321831.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
 gb|EEF05958.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
Length=636

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 150/225 (67%), Gaps = 23/225 (10%)
 Frame = +1

Query  31   SSYKPPYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKD---  201
            +S  PPYTPL D      +P  +RR    F   L SL+ ++  V +++N S E + +   
Sbjct  8    TSSDPPYTPLLDNP----SPARIRRPFNGFAAILASLIFLLSLVALIINQSQESLPEQNQ  63

Query  202  ----------ETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPK  351
                      E+  +P P   A G    S      D V Y+WTN M SWQRTA+HFQP K
Sbjct  64   NRSPSTPRPTESFSKPEPRGVAQGVSPKSNPSFFSDKVSYNWTNAMFSWQRTAYHFQPEK  123

Query  352  SWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYD  531
            +WMN   GPL+HKGWYHLFYQYNP SAVW  NITWGHAVS D+IHWL+LP+AM+PD  YD
Sbjct  124  NWMN---GPLFHKGWYHLFYQYNPDSAVW-GNITWGHAVSTDLIHWLYLPFAMVPDHWYD  179

Query  532  LRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            + GVWTGSAT LPDGQIMM+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  180  INGVWTGSATLLPDGQIMMLYTGSTNESVQVQNLAYPANLSDPLL  224



>emb|CAD41525.3| OSJNBb0020O11.6 [Oryza sativa Japonica Group]
Length=666

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  253  PSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSA  432
            P++    G    Y+WTN MLSWQRTAFHFQPP +WMNDPNGPLY+KGWYHLFYQ+NP SA
Sbjct  91   PALRLGGGAVRDYAWTNSMLSWQRTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSA  150

Query  433  VWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD-  609
            VW  NITWGHAVSRD+IHWLHLP AM+PD  YD+ GVWTGSAT LPDG+I+M+YTG T+ 
Sbjct  151  VW-GNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEE  209

Query  610  -VQVQNLAYPANLSDPLL  660
             VQVQNLA PA+ +DPLL
Sbjct  210  SVQVQNLAEPADPNDPLL  227



>gb|KDO65465.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=461

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  107  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  166  SADLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  225

Query  643  LSDPLL  660
             SDPLL
Sbjct  226  PSDPLL  231



>emb|CAH67112.1| H0502G05.3 [Oryza sativa Indica Group]
 emb|CAH67470.1| OSIGBa0159I10.15 [Oryza sativa Indica Group]
Length=649

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  253  PSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSA  432
            P++    G    Y+WTN MLSWQRTAFHFQPP +WMNDPNGPLY+KGWYHLFYQ+NP SA
Sbjct  91   PALRLGGGAVRDYAWTNSMLSWQRTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSA  150

Query  433  VWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD-  609
            VW  NITWGHAVSRD+IHWLHLP AM+PD  YD+ GVWTGSAT LPDG+I+M+YTG T+ 
Sbjct  151  VW-GNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEE  209

Query  610  -VQVQNLAYPANLSDPLL  660
             VQVQNLA PA+ +DPLL
Sbjct  210  SVQVQNLAEPADPNDPLL  227



>gb|EEC77707.1| hypothetical protein OsI_16783 [Oryza sativa Indica Group]
 gb|EEE61409.1| hypothetical protein OsJ_15598 [Oryza sativa Japonica Group]
Length=673

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  253  PSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSA  432
            P++    G    Y+WTN MLSWQRTAFHFQPP +WMNDPNGPLY+KGWYHLFYQ+NP SA
Sbjct  98   PALRLGGGAVRDYAWTNSMLSWQRTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSA  157

Query  433  VWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD-  609
            VW  NITWGHAVSRD+IHWLHLP AM+PD  YD+ GVWTGSAT LPDG+I+M+YTG T+ 
Sbjct  158  VW-GNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEE  216

Query  610  -VQVQNLAYPANLSDPLL  660
             VQVQNLA PA+ +DPLL
Sbjct  217  SVQVQNLAEPADPNDPLL  234



>ref|NP_001053422.1| Os04g0535600 [Oryza sativa Japonica Group]
 dbj|BAF15336.1| Os04g0535600 [Oryza sativa Japonica Group]
 dbj|BAG89376.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94058.1| unnamed protein product [Oryza sativa Japonica Group]
Length=656

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = +1

Query  253  PSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSA  432
            P++    G    Y+WTN MLSWQRTAFHFQPP +WMNDPNGPLY+KGWYHLFYQ+NP SA
Sbjct  98   PALRLGGGAVRDYAWTNSMLSWQRTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSA  157

Query  433  VWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD-  609
            VW  NITWGHAVSRD+IHWLHLP AM+PD  YD+ GVWTGSAT LPDG+I+M+YTG T+ 
Sbjct  158  VW-GNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEE  216

Query  610  -VQVQNLAYPANLSDPLL  660
             VQVQNLA PA+ +DPLL
Sbjct  217  SVQVQNLAEPADPNDPLL  234



>gb|KDO65464.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=494

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  107  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  166  SADLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  225

Query  643  LSDPLL  660
             SDPLL
Sbjct  226  PSDPLL  231



>gb|KDO65463.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=573

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  107  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  166  SADLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  225

Query  643  LSDPLL  660
             SDPLL
Sbjct  226  PSDPLL  231



>ref|XP_003540575.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=614

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 125/164 (76%), Gaps = 16/164 (10%)
 Frame = +1

Query  211  QQPSPSLKAAGDVIPSVEEAAGDGVP------------YSWTNRMLSWQRTAFHFQPPKS  354
            Q   PSL+    +IP     A +GV             Y+WTN MLSWQRTAFHFQP ++
Sbjct  47   QSHEPSLENNITLIPKARGVA-EGVSAKSNQYLSHKASYNWTNAMLSWQRTAFHFQPQRN  105

Query  355  WMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDL  534
            WMNDPNGPL++ GWYH+FYQYNP SAVW  NITWGHAVSRD+IHWL+LP A+ PD+ +D+
Sbjct  106  WMNDPNGPLFYMGWYHVFYQYNPDSAVW-GNITWGHAVSRDLIHWLYLPIALFPDKWFDV  164

Query  535  RGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             GVW+GSAT LPDG+I+M+YTG+TD  VQVQNLAYPANLSDPLL
Sbjct  165  NGVWSGSATLLPDGKILMLYTGSTDQNVQVQNLAYPANLSDPLL  208



>ref|XP_002510944.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
 gb|EEF51546.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
Length=639

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 147/219 (67%), Gaps = 18/219 (8%)
 Frame = +1

Query  46   PYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhss------------e  189
            P TPL ++    G    LRR LK FT T  SL+ ++  V +++N S              
Sbjct  13   PCTPLLEQPSLLGPSTKLRRPLKVFTVTFASLIFLLSLVTLIMNQSQGPLPTPNKNRSPS  72

Query  190  lvKDETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDP  369
              K  +  +  P   A G    S      +GV Y+WTN MLSWQRTA+HFQP K+WMN  
Sbjct  73   TPKSTSFSEHVPRGVAEGVSAKSNPSFFSNGVSYNWTNAMLSWQRTAYHFQPEKNWMN--  130

Query  370  NGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWT  549
             GPL++ GWYHLFYQYNP SAVW  NITWGHAVSRD+IHWL+LP AM+PD+ YD+ GVWT
Sbjct  131  -GPLFYMGWYHLFYQYNPDSAVW-GNITWGHAVSRDLIHWLYLPMAMVPDKWYDINGVWT  188

Query  550  GSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            GSAT LPDGQI+M+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  189  GSATLLPDGQIVMLYTGDTNASVQVQNLAYPANLSDPLL  227



>gb|AFD62255.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 115/137 (84%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +V+E A +  P  W N MLSWQRTAFHFQP K+WMNDPNGPLY+KGWYH  YQYNP+ AV
Sbjct  93   AVKEGASEAFP--WDNSMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFLYQYNPNGAV  150

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YDL+GVWTGSAT LPDGQ++M+YTG+T+  
Sbjct  151  W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDLQGVWTGSATILPDGQLIMLYTGSTNES  209

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPA+ SDPLL
Sbjct  210  VQVQNLAYPADPSDPLL  226



>ref|XP_004499664.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Cicer arietinum]
Length=636

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+WTN M+SWQRTAFHFQP K+WMNDP+GPL+H GWYHLFYQYNP S++W  NITWGH
Sbjct  95   VSYNWTNAMISWQRTAFHFQPQKNWMNDPDGPLFHMGWYHLFYQYNPYSSIW-GNITWGH  153

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+DMIHWL+LP AM P++ +D+ GVWTGSAT LPDG+I+M+YTG+T+  VQVQNLAYP
Sbjct  154  AVSKDMIHWLYLPIAMKPNKWFDINGVWTGSATLLPDGKIIMLYTGDTNEYVQVQNLAYP  213

Query  637  ANLSDPLL  660
            ANLSDPLL
Sbjct  214  ANLSDPLL  221



>ref|XP_004976364.1| PREDICTED: beta-fructofuranosidase 1-like [Setaria italica]
Length=672

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 3/133 (2%)
 Frame = +1

Query  268  AAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVEN  447
             AG    YSWTN ML+WQRTAFHFQPPK+WMNDPNGPLYHKGWYHLFYQ+NP SAVW  N
Sbjct  115  GAGALRDYSWTNAMLAWQRTAFHFQPPKNWMNDPNGPLYHKGWYHLFYQWNPHSAVW-GN  173

Query  448  ITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQ  621
            ITWGHAVSRD++HWLHLP AM+PD  YD  GVW+GSAT LPDG+I+M+YTG+T   VQVQ
Sbjct  174  ITWGHAVSRDLVHWLHLPLAMVPDHWYDANGVWSGSATRLPDGRIVMLYTGSTADSVQVQ  233

Query  622  NLAYPANLSDPLL  660
            NLA PA+ SDPLL
Sbjct  234  NLAEPADPSDPLL  246



>gb|ADP08983.1| vacuolar invertase 1 [Gossypium hirsutum]
Length=648

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 112/130 (86%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D V ++WTN M  WQRTA+HFQP K+WMNDP+GPLYHKGWYHLFYQYNP SA+W  NITW
Sbjct  97   DKVGFNWTNAMFYWQRTAYHFQPQKNWMNDPDGPLYHKGWYHLFYQYNPDSAIW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS D+IHW +LP AM+PDQ YD+ G WTGSAT LPDG+I+M+YTG+T+  VQVQNLA
Sbjct  156  GHAVSTDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPDGRIVMLYTGSTNDSVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>gb|KDO65462.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=589

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  107  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  166  SADLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  225

Query  643  LSDPLL  660
             SDPLL
Sbjct  226  PSDPLL  231



>gb|KHN04338.1| Acid beta-fructofuranosidase [Glycine soja]
Length=555

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 115/137 (84%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +V++ A    P  W N MLSWQRTAFHFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AV
Sbjct  4    AVKDGASKAFP--WDNSMLSWQRTAFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAV  61

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YD++GVWTGSAT LP+G+I+M+YTG+T+  
Sbjct  62   W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPNGEIIMLYTGSTNES  120

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPAN SDPLL
Sbjct  121  VQVQNLAYPANPSDPLL  137



>gb|AAM52063.1| vacuolar acid invertase PsI-1 [Pisum sativum]
Length=222

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 109/131 (83%), Gaps = 3/131 (2%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            +  G+   + W N MLSWQRTAFHFQP K+WMNDPNGPLY+KGWYH FYQYNP+ AVW +
Sbjct  93   KVVGEAESFPWDNTMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNGAVWGD  152

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHWLHLP AM+ DQ YD  GVWTGSAT LPDGQ++M+YTG+T+  VQV
Sbjct  153  -IVWGHAVSRDIIHWLHLPLAMVADQWYDSNGVWTGSATILPDGQVIMLYTGSTNESVQV  211

Query  619  QNLAYPANLSD  651
            QNLAYPA+L+D
Sbjct  212  QNLAYPADLND  222



>gb|KDO65459.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=642

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  107  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  166  SADLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  225

Query  643  LSDPLL  660
             SDPLL
Sbjct  226  PSDPLL  231



>gb|AAM52062.1| vacuolar acid invertase PsI-1 [Pisum sativum]
Length=647

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 112/134 (84%), Gaps = 3/134 (2%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            +  G+   + W N MLSWQRTAFHFQP K+WMNDPNGPLY+KGWYH FYQYNP+ AVW  
Sbjct  93   KVVGEAESFPWDNTMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNGAVW-G  151

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
            +I WGHAVSRD+IHWLHLP AM+ DQ YD  GVWTGSAT LPDGQ++M+YTG+T+  VQV
Sbjct  152  DIVWGHAVSRDIIHWLHLPLAMVADQWYDSNGVWTGSATILPDGQVIMLYTGSTNESVQV  211

Query  619  QNLAYPANLSDPLL  660
            QNLAYPA+L+DPLL
Sbjct  212  QNLAYPADLNDPLL  225



>gb|AAL27709.3|AF433643_1 vacuolar invertase [Citrus sinensis]
Length=588

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  107  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  166  SADLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  225

Query  643  LSDPLL  660
             SDPLL
Sbjct  226  PSDPLL  231



>gb|AES90955.2| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=643

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 119/153 (78%), Gaps = 7/153 (5%)
 Frame = +1

Query  220  SPSLKAA----GDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYH  387
            SPS+ A      +V  S     G+   + W N MLSWQRT+FHFQP K+WMNDPNGP+Y+
Sbjct  74   SPSVSAGVSEKSNVFLSGPNKVGETESFPWNNTMLSWQRTSFHFQPEKNWMNDPNGPMYY  133

Query  388  KGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTL  567
            KGWYH FYQYNP+ AVW  +I WGHAVSRDMIHWLHLP AM+ DQ YD  GVWTGSAT L
Sbjct  134  KGWYHFFYQYNPNGAVW-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDSNGVWTGSATIL  192

Query  568  PDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            PDGQ++M+YTG+T+  VQVQNLAYPA+L+DPLL
Sbjct  193  PDGQVIMLYTGSTNETVQVQNLAYPADLNDPLL  225



>gb|AAK71505.2| soluble acid invertase Ib2FRUCT3 [Ipomoea batatas]
Length=661

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  268  AAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVEN  447
             +G  + Y W+N ML+WQRTA+HFQP K+WMNDP+GPLYHKGWYH FYQYNP SAVW  N
Sbjct  113  VSGGRISYPWSNLMLTWQRTAYHFQPEKNWMNDPDGPLYHKGWYHFFYQYNPDSAVW-GN  171

Query  448  ITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQ  621
            ITWGHAVSRD+IHW HLP+AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQ
Sbjct  172  ITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDENVQVQ  231

Query  622  NLAYPA  639
            NLAYPA
Sbjct  232  NLAYPA  237



>ref|XP_010476187.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Camelina 
sativa]
Length=670

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 123/166 (74%), Gaps = 16/166 (10%)
 Frame = +1

Query  199  DETSQQPSPSLKAAGDVIPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQPP  348
            DET +  S S +A    +  V E + DG+           + W N MLSWQRTAFHFQP 
Sbjct  78   DETEKTTSSSSRAR---LAGVSEKSNDGLWKLSGGQNTPAFEWNNSMLSWQRTAFHFQPE  134

Query  349  KSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPY  528
            ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAVSRD+IHW+HLP AM+ DQ Y
Sbjct  135  ENWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSRDLIHWVHLPLAMVADQWY  193

Query  529  DLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            D  GVWTGSAT LPDG I+M+YTG+TD  VQVQNLAYP +L+DPLL
Sbjct  194  DSNGVWTGSATILPDGSIVMLYTGSTDKAVQVQNLAYPEDLNDPLL  239



>ref|XP_006421676.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
 gb|ESR34916.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
Length=685

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  150  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  208

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  209  SADLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  268

Query  643  LSDPLL  660
             SDPLL
Sbjct  269  PSDPLL  274



>ref|XP_007218853.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 ref|XP_007218854.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20052.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20053.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
Length=639

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D   Y+WTN M SWQRTAFHFQP ++WMNDPNGP+++KGWYHLFYQYNP SAVW  NITW
Sbjct  97   DEASYNWTNAMFSWQRTAFHFQPERNWMNDPNGPMFYKGWYHLFYQYNPDSAVW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS D+IHWL+LP AM+PD+ +D  GVWTGS+T LPDGQI+++YTG+T+  VQVQNLA
Sbjct  156  GHAVSIDLIHWLYLPLAMVPDRWFDANGVWTGSSTILPDGQIVILYTGSTNESVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>emb|CAA77268.1| Inv*Dc4' protein [Daucus carota]
Length=570

 Score =   208 bits (529),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 145/211 (69%), Gaps = 9/211 (4%)
 Frame = +1

Query  43   PPYTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDETSQQPS  222
            PP +PL ++ E+      LRRS+K     L+    +VL  +      +   +D+ + +  
Sbjct  8    PPCSPLLEKAETEKTSVVLRRSIKGLCSLLLVSTLLVLLFVQQGPRITRNGEDDLNLK--  65

Query  223  PSLKAAGDVIPS--VEEAAGDGVP-YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKG  393
             SL+ A   +      + +G+ V  Y WTN MLSWQRT++HFQP K+WMNDPNGPL+H G
Sbjct  66   -SLEQAWRWVSKEITLDVSGERVKAYPWTNDMLSWQRTSYHFQPQKNWMNDPNGPLFHMG  124

Query  394  WYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPD  573
            WYH FYQYNP+SAVW  NITWGHAVS+D+I+W HLP AM+PD  YD+ GVWTGSAT LPD
Sbjct  125  WYHFFYQYNPNSAVW-GNITWGHAVSKDLINWFHLPIAMVPDNWYDIAGVWTGSATILPD  183

Query  574  GQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            GQI+M+YTG T    +VQNLAYPANLSDPLL
Sbjct  184  GQIIMLYTGKTANLTEVQNLAYPANLSDPLL  214



>ref|NP_001275874.1| beta-fructofuranosidase, soluble isoenzyme I-like [Citrus sinensis]
 dbj|BAF34363.1| beta-fructofuranosidase [Citrus sinensis]
Length=642

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M +WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHA 
Sbjct  107  YNWTNAMFTWQRTSFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAA  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWL+LP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG+TD  VQVQNLAYPA+
Sbjct  166  STDLIHWLYLPIAMVPDQWYDINGVWTGSATILPDGQIVMLYTGSTDKSVQVQNLAYPAD  225

Query  643  LSDPLL  660
             SDPLL
Sbjct  226  PSDPLL  231



>ref|XP_003525803.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=645

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 115/137 (84%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +V++ A    P  W N MLSWQRTAFHFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AV
Sbjct  94   AVKDGASKAFP--WDNSMLSWQRTAFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAV  151

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YD++GVWTGSAT LP+G+I+M+YTG+T+  
Sbjct  152  W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPNGEIIMLYTGSTNES  210

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPAN SDPLL
Sbjct  211  VQVQNLAYPANPSDPLL  227



>ref|XP_009374489.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=646

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M SWQRTAFHFQP  +WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  110  YNWTNAMFSWQRTAFHFQPADNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  168

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S DMIHWL+LP AM+PD+ +D  GVWTGSAT LP+G+IM++YTG+T+  VQVQNLAYPAN
Sbjct  169  STDMIHWLYLPLAMVPDRWFDANGVWTGSATILPNGEIMILYTGSTNDSVQVQNLAYPAN  228

Query  643  LSDPLL  660
            LSDPLL
Sbjct  229  LSDPLL  234



>gb|AHK05786.1| vacuolar invertase [Eriobotrya japonica]
Length=646

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 147/228 (64%), Gaps = 26/228 (11%)
 Frame = +1

Query  49   YTPLSDRTESAGA-PENLRRSLKFFTCTlisllcvvlsvlvvlnhs---------selvK  198
            YTPL     SAG  P   RR  K F  T  S++ ++  V ++++            +   
Sbjct  8    YTPLPGEDPSAGVPPPTHRRPFKVFAVTFSSVIFLLSLVTLIIHQGPGAPPNTVPEQPHH  67

Query  199  DETSQQPSPSLKAAGDVIPSVEEAAGDGV------------PYSWTNRMLSWQRTAFHFQ  342
            D   QQP+ S         SV     +GV             Y+WTN M SWQRTAFHFQ
Sbjct  68   DHRHQQPAASTSPEPRSF-SVPRGKLEGVSAKSNPYFSEEASYNWTNAMFSWQRTAFHFQ  126

Query  343  PPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQ  522
            P  +WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAVSRDMIHWL+LP AM+PD+
Sbjct  127  PEDNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAVSRDMIHWLYLPLAMVPDR  185

Query  523  PYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             +D  GVWTGSAT LP+G+IM++YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  186  WFDANGVWTGSATILPNGEIMILYTGSTNDSVQVQNLAYPANLSDPLL  233



>ref|XP_007131343.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
 gb|ESW03337.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
Length=627

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH+FYQYNP SAV+  NITWGHAV
Sbjct  97   YNWTNAMLSWQRTAFHFQPQKNWMNDPNGPLFYKGWYHIFYQYNPESAVF-GNITWGHAV  155

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPAN  642
            S D+IHWL+LP AML D  YD +GVW+GSAT LPDG+I+M+YTGNT  +VQVQNLAYPAN
Sbjct  156  STDLIHWLYLPIAMLRDSWYDAKGVWSGSATLLPDGRIVMLYTGNTHQNVQVQNLAYPAN  215

Query  643  LSDPLL  660
            LSDPLL
Sbjct  216  LSDPLL  221



>gb|AFO84092.1| vacuolar invertase [Actinidia chinensis]
Length=632

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +  E +G    Y+WTN ML+WQRTAFHFQP K+WMNDPN PL+H GWYH++YQYNP SA+
Sbjct  81   AFREYSGMDPEYNWTNTMLAWQRTAFHFQPQKNWMNDPNAPLFHMGWYHIWYQYNPDSAI  140

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  NITWGHAVS D+IHWLHLP AM+PD  +D  GVWTGSAT LPDGQI+++YTG+TD  
Sbjct  141  W-GNITWGHAVSTDLIHWLHLPIAMVPDHWFDSNGVWTGSATLLPDGQIVILYTGDTDDY  199

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPANLSDPLL
Sbjct  200  VQVQNLAYPANLSDPLL  216



>ref|XP_010062212.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Eucalyptus grandis]
 gb|KCW90831.1| hypothetical protein EUGRSUZ_A02888 [Eucalyptus grandis]
Length=654

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D + Y+WTN M SWQRTA+HFQP K+WMNDP+GPLY+ GWYHLFYQYNP SAVW  NITW
Sbjct  103  DRLSYNWTNAMFSWQRTAYHFQPEKNWMNDPDGPLYYMGWYHLFYQYNPDSAVW-GNITW  161

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGN--TDVQVQNLA  630
            GHAVS+D+IHWL+LP AM+PD+ +D+ GVWTGSAT LPDG+I+M+YTG+    VQVQNLA
Sbjct  162  GHAVSKDLIHWLYLPLAMVPDRWFDIGGVWTGSATLLPDGRIVMLYTGDMANSVQVQNLA  221

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  222  YPANLSDPLL  231



>gb|KHN09790.1| Acid beta-fructofuranosidase [Glycine soja]
Length=619

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 116/137 (85%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +V++ A +  P  W N MLSWQRTAFHFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AV
Sbjct  68   AVKDGASEAFP--WDNSMLSWQRTAFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAV  125

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YD++GVWTGSAT LP+G+I+M+YTG+T+  
Sbjct  126  W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPNGEIIMLYTGSTNES  184

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPA+ SDPLL
Sbjct  185  VQVQNLAYPADPSDPLL  201



>ref|NP_001284386.1| acid beta-fructofuranosidase-like [Cucumis melo]
 gb|ACS94417.1| acid invertase 1 [Cucumis melo]
Length=680

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 116/159 (73%), Gaps = 9/159 (6%)
 Frame = +1

Query  208  SQQPSPSLKAAGDVIPSVEEAA-----GDGVPYS-WTNRMLSWQRTAFHFQPPKSWMNDP  369
            SQ P      +  V   V E A     G  V Y  W N MLSWQRTAFHFQP ++WMNDP
Sbjct  80   SQSPEILRPGSRGVSAGVSEKANRHFIGQNVAYFPWNNSMLSWQRTAFHFQPEENWMNDP  139

Query  370  NGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWT  549
            NGPLY+ GWYH FYQYNP +AVW  NI WGHAVS D+IHW HLP A++PDQ YD+ GVWT
Sbjct  140  NGPLYYNGWYHFFYQYNPRAAVW-GNIVWGHAVSTDLIHWFHLPLALVPDQWYDINGVWT  198

Query  550  GSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            GSAT LPDGQIMM YTG+T   VQVQNLAYPANLSDPLL
Sbjct  199  GSATILPDGQIMMFYTGSTKEHVQVQNLAYPANLSDPLL  237



>gb|AAD01606.1| beta-fructofuranosidase [Ipomoea batatas]
Length=656

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 115/134 (86%), Gaps = 4/134 (3%)
 Frame = +1

Query  268  AAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVEN  447
             +G  + Y W+N ML+WQRTA+HFQP K+WMNDPNGPLY+KGWYH FYQYNP SAVW  N
Sbjct  113  VSGGRISYPWSNLMLTWQRTAYHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPDSAVW-GN  171

Query  448  ITWGHAV-SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
            ITWGHAV   D+I+W+HLP+AM+PDQ YD+ GVWTGSAT LPDG+I+M+YTG+TD  VQV
Sbjct  172  ITWGHAVFPTDLINWIHLPFAMVPDQWYDVNGVWTGSATILPDGRIVMLYTGDTDDYVQV  231

Query  619  QNLAYPANLSDPLL  660
            QNLA+PANLSDPLL
Sbjct  232  QNLAFPANLSDPLL  245



>ref|XP_010106222.1| hypothetical protein L484_003380 [Morus notabilis]
 gb|EXC08928.1| hypothetical protein L484_003380 [Morus notabilis]
Length=648

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 144/217 (66%), Gaps = 18/217 (8%)
 Frame = +1

Query  49   YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKD--ETSQQPS  222
            YTPL D++ +   P   RR LK F  T+  ++ ++  V ++  +     +   ET+  P 
Sbjct  24   YTPLPDQSPTVAGPRG-RRPLKGFAATICFVVFLISLVALISPNQIHSQQQPSETAAVPE  82

Query  223  PSLKAAGDVIPSVEEAAG---------DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNG  375
             + + +      V E            D + Y+WTN M SWQRTAFHFQP K+WMN   G
Sbjct  83   DTKRKSFSEPRGVAEGVSAKSNPYFFSDKLSYNWTNAMFSWQRTAFHFQPQKNWMN---G  139

Query  376  PLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGS  555
            PL+HKGWYHLFYQYNP SA+W  NITWGHAVS D+IHWLHLP AM+PD  YD+ G W+G+
Sbjct  140  PLFHKGWYHLFYQYNPDSAIW-GNITWGHAVSSDLIHWLHLPIAMVPDHWYDINGAWSGA  198

Query  556  ATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            AT LPDG+I+M+YTG+TD  VQVQNLAYPANLSDPLL
Sbjct  199  ATILPDGKIIMLYTGSTDESVQVQNLAYPANLSDPLL  235



>gb|EPS61897.1| soluble acid invertase 1, partial [Genlisea aurea]
Length=561

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 3/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G  + ++WTN MLSWQRT +HFQP K+WMNDPNGPLYHKGWYHLFYQ+NP +AVW   I+
Sbjct  16   GGDLSFAWTNAMLSWQRTGYHFQPVKNWMNDPNGPLYHKGWYHLFYQHNPDAAVW-GVIS  74

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVSRD+IHWL+LPYAM+PDQ YD+ GVWTGSAT LPDG I+++YTG+T   VQVQ L
Sbjct  75   WGHAVSRDLIHWLYLPYAMVPDQWYDINGVWTGSATILPDGAIVILYTGDTTDAVQVQCL  134

Query  628  AYPANLSDPLL  660
            A PANLSDPLL
Sbjct  135  AVPANLSDPLL  145



>ref|XP_004147588.1| PREDICTED: acid beta-fructofuranosidase-like [Cucumis sativus]
 gb|KGN50220.1| hypothetical protein Csa_5G160230 [Cucumis sativus]
Length=685

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 116/155 (75%), Gaps = 17/155 (11%)
 Frame = +1

Query  244  DVIPSVEEAAGDGVP--------------YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPL  381
            +++P V     +GV               + W N MLSWQRTAFHFQP ++WMNDPNGPL
Sbjct  84   EILPPVSRGVSEGVSEKANRHFIGQNLAYFPWNNSMLSWQRTAFHFQPEENWMNDPNGPL  143

Query  382  YHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSAT  561
            Y+ GWYH FYQYNP +AVW  NI WGHAVS D+IHWLHLP A++PDQ YD+ GVWTGSAT
Sbjct  144  YYNGWYHFFYQYNPRAAVW-GNIVWGHAVSTDLIHWLHLPLALVPDQWYDINGVWTGSAT  202

Query  562  TLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             LPDG+IMM+YTG+T   VQVQNLAYPANLSDPLL
Sbjct  203  ILPDGRIMMLYTGSTKEHVQVQNLAYPANLSDPLL  237



>gb|AFU56882.1| vacuolar invertase [Malus domestica]
Length=645

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M SWQRTAFHFQP  +WMNDP+GPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  109  YNWTNAMFSWQRTAFHFQPEHNWMNDPDGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  167

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S DMIHWL+LP AM+PD+ YD  GVWTGSAT LP+G+IM++YTG+T+  VQVQNLAYPAN
Sbjct  168  STDMIHWLYLPLAMVPDRWYDANGVWTGSATILPNGEIMILYTGSTNDSVQVQNLAYPAN  227

Query  643  LSDPLL  660
            LSDPLL
Sbjct  228  LSDPLL  233



>ref|XP_003549902.1| PREDICTED: acid beta-fructofuranosidase-like isoform 1 [Glycine 
max]
Length=645

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 116/137 (85%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            +V++ A +  P  W N MLSWQRTAFHFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AV
Sbjct  94   AVKDGASEAFP--WDNSMLSWQRTAFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAV  151

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YD++GVWTGSAT LP+G+I+M+YTG+T+  
Sbjct  152  W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPNGEIIMLYTGSTNES  210

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPA+ SDPLL
Sbjct  211  VQVQNLAYPADPSDPLL  227



>ref|XP_004307805.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Fragaria vesca subsp. vesca]
Length=644

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 117/155 (75%), Gaps = 4/155 (3%)
 Frame = +1

Query  202  ETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPL  381
            ET+    P  KA G V         D + Y+WTN M SWQRTAFHFQP ++WMNDPNGPL
Sbjct  79   ETTSSWEPRGKALG-VSAKSNPPVSDELSYNWTNAMFSWQRTAFHFQPEENWMNDPNGPL  137

Query  382  YHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSAT  561
            +HKGWYHLFYQYNP SAVW  NITWGHAVS D+IHWL+LP AM+ DQ YD  GVW+GSAT
Sbjct  138  FHKGWYHLFYQYNPDSAVW-GNITWGHAVSTDLIHWLYLPLAMVADQWYDANGVWSGSAT  196

Query  562  TLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
             LPDG I+M+YTG+T   VQVQ LAYP NLSDPLL
Sbjct  197  LLPDGNIVMLYTGDTVDAVQVQCLAYPGNLSDPLL  231



>ref|NP_001275813.1| acid beta-fructofuranosidase-like [Citrus sinensis]
 ref|XP_006440372.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
 dbj|BAF34362.1| beta-fructofuranosidase [Citrus sinensis]
 gb|ESR53612.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
Length=687

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNG  375
            KD    +P  S  +AG    S          Y WTN MLSWQRTAFHFQP K+WMNDPNG
Sbjct  77   KDPERLRPFTSASSAGVSEKSNRRFGARTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNG  136

Query  376  PLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGS  555
            P+++KGWYHLFYQYNP+ A+W  +I WGHAVS+D+IHW HLP AM+ DQ YD+ GVWTGS
Sbjct  137  PVFYKGWYHLFYQYNPNGAIW-GDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGS  195

Query  556  ATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            AT LPDG++MM+YTG+T+  VQVQNLAYPA+ SDPLL
Sbjct  196  ATILPDGKLMMLYTGSTNESVQVQNLAYPADPSDPLL  232



>ref|XP_011081205.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I [Sesamum 
indicum]
Length=655

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 123/156 (79%), Gaps = 9/156 (6%)
 Frame = +1

Query  211  QQPSPSLKAAGDVIPSVEEAAGDG----VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGP  378
            ++  P+L+   + +   E++ G G    +PY WT +ML+WQRT +HFQP K+WMNDPNGP
Sbjct  91   EEGRPTLRGVHEGVS--EKSFGKGRLGAIPYPWTKKMLAWQRTGYHFQPQKNWMNDPNGP  148

Query  379  LYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSA  558
            L++KGWYH FYQYNPS AVW  NI+WGHAVS+D+I+W HLP AM+PDQ YD+ GVWTGSA
Sbjct  149  LFYKGWYHFFYQYNPSGAVW-GNISWGHAVSKDLINWRHLPLAMVPDQWYDINGVWTGSA  207

Query  559  TTLPDGQIMMVYTG--NTDVQVQNLAYPANLSDPLL  660
            T L DGQ++M+YTG  NT VQVQNLAYPA+ SDPLL
Sbjct  208  TILQDGQLVMLYTGSTNTSVQVQNLAYPADQSDPLL  243



>ref|XP_008234397.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Prunus mume]
Length=637

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (87%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D   Y+WTN M SWQRTAFHFQP ++WMNDP+GP+++KGWYHLFYQYNP SAVW  NITW
Sbjct  97   DEASYNWTNAMFSWQRTAFHFQPERNWMNDPDGPMFYKGWYHLFYQYNPDSAVW-GNITW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS D+IHWL+LP AM+PD+ +D  GVWTGS+T LPDGQI+++YTG+T+  VQVQNLA
Sbjct  156  GHAVSIDLIHWLYLPIAMVPDRWFDANGVWTGSSTILPDGQIVILYTGSTNESVQVQNLA  215

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  216  YPANLSDPLL  225



>ref|XP_007210314.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
 gb|EMJ11513.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
Length=686

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 12/145 (8%)
 Frame = +1

Query  232  KAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFY  411
            + AGDV         DG  + W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FY
Sbjct  108  RLAGDV---------DGPVFPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFY  158

Query  412  QYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMV  591
            QYNP+ AVW  +I WGHAVS+D+IHWLHLP AM+ DQ YD+ GVWTGSAT LPDG+I+M+
Sbjct  159  QYNPNKAVW-GDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVML  217

Query  592  YTGNTD--VQVQNLAYPANLSDPLL  660
            YTG+T+  VQVQNLAYPA+ SDPLL
Sbjct  218  YTGSTNESVQVQNLAYPADHSDPLL  242



>ref|XP_004515737.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=658

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 118/154 (77%), Gaps = 10/154 (6%)
 Frame = +1

Query  205  TSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLY  384
             S++ +  L AAG+ +   E        + W N MLSWQRTAFHFQP K+WMNDPNGP+Y
Sbjct  95   VSEKSNMFLSAAGNKVGETES-------FPWNNTMLSWQRTAFHFQPEKNWMNDPNGPMY  147

Query  385  HKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATT  564
            +KGWYH FYQYNP+ AVW  +I WGHAVSRDMIHWLHLP AM+ D+ YD  GVWTGSAT 
Sbjct  148  YKGWYHFFYQYNPNGAVW-GDIVWGHAVSRDMIHWLHLPLAMVADEWYDKNGVWTGSATI  206

Query  565  LPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            L DGQI+M+YTG+T+  VQVQNLAYPA+ SDPLL
Sbjct  207  LSDGQIVMLYTGSTNESVQVQNLAYPADPSDPLL  240



>dbj|BAD91192.1| soluble acid invertase [Pyrus communis]
Length=200

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 105/117 (90%), Gaps = 3/117 (3%)
 Frame = +1

Query  316  WQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLH  495
            WQRTAFHFQP K+W+NDPNGPL+HKGWYHLFYQYNP SAVW  NITWGHAVS DMIHWL+
Sbjct  1    WQRTAFHFQPEKNWINDPNGPLFHKGWYHLFYQYNPDSAVW-GNITWGHAVSTDMIHWLY  59

Query  496  LPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            LP AM+PD+ +D  GVWTGSAT LPDGQI+M+YTG+T+  VQVQNLAYPANLSDPLL
Sbjct  60   LPLAMVPDRWFDANGVWTGSATLLPDGQIIMLYTGSTNESVQVQNLAYPANLSDPLL  116



>gb|AES68467.2| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=632

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 110/128 (86%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+WT  M SWQRTAFHFQP  +WMNDP+GPL+H GWYHLFYQYNP SAVW  NI+WGH
Sbjct  91   VSYNWTKDMFSWQRTAFHFQPQNNWMNDPSGPLFHMGWYHLFYQYNPDSAVW-GNISWGH  149

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS DMIHWL+LP AM PD+ +D+ GVWTGSAT LPDG+++M+YTG+TD  VQVQNLA+P
Sbjct  150  AVSSDMIHWLYLPIAMEPDKWFDINGVWTGSATLLPDGEVIMLYTGDTDNYVQVQNLAHP  209

Query  637  ANLSDPLL  660
            ANLSDPLL
Sbjct  210  ANLSDPLL  217



>emb|CAA06839.1| invertase [Allium cepa]
Length=690

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 106/127 (83%), Gaps = 3/127 (2%)
 Frame = +1

Query  286  PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHA  465
            PY WTN+MLSWQRT FHFQP K+WMNDPNGPLY+KGWYH FYQYNP  AVW  NI WGHA
Sbjct  138  PYPWTNQMLSWQRTGFHFQPVKNWMNDPNGPLYYKGWYHFFYQYNPEGAVW-GNIAWGHA  196

Query  466  VSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTG--NTDVQVQNLAYPA  639
            VSRD++HW HLP AM+PDQ YD+ GVWTGSAT LPDGQI+M+YTG  N  VQVQNLA PA
Sbjct  197  VSRDLVHWTHLPLAMVPDQWYDINGVWTGSATILPDGQIVMLYTGATNESVQVQNLAVPA  256

Query  640  NLSDPLL  660
            + SD LL
Sbjct  257  DQSDTLL  263



>gb|KDO48371.1| hypothetical protein CISIN_1g0052792mg, partial [Citrus sinensis]
Length=553

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNG  375
            K+    +P  S  +AG    S          Y WTN MLSWQRTAFHFQP K+WMNDPNG
Sbjct  77   KEPERLRPFTSASSAGVSEKSNRRFGSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNG  136

Query  376  PLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGS  555
            P+++KGWYHLFYQYNP+ A+W  +I WGHAVS+D+IHW HLP AM+ DQ YD+ GVWTGS
Sbjct  137  PVFYKGWYHLFYQYNPNGAIW-GDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGS  195

Query  556  ATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            AT LPDG++MM+YTG+T+  VQVQNLAYPA+ SDPLL
Sbjct  196  ATILPDGKLMMLYTGSTNESVQVQNLAYPADPSDPLL  232



>ref|XP_010458650.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Camelina 
sativa]
Length=669

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 121/166 (73%), Gaps = 17/166 (10%)
 Frame = +1

Query  199  DETSQQPSPSLKAAGDVIPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQPP  348
            DET +  S S       +  V E + DG+           + W N MLSWQRTAFHFQP 
Sbjct  78   DETEKTTSSSRAR----LAGVSEKSNDGLWKLSGGRNTPAFEWNNSMLSWQRTAFHFQPE  133

Query  349  KSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPY  528
            ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAVSRD+IHW+HLP AM+ DQ Y
Sbjct  134  ENWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSRDLIHWVHLPLAMVADQWY  192

Query  529  DLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            D  GVWTGSAT LPDG I+M+YTG+TD  VQVQNLAYP +L+DPLL
Sbjct  193  DSNGVWTGSATILPDGSIVMLYTGSTDKAVQVQNLAYPEDLNDPLL  238



>gb|ADF27779.1| soluble acid invertase 1 [Orobanche ramosa]
Length=661

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = +1

Query  223  PSLKAAGDVIPSVEEAAGDG--VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGW  396
            PS   A  V   V    G G  + ++WTN MLSWQRTA+HFQP K+W+NDPNGPLY+ GW
Sbjct  93   PSRGVAQGVSEKVFRPVGGGGNLSFTWTNFMLSWQRTAYHFQPEKNWINDPNGPLYYNGW  152

Query  397  YHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDG  576
            YHLFYQYNP SAVW  NITWGHAVS D+IHWLHLP +++PDQ YD+ GVW+GS+T LPDG
Sbjct  153  YHLFYQYNPDSAVW-GNITWGHAVSMDLIHWLHLPLSVVPDQWYDINGVWSGSSTILPDG  211

Query  577  QIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            +I+M+YTG+T   VQVQ LAYPANLSDPLL
Sbjct  212  RIIMLYTGDTYDVVQVQCLAYPANLSDPLL  241



>ref|XP_008794813.1| PREDICTED: beta-fructofuranosidase 1-like [Phoenix dactylifera]
Length=664

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 115/151 (76%), Gaps = 7/151 (5%)
 Frame = +1

Query  226  SLKAAGDVIPSVEEAAGDGV----PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKG  393
            S K +G     +   AGD      PY WTN ML WQRT FHFQPPK+WMNDPNGP++HKG
Sbjct  88   SEKTSGAFPTLLSATAGDSAAAPPPYPWTNAMLEWQRTGFHFQPPKNWMNDPNGPMWHKG  147

Query  394  WYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPD  573
            WYHLFYQYNP S VW  NITWGHAVSRD++HW HLP AM+PD+ YDL GVWTGSAT LP 
Sbjct  148  WYHLFYQYNPDSVVW-GNITWGHAVSRDLVHWEHLPLAMVPDRWYDLSGVWTGSATILPT  206

Query  574  GQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            GQI+M+YTG+T+   QVQNLA P + SDPLL
Sbjct  207  GQIIMLYTGSTNESAQVQNLAVPVDPSDPLL  237



>ref|XP_010493951.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar [Camelina 
sativa]
Length=669

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 121/166 (73%), Gaps = 17/166 (10%)
 Frame = +1

Query  199  DETSQQPSPSLKAAGDVIPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQPP  348
            DET +  S S       +  V E + DG+           + W N MLSWQRTAFHFQP 
Sbjct  78   DETEKTTSSSRAR----LAGVSEKSNDGLWKLSGGRNTPAFEWNNSMLSWQRTAFHFQPE  133

Query  349  KSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPY  528
            ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAVSRD+IHW+HLP AM+ DQ Y
Sbjct  134  ENWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSRDLIHWVHLPLAMVADQWY  192

Query  529  DLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            D  GVWTGSAT LPDG I+M+YTG+TD  VQVQNLAYP +L+DPLL
Sbjct  193  DSNGVWTGSATILPDGSIVMLYTGSTDKAVQVQNLAYPEDLNDPLL  238



>ref|XP_012087134.1| PREDICTED: acid beta-fructofuranosidase-like [Jatropha curcas]
 gb|KDP25630.1| hypothetical protein JCGZ_20786 [Jatropha curcas]
Length=659

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP +AVW  NI WGHAV
Sbjct  119  YPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPDAAVW-GNIVWGHAV  177

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+IHWLHLP AM+ DQ YD+ GVWTGSAT LPDG+I+M+YTG+T+  VQVQNLAYPA+
Sbjct  178  SKDLIHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPAD  237

Query  643  LSDPLL  660
             +DPLL
Sbjct  238  HNDPLL  243



>ref|XP_007039920.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
 gb|EOY24421.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
Length=766

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 3/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G+ + Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I 
Sbjct  219  GNLLVYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIV  277

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNL  627
            WGHAVSRDMIHWLHLP AM+ DQ YD+ GVWTGSAT LPDG+++M+YTG+T   VQVQNL
Sbjct  278  WGHAVSRDMIHWLHLPLAMVADQWYDVNGVWTGSATILPDGKVVMLYTGSTAEAVQVQNL  337

Query  628  AYPANLSDPLL  660
            AYPAN +DPLL
Sbjct  338  AYPANPNDPLL  348



>gb|AJW82912.1| acid invertase [Dimocarpus longan]
Length=656

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N MLSWQRTAFHFQP K+WMNDPNGP+++KGWYH FYQYNP +AVW  +I WGHAV
Sbjct  114  FPWNNSMLSWQRTAFHFQPEKNWMNDPNGPVFYKGWYHFFYQYNPHAAVW-GDIVWGHAV  172

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRDMIHWLHLP AM+ DQ YD+ GVWTGSAT LPDGQ++M+YTG+TD  VQVQNLAYPA+
Sbjct  173  SRDMIHWLHLPLAMVADQWYDINGVWTGSATILPDGQLIMLYTGSTDKHVQVQNLAYPAD  232

Query  643  LSDPLL  660
             +DPLL
Sbjct  233  PNDPLL  238



>ref|XP_009775767.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana sylvestris]
Length=652

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 3/127 (2%)
 Frame = +1

Query  286  PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHA  465
            P+ WT +ML+WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP +AVW  NI WGHA
Sbjct  115  PFPWTKQMLAWQRTSFHFQPKKNWMNDPNGPLFYKGWYHLFYQYNPEAAVW-GNIVWGHA  173

Query  466  VSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPA  639
            VSRD+IHW HLP AM+ DQ YD+ GVWTGSAT LPDG+++M+YTG+T+  VQVQNLAYPA
Sbjct  174  VSRDLIHWQHLPVAMVADQWYDINGVWTGSATILPDGKLVMLYTGSTNESVQVQNLAYPA  233

Query  640  NLSDPLL  660
            + SDPLL
Sbjct  234  DPSDPLL  240



>ref|XP_006573732.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=675

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 3/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G+G  Y W N MLSWQRTA+HFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AVW  +I 
Sbjct  126  GNGESYPWNNSMLSWQRTAYHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAVW-GDIV  184

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVSRDMIHW HLP AM+ DQ YD  GVWTGSAT LPDGQ++M+YTG+T+  +QVQNL
Sbjct  185  WGHAVSRDMIHWFHLPLAMVADQWYDKNGVWTGSATILPDGQVIMLYTGSTNESMQVQNL  244

Query  628  AYPANLSDPLL  660
            AYPA+ SDPLL
Sbjct  245  AYPADPSDPLL  255



>ref|XP_009630517.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana tomentosiformis]
Length=652

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 3/127 (2%)
 Frame = +1

Query  286  PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHA  465
            P+ WT +ML+WQRT+FHFQP K+WMNDPNGPL++KGWYHLFYQYNP +AVW  NI WGHA
Sbjct  115  PFPWTKQMLAWQRTSFHFQPKKNWMNDPNGPLFYKGWYHLFYQYNPEAAVW-GNIVWGHA  173

Query  466  VSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPA  639
            VSRD+IHW HLP AM+ DQ YD+ GVWTGSAT LPDG+++M+YTG+T+  VQVQNLAYPA
Sbjct  174  VSRDLIHWQHLPVAMVADQWYDINGVWTGSATILPDGKLVMLYTGSTNESVQVQNLAYPA  233

Query  640  NLSDPLL  660
            + SDPLL
Sbjct  234  DPSDPLL  240



>gb|KHN42709.1| Acid beta-fructofuranosidase [Glycine soja]
Length=675

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 3/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G+G  Y W N MLSWQRTA+HFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AVW  +I 
Sbjct  126  GNGESYPWNNSMLSWQRTAYHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAVW-GDIV  184

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVSRDMIHW HLP AM+ DQ YD  GVWTGSAT LPDGQ++M+YTG+T+  +QVQNL
Sbjct  185  WGHAVSRDMIHWFHLPLAMVADQWYDKNGVWTGSATILPDGQVIMLYTGSTNESMQVQNL  244

Query  628  AYPANLSDPLL  660
            AYPA+ SDPLL
Sbjct  245  AYPADPSDPLL  255



>ref|XP_010259021.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X2 [Nelumbo nucifera]
Length=593

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 3/129 (2%)
 Frame = +1

Query  280  GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWG  459
            G  Y WTN MLSWQRTA+HFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWG
Sbjct  119  GDSYPWTNLMLSWQRTAYHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWG  177

Query  460  HAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAY  633
            HAVS+D+IHWL+LP AM+PD  YD+ GVWTGSAT LPDG ++++YTG+TD  VQVQNLA+
Sbjct  178  HAVSKDLIHWLYLPLAMVPDHWYDINGVWTGSATLLPDGSVVILYTGSTDEKVQVQNLAH  237

Query  634  PANLSDPLL  660
            PA+ SDPLL
Sbjct  238  PADPSDPLL  246



>dbj|BAB82419.1| acid invertase [Citrus unshiu]
Length=687

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNG  375
            K+    +P  S  +AG    S          Y WTN MLSWQRTAFHFQP K+WMNDPNG
Sbjct  77   KEPERLRPFTSASSAGVSEKSNRRFGSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNG  136

Query  376  PLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGS  555
            P+++KGWYHLFYQYNP+ A+W  +I WGHAVS+D+IHW HLP AM+ DQ YD+ GVWTGS
Sbjct  137  PVFYKGWYHLFYQYNPNGAIW-GDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGS  195

Query  556  ATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            AT LPDG++MM+YTG+T+  VQVQNLAYPA+ SDPLL
Sbjct  196  ATILPDGKLMMLYTGSTNESVQVQNLAYPADPSDPLL  232



>ref|XP_003526374.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=646

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V Y+WTN M SWQRTAFHFQP  +WMNDP+GPL+H GWYHLFYQYNP SA+W  NI+WGH
Sbjct  105  VSYNWTNAMFSWQRTAFHFQPQNNWMNDPDGPLFHMGWYHLFYQYNPDSAIW-GNISWGH  163

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVSRDMIHW +LP AM PD  YD+ GVWTGSAT LP G+I+++YTG+T+  VQVQNLAYP
Sbjct  164  AVSRDMIHWFYLPIAMGPDTWYDINGVWTGSATILPGGKIIILYTGDTNEYVQVQNLAYP  223

Query  637  ANLSDPLL  660
            ANLSDPLL
Sbjct  224  ANLSDPLL  231



>gb|KHN11662.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=534

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 3/120 (3%)
 Frame = +1

Query  307  MLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIH  486
            MLSWQRTAFHFQP ++WMNDPNGPL++ GWYH+FYQYNP SAVW  NITWGHAVSRD+IH
Sbjct  1    MLSWQRTAFHFQPQRNWMNDPNGPLFYMGWYHIFYQYNPDSAVW-GNITWGHAVSRDLIH  59

Query  487  WLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            WL+LP A++PD+ +D+ GVW+GSAT LPDG+I+M+YTGNTD  VQVQNLAYPANLSDPLL
Sbjct  60   WLYLPIALVPDKWFDISGVWSGSATLLPDGKILMLYTGNTDRNVQVQNLAYPANLSDPLL  119



>ref|XP_010941127.1| PREDICTED: beta-fructofuranosidase 1-like [Elaeis guineensis]
Length=661

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 3/127 (2%)
 Frame = +1

Query  286  PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHA  465
            PY WTN ML WQRT FHFQPP++WMNDPNGPL++KG YHLFYQYNP SAVW  NITWGHA
Sbjct  114  PYPWTNDMLQWQRTGFHFQPPRNWMNDPNGPLWYKGLYHLFYQYNPDSAVW-GNITWGHA  172

Query  466  VSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPA  639
            VSRD++HW HLP AM+PD  YDLRGVWTGSAT LP GQI+M+YTG+T+  VQVQNLA PA
Sbjct  173  VSRDLVHWAHLPLAMVPDHWYDLRGVWTGSATILPTGQIVMLYTGSTNESVQVQNLAVPA  232

Query  640  NLSDPLL  660
            + SDPLL
Sbjct  233  DPSDPLL  239



>ref|XP_010259020.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X1 [Nelumbo nucifera]
Length=664

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 3/129 (2%)
 Frame = +1

Query  280  GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWG  459
            G  Y WTN MLSWQRTA+HFQP K+WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWG
Sbjct  119  GDSYPWTNLMLSWQRTAYHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWG  177

Query  460  HAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAY  633
            HAVS+D+IHWL+LP AM+PD  YD+ GVWTGSAT LPDG ++++YTG+TD  VQVQNLA+
Sbjct  178  HAVSKDLIHWLYLPLAMVPDHWYDINGVWTGSATLLPDGSVVILYTGSTDEKVQVQNLAH  237

Query  634  PANLSDPLL  660
            PA+ SDPLL
Sbjct  238  PADPSDPLL  246



>ref|XP_009340588.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=645

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y+WTN M SWQRTAFHFQP  +WMNDPNGPL++KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  109  YNWTNAMFSWQRTAFHFQPADNWMNDPNGPLFYKGWYHLFYQYNPDSAVW-GNITWGHAV  167

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S DMIHWL+LP AM+PD+ +D  GVWTGSAT LP+G IM++YTG+T+  VQVQ LAYPAN
Sbjct  168  STDMIHWLYLPLAMVPDRWFDANGVWTGSATILPNGDIMILYTGSTNDSVQVQTLAYPAN  227

Query  643  LSDPLL  660
            LSDPLL
Sbjct  228  LSDPLL  233



>gb|AGW23637.1| soluble acid invertase [Lilium davidii]
Length=635

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W+N ML WQRT FHFQP K+WMNDP+GPL++KGWYHLFYQYNP SAVW  NITWGH+V
Sbjct  89   FPWSNAMLKWQRTGFHFQPEKNWMNDPDGPLFYKGWYHLFYQYNPDSAVW-GNITWGHSV  147

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHWLHLP A +PD  YD  GVWTGSAT LPDG+I+MVYTG+T   VQVQNLAYPA+
Sbjct  148  SRDLIHWLHLPLAFVPDHWYDANGVWTGSATFLPDGRIVMVYTGSTTEAVQVQNLAYPAD  207

Query  643  LSDPLL  660
            L DPLL
Sbjct  208  LDDPLL  213



>ref|XP_004298661.1| PREDICTED: acid beta-fructofuranosidase-like [Fragaria vesca 
subsp. vesca]
Length=694

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 110/132 (83%), Gaps = 4/132 (3%)
 Frame = +1

Query  274  GDGVP-YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
            G G P Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP  AVW  NI
Sbjct  119  GAGTPVYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPKGAVW-GNI  177

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQN  624
             WGHAVSRD+IHWLHLP AM+ DQ YD+ GVWTGSAT LP+GQI+M+YTG+T+  VQVQ 
Sbjct  178  VWGHAVSRDLIHWLHLPLAMVADQWYDINGVWTGSATILPNGQIVMLYTGSTNESVQVQC  237

Query  625  LAYPANLSDPLL  660
            LAYPA+ +DPLL
Sbjct  238  LAYPADHNDPLL  249



>gb|ACT21538.1| acid invertase [Vigna radiata]
Length=579

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 112/135 (83%), Gaps = 5/135 (4%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            E  A +  P  W N MLSWQRT+FHFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AVW 
Sbjct  28   EGGASEAFP--WDNSMLSWQRTSFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAVW-  84

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
             +I WGHAVSRDMIHWLHLP AM+ DQ YD +GVWTGSAT LP+G+I+M+YTG+T+  VQ
Sbjct  85   GDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPNGEIIMLYTGSTNESVQ  144

Query  616  VQNLAYPANLSDPLL  660
            VQNLAYPA+ SDPLL
Sbjct  145  VQNLAYPADPSDPLL  159



>ref|XP_008373808.1| PREDICTED: acid beta-fructofuranosidase [Malus domestica]
Length=681

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  214  QPSPSLKAAGDVIPSVEEA-AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHK  390
            +P P   AAG    S   A A DG  + W N MLSWQRTAFHFQP K+WMNDPNGPL++K
Sbjct  87   RPVPRGIAAGVSEKSNRLADAVDGPAFPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYK  146

Query  391  GWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLP  570
            GWYH FYQ+NP+ A+W  +I WGHAVS+D+IHWLHLP AM+ DQ YD+ GVWTGSAT LP
Sbjct  147  GWYHFFYQWNPNGAIW-GDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILP  205

Query  571  DGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            DG+I+M+YTG+T+  VQVQNLAYPA+ +DPLL
Sbjct  206  DGKIVMLYTGSTNESVQVQNLAYPADHNDPLL  237



>gb|AFH77957.1| vacuolar invertase [Manihot esculenta]
Length=660

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 120/153 (78%), Gaps = 5/153 (3%)
 Frame = +1

Query  208  SQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYH  387
            S+  S  +    ++I    E++ D   Y W N MLSWQRTAFHFQP K+WMNDPNGPL++
Sbjct  96   SRGKSAGVSEKANLISGGSESSTD--QYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFY  153

Query  388  KGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTL  567
            KGWYH FYQYNP++AVW  +I WGHAVSRD+IHWLHLP AM+ DQ YD  GVWTGSAT L
Sbjct  154  KGWYHFFYQYNPNAAVW-GDIVWGHAVSRDLIHWLHLPLAMVADQWYDQNGVWTGSATIL  212

Query  568  PDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            PDG+I+M+YTG+T+  VQVQNLAYPA+ +DPLL
Sbjct  213  PDGKIVMLYTGSTNESVQVQNLAYPADPNDPLL  245



>ref|XP_011033927.1| PREDICTED: acid beta-fructofuranosidase [Populus euphratica]
Length=661

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 146/235 (62%), Gaps = 25/235 (11%)
 Frame = +1

Query  28   SSSYKPPYTPLSDRTESAGAPE-NLRRSLKFFTCT------lisllcvvlsvlvvlnhss  186
            S+S +P Y P+ +   SAG P  +LRRS K           +  +L  + +         
Sbjct  11   SNSLEPNYRPVPEVAVSAGCPATHLRRSKKVLIAVFSGLFVVSLILATINNNNGARRVRY  70

Query  187  elvKDETSQQPSP-------SLKAAGD--VIPSVEEAAGDGVP------YSWTNRMLSWQ  321
               +DE +   +P       +L  AG   V   V E A   +       Y W N MLSWQ
Sbjct  71   HSQEDEYASLATPKEMAKPETLSPAGSRGVSAGVSEKANVNLKGAQVKDYPWNNSMLSWQ  130

Query  322  RTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLP  501
            RTAFHFQP ++WMNDPNGPLY+KGWYH FYQYNP +AVW  +I WGHAVSRD+IHWLHLP
Sbjct  131  RTAFHFQPQENWMNDPNGPLYYKGWYHFFYQYNPHAAVW-GDIVWGHAVSRDLIHWLHLP  189

Query  502  YAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
             AM+ D+ YD  GVWTGSAT LPDG+I+M+YTG+T+  VQVQNLAYPA+  DPLL
Sbjct  190  LAMVADKWYDKNGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPADHDDPLL  244



>ref|XP_003580229.1| PREDICTED: beta-fructofuranosidase 1-like [Brachypodium distachyon]
Length=679

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 9/147 (6%)
 Frame = +1

Query  226  SLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHL  405
            S K+AG   P++ EA   G  + WT  ML+WQRTAFHFQP K+WMNDPNGPLY+KGWYHL
Sbjct  115  SEKSAG---PALLEA---GRAFDWTKGMLAWQRTAFHFQPQKNWMNDPNGPLYYKGWYHL  168

Query  406  FYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIM  585
            FYQ+NP +AVW  NITWGHAVSRD+IHWLHLP AM+PD  YD+ GVWTGSATTLPDG+I+
Sbjct  169  FYQWNPDAAVW-GNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATTLPDGRIV  227

Query  586  MVYTGNTD--VQVQNLAYPANLSDPLL  660
            M+YTG T+  VQVQ LA PA+ SDPLL
Sbjct  228  MLYTGATEEMVQVQLLAEPADPSDPLL  254



>gb|AEB66649.1| vacuole invertase [Rumex dentatus]
Length=567

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D   + WTN ML+WQRT +HFQP K+WMNDPNGPLYH GWYHLFYQYNP SAVW  NITW
Sbjct  96   DNDSFVWTNAMLTWQRTGYHFQPQKNWMNDPNGPLYHMGWYHLFYQYNPDSAVW-GNITW  154

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS D+I+WL+LP AM+PD+ +D  GVWTGSAT LP G I+M+YTG+TD  VQVQNLA
Sbjct  155  GHAVSTDLINWLYLPLAMVPDRWFDWNGVWTGSATLLPGGDIVMLYTGDTDNYVQVQNLA  214

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  215  YPANLSDPLL  224



>ref|XP_010430328.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X1 [Camelina sativa]
 ref|XP_010430329.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X2 [Camelina sativa]
Length=648

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 121/160 (76%), Gaps = 6/160 (4%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVI-PSVEEAAGDGV--PYSWTNRMLSWQRTAFHFQPPKSWMND  366
            KDETS +    L    +     V + +GDG    + W N MLSWQRTAFHFQP K+WMND
Sbjct  67   KDETSTESRARLAGVSEKSNDGVWKLSGDGKTEAFPWNNTMLSWQRTAFHFQPEKNWMND  126

Query  367  PNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVW  546
            PNGPL++KGWYH FYQYNP++AVW  +I WGHAVS+D+IHWL+LP AM+PDQ YD  GVW
Sbjct  127  PNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPLAMVPDQWYDANGVW  185

Query  547  TGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            TGSAT L DG I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  186  TGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPEDPSDPLL  225



>gb|AEB66648.1| vacuole invertase [Rumex dentatus]
Length=567

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            D   + WTN ML+WQRT +HFQP K+WMNDPNGPLYH GWYHLFYQYNP SAVW  NITW
Sbjct  96   DNDSFVWTNAMLTWQRTGYHFQPQKNWMNDPNGPLYHMGWYHLFYQYNPDSAVW-GNITW  154

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS D+I+WL+LP AM+PD+ +D  GVWTGSAT LP G I+M+YTG+TD  VQVQNLA
Sbjct  155  GHAVSTDLINWLYLPLAMVPDRWFDWNGVWTGSATLLPGGDIVMLYTGDTDNYVQVQNLA  214

Query  631  YPANLSDPLL  660
            YPANLSDPLL
Sbjct  215  YPANLSDPLL  224



>gb|AEY79729.1| vacuolar invertase isoform 1 [Rosa hybrid cultivar]
Length=588

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 118/155 (76%), Gaps = 4/155 (3%)
 Frame = +1

Query  202  ETSQQPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPL  381
            ET+    P  KA G V         D + Y+WTN M SWQRTAFHFQP ++WMNDPNGPL
Sbjct  80   ETTASWEPRGKALG-VSAKSNPPVSDELSYNWTNAMFSWQRTAFHFQPERNWMNDPNGPL  138

Query  382  YHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSAT  561
            ++KGWYHLFYQYNP SA+W  NITWGHAVS D+IHWL+LP AM+ DQ YD  GVW+GSAT
Sbjct  139  FYKGWYHLFYQYNPDSAIW-GNITWGHAVSTDLIHWLYLPIAMVADQWYDANGVWSGSAT  197

Query  562  TLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
             LPDGQI+M+YTG+T   VQV  LA+PANLSDPLL
Sbjct  198  LLPDGQIVMLYTGDTVDAVQVVCLAHPANLSDPLL  232



>ref|XP_003635662.2| PREDICTED: acid beta-fructofuranosidase-like, partial [Vitis 
vinifera]
Length=273

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = +1

Query  214  QPSPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKG  393
            +P+    +AG    S    +G   P+ W+N ML+WQRT +HFQP K+WMNDPNGP+++ G
Sbjct  37   EPASRGPSAGVSEKSFRLHSGVRAPFPWSNTMLTWQRTGYHFQPEKNWMNDPNGPMFYGG  96

Query  394  WYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPD  573
            WYH FYQYNP +AVW  NI WGHAVS+D+I WLHLP AM+ DQ YD  GVWTGSAT L D
Sbjct  97   WYHFFYQYNPDAAVW-GNIVWGHAVSKDLIEWLHLPLAMVADQWYDTNGVWTGSATLLSD  155

Query  574  GQIMMVYTG--NTDVQVQNLAYPANLSDPLL  660
            GQ++M+YTG  N  VQVQNLAYPA+LSDPLL
Sbjct  156  GQVIMLYTGATNESVQVQNLAYPADLSDPLL  186



>ref|XP_003538727.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=622

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 108/131 (82%), Gaps = 3/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G G  Y W N +LSWQRTA+HFQP K+WMNDPNGP+++K WYH FYQYNP  AVW  +I 
Sbjct  121  GSGESYPWNNSVLSWQRTAYHFQPEKNWMNDPNGPMFYKEWYHFFYQYNPKGAVW-GDIV  179

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVSRDMIHWLHLP AM+ DQ YD  GVWTGSAT LPDGQI+M+YTG+T+  VQVQNL
Sbjct  180  WGHAVSRDMIHWLHLPLAMMADQWYDKNGVWTGSATILPDGQIIMLYTGSTNESVQVQNL  239

Query  628  AYPANLSDPLL  660
            AYPA+ SDPLL
Sbjct  240  AYPADPSDPLL  250



>ref|XP_007157332.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
 gb|ESW29326.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
Length=649

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
            + +G  Y W N +LSWQRTA+HFQP K+WMNDPNGP+Y+KGWYH FYQYNP  AVW  +I
Sbjct  99   SNNGESYPWNNTLLSWQRTAYHFQPQKNWMNDPNGPMYYKGWYHFFYQYNPKGAVW-GDI  157

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQN  624
             WGHAVSRD+IHWLHLP AM+ DQ YD  GVWTGSAT LP+G+++M+YTG+T+  VQVQN
Sbjct  158  VWGHAVSRDLIHWLHLPLAMVADQWYDKNGVWTGSATILPNGEVIMLYTGSTNESVQVQN  217

Query  625  LAYPANLSDPLL  660
            LAYPA+LSDPLL
Sbjct  218  LAYPADLSDPLL  229



>ref|XP_009350311.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=680

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
            A DG  + W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQ+NP+ AVW  +I
Sbjct  107  AVDGPAFPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQWNPNGAVW-GDI  165

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQN  624
             WGHAVS+D+IHWLHLP AM+ DQ YD+ GVWTGSAT LPDG+I+M+YTG+T+  VQVQN
Sbjct  166  VWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQN  225

Query  625  LAYPANLSDPLL  660
            LAYPA+ +DPLL
Sbjct  226  LAYPADHNDPLL  237



>dbj|BAF35859.1| soluble acid invertase [Pyrus pyrifolia var. culta]
 dbj|BAG30920.1| soluble acid invertase [Pyrus pyrifolia]
Length=681

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
            A DG  + W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQ+NP+ AVW  +I
Sbjct  107  AVDGPAFPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQWNPNGAVW-GDI  165

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQN  624
             WGHAVS+D+IHWLHLP AM+ DQ YD+ GVWTGSAT LPDG+I+M+YTG+T+  VQVQN
Sbjct  166  VWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQN  225

Query  625  LAYPANLSDPLL  660
            LAYPA+ +DPLL
Sbjct  226  LAYPADHNDPLL  237



>emb|CDY30056.1| BnaC05g09640D [Brassica napus]
Length=659

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V +SW N MLSWQRTAFHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  106  VAFSWNNSMLSWQRTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  164

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHW+HLP AM+ DQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP
Sbjct  165  AVSKDLIHWVHLPLAMVADQWYDANGVWTGSATFLEDGSIVMLYTGSTDKSVQVQNLAYP  224

Query  637  ANLSDPLL  660
             +L+DPLL
Sbjct  225  EDLNDPLL  232



>ref|XP_009343902.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
 ref|XP_009343903.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=681

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
            A DG  + W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQ+NP+ AVW  +I
Sbjct  107  AVDGPAFPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQWNPNGAVW-GDI  165

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQN  624
             WGHAVS+D+IHWLHLP AM+ DQ YD+ GVWTGSAT LPDG+I+M+YTG+T+  VQVQN
Sbjct  166  VWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQN  225

Query  625  LAYPANLSDPLL  660
            LAYPA+ +DPLL
Sbjct  226  LAYPADHNDPLL  237



>ref|XP_008238615.1| PREDICTED: acid beta-fructofuranosidase-like [Prunus mume]
Length=686

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP+ AVW  +I WGHAV
Sbjct  118  FPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNKAVW-GDIVWGHAV  176

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+IHWLHLP AM+ DQ YD+ GVWTGSAT LPDG+I+M+YTG+T+  VQVQNLAYPA+
Sbjct  177  SKDLIHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPAD  236

Query  643  LSDPLL  660
             SDPLL
Sbjct  237  HSDPLL  242



>gb|AFV94412.1| soluble acid invertase 1 [Saccharum hybrid cultivar GT28]
Length=685

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  118  RADGGGNAFPWSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  177

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTG--NTDVQV  618
             I WGHAVSRD+IHW HLP AMLPDQ YD  GVWTGSATTLPDG++ M+YTG  NT VQV
Sbjct  178  KIAWGHAVSRDLIHWRHLPLAMLPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNTSVQV  237

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+  DPLL
Sbjct  238  QCLAVPADDDDPLL  251



>gb|KJB51894.1| hypothetical protein B456_008G236700 [Gossypium raimondii]
Length=493

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            + Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP +AVW  +I WGH
Sbjct  104  LAYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPHAAVW-GDIVWGH  162

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYP  636
            AVS+D+IHWLHLP AM+ DQ YD  GVWTGSAT LPDG+++M+YTG+T  +VQVQNLAYP
Sbjct  163  AVSKDLIHWLHLPLAMVADQWYDKNGVWTGSATILPDGKVVMLYTGSTTENVQVQNLAYP  222

Query  637  ANLSDPLL  660
            A+ SDPLL
Sbjct  223  ADHSDPLL  230



>gb|KJB51889.1| hypothetical protein B456_008G236700 [Gossypium raimondii]
Length=649

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            + Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP +AVW  +I WGH
Sbjct  104  LAYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPHAAVW-GDIVWGH  162

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYP  636
            AVS+D+IHWLHLP AM+ DQ YD  GVWTGSAT LPDG+++M+YTG+T  +VQVQNLAYP
Sbjct  163  AVSKDLIHWLHLPLAMVADQWYDKNGVWTGSATILPDGKVVMLYTGSTTENVQVQNLAYP  222

Query  637  ANLSDPLL  660
            A+ SDPLL
Sbjct  223  ADHSDPLL  230



>sp|P29001.1|INVA_VIGRR RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Contains: RecName: Full=Acid 
beta-fructofuranosidase 30 kDa subunit; Contains: RecName: 
Full=Acid beta-fructofuranosidase 38 kDa subunit; Flags: 
Precursor [Vigna radiata var. radiata]
 dbj|BAA01107.1| invertase [Vigna radiata]
 prf||1905412A acid invertase
Length=649

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 5/145 (3%)
 Frame = +1

Query  232  KAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFY  411
            + + +++ + E  A +  P  W N MLSWQRT+FHFQP K+WMNDPNGP+Y+KGWYH FY
Sbjct  88   EKSSNLLFAGEGGASEAFP--WDNSMLSWQRTSFHFQPEKNWMNDPNGPMYYKGWYHFFY  145

Query  412  QYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMV  591
            QYNP+ AVW  +I WGHAVSRDMIHWLHLP AM+ DQ YD +GVWTGSAT LP+G+I+M+
Sbjct  146  QYNPNGAVW-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPNGEIIML  204

Query  592  YTGNTD--VQVQNLAYPANLSDPLL  660
            YTG+T+  VQVQNLAYPA+ SDPLL
Sbjct  205  YTGSTNESVQVQNLAYPADPSDPLL  229



>emb|CDY39804.1| BnaA09g10560D [Brassica napus]
Length=631

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            +G  ++W N MLSWQRTAFHFQP K+WMNDP+GPL++KGWYH FYQYNP++AVW  +I W
Sbjct  97   EGEAFAWNNTMLSWQRTAFHFQPEKNWMNDPDGPLFYKGWYHFFYQYNPNAAVW-GDIVW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHWLHLP+AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLA
Sbjct  156  GHAVSKDLIHWLHLPFAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLA  215

Query  631  YPANLSDPLL  660
            YP + +DPLL
Sbjct  216  YPEDPNDPLL  225



>ref|NP_001234069.1| invertase [Solanum lycopersicum]
 emb|CAJ19056.1| invertase [Solanum lycopersicum]
Length=652

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 110/127 (87%), Gaps = 3/127 (2%)
 Frame = +1

Query  286  PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHA  465
            P+ WT +ML+WQRT+FHFQP K+WMNDPNGPLY+KGWYHLFYQYNP +AVW  NI WGHA
Sbjct  115  PFPWTQKMLAWQRTSFHFQPKKNWMNDPNGPLYYKGWYHLFYQYNPEAAVW-GNIVWGHA  173

Query  466  VSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPA  639
            VSRD+IHW HLP AM+ DQ YD+ GVWTGSAT LP+G ++M+YTG+T+  +QVQNLAYPA
Sbjct  174  VSRDLIHWQHLPVAMVADQWYDINGVWTGSATFLPNGDLIMLYTGSTNESIQVQNLAYPA  233

Query  640  NLSDPLL  660
            + SDPLL
Sbjct  234  DPSDPLL  240



>ref|XP_009112697.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Brassica 
rapa]
Length=655

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            +G  ++W N MLSWQRTAFHFQP K+WMNDP+GPL++KGWYH FYQYNP++AVW  +I W
Sbjct  97   EGEAFAWNNTMLSWQRTAFHFQPEKNWMNDPDGPLFYKGWYHFFYQYNPNAAVW-GDIVW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHWLHLP+AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLA
Sbjct  156  GHAVSKDLIHWLHLPFAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLA  215

Query  631  YPANLSDPLL  660
            YP + +DPLL
Sbjct  216  YPEDPNDPLL  225



>gb|AFV94469.1| soluble acid invertase 6 [Saccharum hybrid cultivar GT28]
Length=695

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  131  RADGSGNAFPWSNAMLQWQRTGFHFQPQKNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  190

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AMLPDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  191  KIAWGHAVSRDLIHWRHLPLAMLPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  250

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  251  QCLAVPADDADPLL  264



>ref|XP_007155629.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
 gb|ESW27623.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
Length=651

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 113/137 (82%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            S E  A +  P  W N MLSWQRT+FHFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AV
Sbjct  96   SGEGGASEAFP--WDNSMLSWQRTSFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAV  153

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YD +GVWTGSAT LP+G+I+M+YTG+T+  
Sbjct  154  W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPNGEIIMLYTGSTNES  212

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPA+ SDPLL
Sbjct  213  VQVQNLAYPADPSDPLL  229



>ref|XP_010053435.1| PREDICTED: acid beta-fructofuranosidase-like [Eucalyptus grandis]
 gb|KCW77732.1| hypothetical protein EUGRSUZ_D02029 [Eucalyptus grandis]
Length=653

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N MLSWQRTA+HFQP K+WMNDPNGP+Y+KGWYH FYQYNP +AVW  NI WGHAV
Sbjct  117  FPWNNSMLSWQRTAYHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPDAAVW-GNIVWGHAV  175

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTG--NTDVQVQNLAYPAN  642
            S D+IHWL+LP AM+ DQ YD+ GVW+GSAT LPDGQ+MM+YTG  N   Q+QNLAYPAN
Sbjct  176  SEDLIHWLYLPLAMVADQWYDINGVWSGSATVLPDGQVMMLYTGSSNESQQLQNLAYPAN  235

Query  643  LSDPLL  660
            LSDPLL
Sbjct  236  LSDPLL  241



>sp|O24509.1|INVA_PHAVU RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Phaseolus 
vulgaris]
 gb|AAB68679.1| soluble acid invertase [Phaseolus vulgaris]
Length=651

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 113/137 (82%), Gaps = 5/137 (4%)
 Frame = +1

Query  256  SVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAV  435
            S E  A +  P  W N MLSWQRT+FHFQP K+WMNDPNGP+Y+KGWYH FYQYNP+ AV
Sbjct  96   SGEGGASEAFP--WDNSMLSWQRTSFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAV  153

Query  436  WVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--  609
            W  +I WGHAVSRDMIHWLHLP AM+ DQ YD +GVWTGSAT LP+G+I+M+YTG+T+  
Sbjct  154  W-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPNGEIIMLYTGSTNES  212

Query  610  VQVQNLAYPANLSDPLL  660
            VQVQNLAYPA+ SDPLL
Sbjct  213  VQVQNLAYPADPSDPLL  229



>emb|CDY03265.1| BnaC09g10830D [Brassica napus]
Length=631

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITW  456
            +G  ++W N MLSWQRTAFHFQP K+WMNDP+GPL++KGWYH FYQYNP++AVW  +I W
Sbjct  97   EGEAFAWNNTMLSWQRTAFHFQPEKNWMNDPDGPLFYKGWYHFFYQYNPNAAVW-GDIVW  155

Query  457  GHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLA  630
            GHAVS+D+IHWLHLP+AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLA
Sbjct  156  GHAVSKDLIHWLHLPFAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLA  215

Query  631  YPANLSDPLL  660
            YP + +DPLL
Sbjct  216  YPEDPNDPLL  225



>gb|AFJ21575.1| vacuolar invertase [Agave tequilana]
 gb|AFJ21581.1| putative vacuolar invertase [Agave tequilana]
Length=646

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 3/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G G PY WTN+MLSWQRT FHFQP ++WMNDPNGP+Y+KGWYH FYQYNP +AVW  NI 
Sbjct  96   GSGGPYQWTNQMLSWQRTGFHFQPERNWMNDPNGPMYYKGWYHFFYQYNPDAAVW-GNIA  154

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVSRD++ W HLP A+ PDQ YD++GVW+GSAT LPDG+++++YTG T+   QVQNL
Sbjct  155  WGHAVSRDLVRWKHLPIALAPDQWYDIKGVWSGSATLLPDGRVILLYTGGTNESAQVQNL  214

Query  628  AYPANLSDPLL  660
            A P +L+DPLL
Sbjct  215  AVPVDLNDPLL  225



>gb|KFK40589.1| hypothetical protein AALP_AA2G015400 [Arabis alpina]
Length=650

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N +LSWQRTAFHFQP K+WMNDPNGPLY+KGWYH FYQYNP++AVW  +I WGHAV
Sbjct  90   FPWNNTILSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNAAVW-GDIVWGHAV  148

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+IHWL+LP+A++PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP +
Sbjct  149  SKDLIHWLYLPFALVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPED  208

Query  643  LSDPLL  660
            LSDPLL
Sbjct  209  LSDPLL  214



>ref|XP_002889923.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66182.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
Length=663

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 114/149 (77%), Gaps = 13/149 (9%)
 Frame = +1

Query  250  IPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            +  V E + DG+           + W N MLSWQRTAFHFQP ++WMNDPNGPL++KGWY
Sbjct  86   LAGVSEKSNDGLWKLSGDRNTPAFEWNNSMLSWQRTAFHFQPEQNWMNDPNGPLFYKGWY  145

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            H FYQYNP++AVW  +I WGHAVSRD+IHW+HLP AM+ DQ YD  GVWTGSAT LPDG 
Sbjct  146  HFFYQYNPNAAVW-GDIVWGHAVSRDLIHWVHLPIAMVADQWYDSNGVWTGSATILPDGS  204

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  205  IVMLYTGSTDKAVQVQNLAYPEDPSDPLL  233



>ref|XP_006355490.1| PREDICTED: acid beta-fructofuranosidase-like [Solanum tuberosum]
Length=653

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 110/127 (87%), Gaps = 3/127 (2%)
 Frame = +1

Query  286  PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHA  465
            P+ WT +ML+WQRT+FHFQP K+WMNDPNGPLY+KGWYHLFYQYNP +AVW  NI WGHA
Sbjct  116  PFPWTQKMLAWQRTSFHFQPKKNWMNDPNGPLYYKGWYHLFYQYNPEAAVW-GNIVWGHA  174

Query  466  VSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPA  639
            VS+D+IHW HLP AM+ DQ YD+ GVWTGSAT LP+G ++M+YTG+T+  VQVQNLAYPA
Sbjct  175  VSKDLIHWQHLPVAMVADQWYDINGVWTGSATFLPNGDLIMLYTGSTNELVQVQNLAYPA  234

Query  640  NLSDPLL  660
            + SDPLL
Sbjct  235  DPSDPLL  241



>ref|XP_010418267.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=648

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 120/160 (75%), Gaps = 6/160 (4%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVI-PSVEEAAGDGV--PYSWTNRMLSWQRTAFHFQPPKSWMND  366
            KDETS +    L    +     V   +GDG    + W N MLSWQRTAFHFQP K+WMND
Sbjct  67   KDETSTESRARLAGVSEKSNDRVWRLSGDGKTEAFPWNNTMLSWQRTAFHFQPEKNWMND  126

Query  367  PNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVW  546
            PNGPL++KGWYH FYQYNP++AVW  +I WGHAVS+D+IHWL+LP AM+PD+ YD  GVW
Sbjct  127  PNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPLAMVPDKWYDANGVW  185

Query  547  TGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            TGSAT L DG I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  186  TGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPEDPSDPLL  225



>gb|AAP59436.1| soluble acid invertase [Saccharum hybrid cultivar Pindar]
Length=640

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  73   RADGGGNAFPWSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  132

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AMLPDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  133  KIAWGHAVSRDLIHWRHLPLAMLPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  192

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  193  QCLAVPADDADPLL  206



>gb|AAG36943.1|AF274299_1 acid invertase [Brassica oleracea]
Length=662

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V +SW N MLSWQRTAFHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  106  VAFSWNNSMLSWQRTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  164

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHW+HLP AM  DQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP
Sbjct  165  AVSKDLIHWVHLPLAMAADQWYDANGVWTGSATFLEDGSIVMLYTGSTDKSVQVQNLAYP  224

Query  637  ANLSDPLL  660
             +L+DPLL
Sbjct  225  EDLNDPLL  232



>gb|AAB71136.1| acid invertase [Asparagus officinalis]
Length=662

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN+MLSWQRT FHFQP K+WMNDPNGPLY+KGWYH FYQYNP++AVW  +I WGHAV
Sbjct  107  YPWTNKMLSWQRTGFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNAAVW-GDIAWGHAV  165

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTG--NTDVQVQNLAYPAN  642
            S+D++ W HLP AM+PD+ YD+ GVWTGSAT LPDG+I+M+YTG  N  VQVQNLA PA+
Sbjct  166  SKDLLSWRHLPLAMVPDRWYDINGVWTGSATILPDGRIIMLYTGATNESVQVQNLAVPAD  225

Query  643  LSDPLL  660
            LSDPLL
Sbjct  226  LSDPLL  231



>ref|XP_002303519.1| vacuolar invertase family protein [Populus trichocarpa]
 gb|EEE78498.1| vacuolar invertase family protein [Populus trichocarpa]
Length=662

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 150/236 (64%), Gaps = 26/236 (11%)
 Frame = +1

Query  28   SSSYKPPYTPLSDRTESAGAPE-NLRRSLKFFTCTlisllcvvlsvlvvlnhsse-----  189
            S+S +P Y+P  +   SAG P  +LRRS K        LL V L +  + N++       
Sbjct  11   SNSLEPSYSPAPEGAVSAGCPATHLRRSKKVLIAVFSGLLVVSLILATINNNNGGRHVQY  70

Query  190  -lvKDETSQQPSP-------SLKAAG---DVIPSVEEAAGDGVP------YSWTNRMLSW  318
               +DE +   +P       +L  AG    V   V E A   +       Y W N MLSW
Sbjct  71   HSQEDEDASLATPKEMAKPETLLPAGYSRGVSAGVSEKANVNLKGAQVKDYPWNNSMLSW  130

Query  319  QRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHL  498
            QRTAFHFQP ++WMNDPNGPLY+KGWYH FYQYNP +AVW  +I WGHAVS+D+IHWLHL
Sbjct  131  QRTAFHFQPEENWMNDPNGPLYYKGWYHFFYQYNPHAAVW-GDIVWGHAVSKDLIHWLHL  189

Query  499  PYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            P AM+ D+ YD  GVWTGSAT LPDG+I+M+YTG+T+  VQVQNLAYPA+  DPLL
Sbjct  190  PLAMVADKWYDKNGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPADHDDPLL  245



>gb|AAM77272.1|AF519809_1 acid invertase [Lagenaria siceraria]
Length=663

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 121/161 (75%), Gaps = 10/161 (6%)
 Frame = +1

Query  202  ETSQQPSPSLKAAGDVIPSVEEAAG----DGV-PYSWTNRMLSWQRTAFHFQPPKSWMND  366
            E +Q P P  + A  V   V   +     D V  ++WTN M SWQRT FHFQP  +WMND
Sbjct  95   ENTQSPPP-FRLARGVAEGVSAKSNPYFSDSVDSFNWTNAMFSWQRTFFHFQPEGNWMND  153

Query  367  PNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHL-PYAMLPDQPYDLRGV  543
            PNGPLYHKGWYHLFYQYNP SAVW  NI+WGHAVSRD+I   ++  YAM+PDQPYD+ GV
Sbjct  154  PNGPLYHKGWYHLFYQYNPESAVW-GNISWGHAVSRDLITLAYISAYAMVPDQPYDVNGV  212

Query  544  WTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPANLSDPLL  660
            WTGSAT LPDG+I+M+YTG+T   VQVQNLAYPANLSDPLL
Sbjct  213  WTGSATILPDGRIIMLYTGDTIDGVQVQNLAYPANLSDPLL  253



>ref|XP_006391837.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
 gb|ESQ29123.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
Length=655

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V ++W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  100  VAFAWNNTMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  158

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHWL+LP+AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP
Sbjct  159  AVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAYP  218

Query  637  ANLSDPLL  660
             +  DPLL
Sbjct  219  EDPKDPLL  226



>gb|AFV94413.1| soluble acid invertase 2 [Saccharum hybrid cultivar GT28]
Length=695

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  128  RADGGGNAFPWSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  187

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTG--NTDVQV  618
             I WGHAVSRD+IHW HLP AMLPDQ YD  GVWTGSATTLPDG++ M+YTG  NT VQV
Sbjct  188  KIAWGHAVSRDLIHWRHLPLAMLPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNTSVQV  247

Query  619  QNLAYPANLSDPLL  660
            Q LA PA   DPLL
Sbjct  248  QCLAVPAGDDDPLL  261



>emb|CDX98080.1| BnaA06g08310D [Brassica napus]
Length=662

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V +SW N MLSWQRT FHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  106  VAFSWNNSMLSWQRTGFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  164

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHW+HLP AM+ DQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP
Sbjct  165  AVSKDLIHWVHLPLAMVADQWYDANGVWTGSATFLEDGSIVMLYTGSTDKSVQVQNLAYP  224

Query  637  ANLSDPLL  660
             +L+DPLL
Sbjct  225  EDLNDPLL  232



>ref|XP_009401797.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN ML WQRTAFHFQP K+WMNDP+GP Y+KGWYHLFYQYNP SAVW  NI+WGHAV
Sbjct  111  YPWTNSMLLWQRTAFHFQPQKNWMNDPDGPTYYKGWYHLFYQYNPDSAVW-GNISWGHAV  169

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPAN  642
            SRD++HWL+LP AM+PD+ YD  GVWTGSATTLPDG+++M+YTG T   VQVQNLA+PA+
Sbjct  170  SRDLVHWLYLPLAMVPDRWYDANGVWTGSATTLPDGRLVMIYTGATMESVQVQNLAFPAD  229

Query  643  LSDPLL  660
              DPLL
Sbjct  230  PDDPLL  235



>gb|AFR69121.1| vacuolar invertase [Manihot esculenta]
Length=653

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAV
Sbjct  113  YPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAV  171

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHWLHLP AM+ +Q YD  GVWTGSAT LPDG I+M+YTG+T+  VQVQNLAYPA+
Sbjct  172  SRDLIHWLHLPLAMVANQWYDQNGVWTGSATILPDGNIIMLYTGSTNESVQVQNLAYPAD  231

Query  643  LSDPLL  660
             +DPLL
Sbjct  232  ANDPLL  237



>gb|AFS17280.1| acid vacuolar invertase [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=658

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W +  LSWQRT+FHFQP K+WMNDPNGPLY+ GWYH FYQYNP+ AVW  NI WGHAV
Sbjct  122  FDWNDLQLSWQRTSFHFQPQKNWMNDPNGPLYYNGWYHFFYQYNPAGAVW-GNIVWGHAV  180

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+I+W HLP AM+ DQ YD  GVWTGSAT LPDGQIMMVYTG+T+  VQVQNLAYPA+
Sbjct  181  SKDLINWNHLPIAMVADQWYDFNGVWTGSATILPDGQIMMVYTGSTNESVQVQNLAYPAD  240

Query  643  LSDPLL  660
            LSDPLL
Sbjct  241  LSDPLL  246



>ref|XP_009148607.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Brassica 
rapa]
Length=662

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V +SW N MLSWQRT FHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  106  VAFSWNNSMLSWQRTGFHFQPGQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  164

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHW+HLP AM+ DQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP
Sbjct  165  AVSKDLIHWVHLPLAMVADQWYDANGVWTGSATFLEDGSIVMLYTGSTDKSVQVQNLAYP  224

Query  637  ANLSDPLL  660
             +L+DPLL
Sbjct  225  EDLNDPLL  232



>gb|AEY79730.1| vacuolar invertase isoform 2 [Rosa hybrid cultivar]
Length=640

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 139/206 (67%), Gaps = 20/206 (10%)
 Frame = +1

Query  49   YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDETSQQPSPS  228
            YTPL      +G PE  RR LK F     S++ ++  V ++++        +  QQP   
Sbjct  8    YTPLPGDPFLSGPPETPRRPLKGFAVIFASVIFLMSLVALIIH--------QGPQQPP--  57

Query  229  LKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLF  408
                 DV+P  ++      P S TN MLSWQRTAFHFQP K+WMNDPNGP+Y+KGWYH F
Sbjct  58   -----DVMPDKQDEHHH--PQSTTNTMLSWQRTAFHFQPEKNWMNDPNGPMYYKGWYHFF  110

Query  409  YQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMM  588
            YQYNP  AVW  NI WGHAVSRD+IHWLHLP AM+ DQ YD+ GVWTGSAT LP+ QI+M
Sbjct  111  YQYNPRGAVW-GNIVWGHAVSRDLIHWLHLPLAMVADQWYDINGVWTGSATILPNDQIVM  169

Query  589  VYTGNTD--VQVQNLAYPANLSDPLL  660
            +YTG+T+  VQVQ LAYPA+  DPLL
Sbjct  170  LYTGSTNESVQVQCLAYPADHKDPLL  195



>gb|AFV94472.1| soluble acid invertase 9 [Saccharum hybrid cultivar GT28]
Length=698

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  131  RADGGGNAFPWSNAMLQWQRTGFHFQPQKNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  190

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  191  KIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  250

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  251  QCLAVPADDADPLL  264



>gb|AFV94468.1| soluble acid invertase 4 [Saccharum hybrid cultivar GT28]
Length=690

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  123  RADGGGNAFPWSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  182

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  183  KIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  242

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  243  QCLAVPADDADPLL  256



>ref|XP_006300839.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
 gb|EOA33737.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
Length=648

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 119/160 (74%), Gaps = 6/160 (4%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVI-PSVEEAAGDGV--PYSWTNRMLSWQRTAFHFQPPKSWMND  366
            +DET  +    +    +     V   +GDG    + W N MLSWQRTAFHFQP K+WMND
Sbjct  67   RDETETKSRARMAGVSEKTNERVWRLSGDGKTEAFPWNNTMLSWQRTAFHFQPEKNWMND  126

Query  367  PNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVW  546
            PNGPL++KGWYH FYQYNP++AVW  +I WGHAVS+D+IHWL+LP AM+PDQ YD  GVW
Sbjct  127  PNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPLAMVPDQWYDANGVW  185

Query  547  TGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            TGSAT L DG I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  186  TGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPEDPSDPLL  225



>gb|AFV94414.1| soluble acid invertase 3 [Saccharum hybrid cultivar GT28]
Length=696

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            +A G+  P  W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  131  DAGGNAFP--WSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  188

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTG--NTDVQV  618
             I WGHAVSRD+IHW HLP AMLPDQ YD  GVWTGSATTLPDG++ M+YTG  NT VQV
Sbjct  189  KIAWGHAVSRDLIHWRHLPLAMLPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNTSVQV  248

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+  DPLL
Sbjct  249  QCLAVPADDDDPLL  262



>ref|XP_002888009.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64268.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=654

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 119/167 (71%), Gaps = 20/167 (12%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQP  345
            KDETS +    L         V E + D V           + W N MLSWQRTAFHFQP
Sbjct  67   KDETSTESRARLAG-------VSEKSNDRVSRLSDDRKVEAFPWNNTMLSWQRTAFHFQP  119

Query  346  PKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQP  525
             K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAVS+D+IHWL+LP AM+PDQ 
Sbjct  120  EKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPIAMVPDQW  178

Query  526  YDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  179  YDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPDDPSDPLL  225



>ref|XP_010473488.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Camelina 
sativa]
Length=648

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 119/167 (71%), Gaps = 20/167 (12%)
 Frame = +1

Query  196  KDETSQQPSPSLKAAGDVIPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQP  345
            KDET  +    L         V E + DGV           + W N MLSWQRTAFHFQP
Sbjct  67   KDETYTESRARLAG-------VSEKSNDGVWRLSDDGKTEAFPWNNTMLSWQRTAFHFQP  119

Query  346  PKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQP  525
             K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAVS+D+IHWL+LP A++PDQ 
Sbjct  120  EKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPLALVPDQW  178

Query  526  YDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  179  YDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPEDPSDPLL  225



>ref|XP_010676175.1| PREDICTED: acid beta-fructofuranosidase-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W +  L+WQRTAFHFQP K+WMNDPNGPLY+ GWYH FYQYNP+ AVW  NI WGHAV
Sbjct  134  FDWNDLQLAWQRTAFHFQPQKNWMNDPNGPLYYNGWYHFFYQYNPAGAVW-GNIVWGHAV  192

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+I W HLP AM+ D+ YD  GVWTGSAT LPDGQIMM+YTG+T+  VQVQNLAYPAN
Sbjct  193  SKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPDGQIMMLYTGSTNESVQVQNLAYPAN  252

Query  643  LSDPLL  660
            LSDPLL
Sbjct  253  LSDPLL  258



>emb|CAD19321.1| acid vacuolar invertase [Beta vulgaris]
Length=675

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W +  L+WQRTAFHFQP K+WMNDPNGPLY+ GWYH FYQYNP+ AVW  NI WGHAV
Sbjct  132  FDWNDLQLAWQRTAFHFQPQKNWMNDPNGPLYYNGWYHFFYQYNPAGAVW-GNIVWGHAV  190

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+I W HLP AM+ D+ YD  GVWTGSAT LPDGQIMM+YTG+T+  VQVQNLAYPAN
Sbjct  191  SKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPDGQIMMLYTGSTNESVQVQNLAYPAN  250

Query  643  LSDPLL  660
            LSDPLL
Sbjct  251  LSDPLL  256



>ref|XP_008787011.1| PREDICTED: beta-fructofuranosidase 1 [Phoenix dactylifera]
Length=658

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN ML+WQRTAFHFQP K+WMNDPNGP+ +KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  109  YPWTNVMLAWQRTAFHFQPQKNWMNDPNGPMLYKGWYHLFYQYNPESAVW-GNITWGHAV  167

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPAN  642
            SRD++HW +LP AM+PD  YD  GVWTGSAT LPDG+I MVYTG+T   VQVQNLA+PA+
Sbjct  168  SRDLVHWFYLPLAMVPDHWYDAGGVWTGSATLLPDGRIAMVYTGSTADSVQVQNLAFPAD  227

Query  643  LSDPLL  660
              DPLL
Sbjct  228  QDDPLL  233



>ref|NP_001292789.1| invertase2 [Zea mays]
 gb|ACG30542.1| beta-fructofuranosidase 1 precursor [Zea mays]
 gb|ADZ54345.1| invertase [Zea mays]
 gb|AFW69727.1| invertase2 [Zea mays]
Length=673

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = +1

Query  220  SPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            S     A D    +  A G+  P  W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWY
Sbjct  92   SEKTSGASDDGGRLRGAGGNAFP--WSNAMLQWQRTGFHFQPQKNWMNDPNGPVYYKGWY  149

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            HLFYQYNP  A+W   I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG+
Sbjct  150  HLFYQYNPDGAIWGNKIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGR  209

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            + M+YTG+T+  VQVQ LA PA+ +DPLL
Sbjct  210  LAMLYTGSTNASVQVQCLAVPADDADPLL  238



>gb|AFV94471.1| soluble acid invertase 8 [Saccharum hybrid cultivar GT28]
Length=701

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  134  RADGGGNAFPWSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  193

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  194  KIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  253

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  254  QCLAAPADDADPLL  267



>gb|KJB37599.1| hypothetical protein B456_006G212600 [Gossypium raimondii]
Length=438

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
             GD   Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYHLFYQYNP++AVW  +I
Sbjct  100  GGDLPDYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPNAAVW-GHI  158

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQN  624
             WGHAVS+D+IHWLHLP AM  DQ YD  GVWTGSAT L DG+I+M+YTG+T   VQVQN
Sbjct  159  VWGHAVSKDLIHWLHLPLAMAADQWYDKNGVWTGSATILHDGKIVMLYTGSTTEGVQVQN  218

Query  625  LAYPANLSDPLL  660
            LAYPA+  DPLL
Sbjct  219  LAYPADQYDPLL  230



>gb|AGR51646.1| soluble acid invertase, partial [Saccharum hybrid cultivar Pindar]
Length=598

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 108/134 (81%), Gaps = 4/134 (3%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            +A G+  P  W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  33   DAGGNAFP--WSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  90

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  91   KIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  150

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  151  QCLAVPADDADPLL  164



>emb|CDY46906.1| BnaA09g12880D [Brassica napus]
Length=654

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = +1

Query  280  GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWG  459
            G  ++W N +LSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I WG
Sbjct  98   GEAFAWNNTVLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWG  156

Query  460  HAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAY  633
            HAVS+D+IHWL+LP+AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAY
Sbjct  157  HAVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAY  216

Query  634  PANLSDPLL  660
            P +  DPLL
Sbjct  217  PEDPKDPLL  225



>ref|XP_010919478.1| PREDICTED: beta-fructofuranosidase 1 isoform X1 [Elaeis guineensis]
Length=656

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN ML WQRTAFHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP SA+W  NITWGHAV
Sbjct  109  YPWTNVMLVWQRTAFHFQPQENWMNDPNGPMYYKGWYHLFYQYNPDSALW-GNITWGHAV  167

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD++HW +LP AM+PD+ YD  GVWTGSAT LPDG+I MVYTG+T   VQVQNLA+PA+
Sbjct  168  SRDLVHWFYLPLAMVPDRWYDANGVWTGSATLLPDGRIAMVYTGSTTELVQVQNLAFPAD  227

Query  643  LSDPLL  660
             +DPLL
Sbjct  228  PADPLL  233



>ref|XP_010676174.1| PREDICTED: acid beta-fructofuranosidase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 emb|CAC81825.1| beta-fructofuranosidase [Beta vulgaris]
Length=691

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 108/132 (82%), Gaps = 4/132 (3%)
 Frame = +1

Query  274  GDGVPY-SWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
            G  VP+  W +  L+WQRTAFHFQP K+WMNDPNGPLY+ GWYH FYQYNP+ AVW  NI
Sbjct  128  GLKVPFFDWNDLQLAWQRTAFHFQPQKNWMNDPNGPLYYNGWYHFFYQYNPAGAVW-GNI  186

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQN  624
             WGHAVS+D+I W HLP AM+ D+ YD  GVWTGSAT LPDGQIMM+YTG+T+  VQVQN
Sbjct  187  VWGHAVSKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPDGQIMMLYTGSTNESVQVQN  246

Query  625  LAYPANLSDPLL  660
            LAYPANLSDPLL
Sbjct  247  LAYPANLSDPLL  258



>ref|XP_009113064.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Brassica 
rapa]
Length=654

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = +1

Query  280  GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWG  459
            G  ++W N +LSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I WG
Sbjct  98   GEAFAWNNTVLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWG  156

Query  460  HAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAY  633
            HAVS+D+IHWL+LP+AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAY
Sbjct  157  HAVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAY  216

Query  634  PANLSDPLL  660
            P +  DPLL
Sbjct  217  PEDPKDPLL  225



>gb|AFV94470.1| soluble acid invertase 7 [Saccharum hybrid cultivar GT28]
Length=686

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 107/134 (80%), Gaps = 4/134 (3%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            +A G+  P  W+N ML WQRT FHFQP K+WMNDPNGP Y+KGWYHLFYQYNP  A+W  
Sbjct  124  DAGGNAFP--WSNAMLQWQRTGFHFQPQKNWMNDPNGPEYYKGWYHLFYQYNPDGAIWGN  181

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AMLPDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  182  KIAWGHAVSRDLIHWRHLPLAMLPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  241

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  242  QCLAVPADDADPLL  255



>ref|XP_010906620.1| PREDICTED: beta-fructofuranosidase 1-like [Elaeis guineensis]
Length=653

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN ML WQRT FHFQPPK+WMNDPNGP+++KGWYHLFYQYNP SAVW  NI WGHAV
Sbjct  106  YPWTNAMLQWQRTGFHFQPPKNWMNDPNGPMWYKGWYHLFYQYNPDSAVW-GNIAWGHAV  164

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD++HW HLP AM+PD+ YD  GVWTGSAT LP GQI+M+YTG+T+  VQVQNLA PA+
Sbjct  165  SRDLVHWDHLPLAMVPDRWYDHSGVWTGSATILPTGQIIMLYTGSTNESVQVQNLAVPAD  224

Query  643  LSDPLL  660
             +DPLL
Sbjct  225  PADPLL  230



>ref|NP_563901.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
 sp|Q39041.2|INVA4_ARATH RecName: Full=Acid beta-fructofuranosidase 4, vacuolar; Short=At 
beta fruct4; Short=AtBETAFRUCT4; AltName: Full=Acid invertase 
4; Short=AI 4; AltName: Full=Acid sucrose hydrolase 4; 
AltName: Full=Vacuolar invertase 4; Short=Inv-V4; Short=VAC-INV 
4; Short=VI 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12569.1|AC022522_2 beta-fructosidase [Arabidopsis thaliana]
 emb|CAA72321.1| beta-fructosidase [Arabidopsis thaliana]
 gb|AAK76683.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAN13204.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AEE28855.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
Length=664

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N MLSWQRTAFHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAV
Sbjct  110  FEWNNSMLSWQRTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAV  168

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHW+HLP AM+ DQ YD  GVWTGSAT LPDG I+M+YTG+TD  VQVQNLAYP +
Sbjct  169  SRDLIHWVHLPIAMVADQWYDSNGVWTGSATFLPDGSIVMLYTGSTDKAVQVQNLAYPED  228

Query  643  LSDPLL  660
             +DPLL
Sbjct  229  PNDPLL  234



>ref|XP_006653622.1| PREDICTED: beta-fructofuranosidase 1-like [Oryza brachyantha]
Length=622

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 106/129 (82%), Gaps = 3/129 (2%)
 Frame = +1

Query  253  PSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSA  432
            PS+    G    Y WTN MLSWQRTAFHFQPP +WMNDPNGPLY+KGWYHLFYQ+NP SA
Sbjct  101  PSLRLGGGKVRDYDWTNAMLSWQRTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSA  160

Query  433  VWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD-  609
            VW  NITWGHAVSRD+IHWLHLP AM+PD  YD+ GVWTGSAT LPDG+I+M+YTG T+ 
Sbjct  161  VW-GNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEE  219

Query  610  -VQVQNLAY  633
             VQV+N A+
Sbjct  220  SVQVENTAW  228



>emb|CAA66330.1| beta-fructosidase [Arabidopsis thaliana]
Length=660

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N MLSWQRTAFHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAV
Sbjct  106  FEWNNSMLSWQRTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAV  164

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHW+HLP AM+ DQ YD  GVWTGSAT LPDG I+M+YTG+TD  VQVQNLAYP +
Sbjct  165  SRDLIHWVHLPIAMVADQWYDSNGVWTGSATFLPDGSIVMLYTGSTDKAVQVQNLAYPED  224

Query  643  LSDPLL  660
             +DPLL
Sbjct  225  PNDPLL  230



>gb|AAG36942.1|AF274298_1 acid invertase [Brassica oleracea]
Length=663

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V ++W N +LSWQRTAFHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  107  VSFAWNNSVLSWQRTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  165

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHW+HLP AM+ DQ YD  GVWTGSAT L DG ++M+YTG+TD  VQVQNLAYP
Sbjct  166  AVSKDLIHWVHLPIAMVADQWYDANGVWTGSATFLDDGSLVMLYTGSTDKSVQVQNLAYP  225

Query  637  ANLSDPLL  660
             +L+DPLL
Sbjct  226  EDLNDPLL  233



>ref|XP_004511663.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=646

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N MLSWQRTAFHFQP K+WMNDPNGPLY+KGWYH FYQYNP+ AVW  +I WGHAV
Sbjct  104  FPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNGAVW-GDIVWGHAV  162

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD+IHW HLP AM+ D+ YD +GVWTGSAT LP+G+++M+YTG T+  VQVQNLAYP++
Sbjct  163  SRDLIHWFHLPLAMVADKWYDQKGVWTGSATILPNGEVIMLYTGATNELVQVQNLAYPSD  222

Query  643  LSDPLL  660
             SDPLL
Sbjct  223  PSDPLL  228



>gb|AAF87245.1|AF276703_1 vacuolar acid invertase [Oryza sativa]
Length=652

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 6/138 (4%)
 Frame = +1

Query  253  PSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSA  432
            P++    G    Y+WTN MLSWQRTAFHFQPP +WMN   GPLY+KGWYHLFYQ+NP SA
Sbjct  91   PALRLGGGAVRDYAWTNSMLSWQRTAFHFQPPNNWMN---GPLYYKGWYHLFYQWNPDSA  147

Query  433  VWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD-  609
            VW  NITWGHAVSRD+IHWLHLP AM+PD  YD+ GVWTGSAT LPDG+I+M+YTG T+ 
Sbjct  148  VW-GNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEE  206

Query  610  -VQVQNLAYPANLSDPLL  660
             VQVQNLA PA+ +DPLL
Sbjct  207  SVQVQNLAEPADPNDPLL  224



>emb|CDY26548.1| BnaA09g47290D [Brassica napus]
Length=663

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V ++W N +LSWQRTAFHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  107  VSFAWNNSVLSWQRTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  165

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHW+HLP AM+ DQ YD  GVWTGSAT L DG ++M+YTG+TD  VQVQNLAYP
Sbjct  166  AVSKDLIHWVHLPIAMVADQWYDANGVWTGSATFLDDGSLVMLYTGSTDKSVQVQNLAYP  225

Query  637  ANLSDPLL  660
             +L+DPLL
Sbjct  226  EDLNDPLL  233



>ref|XP_009118103.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar [Brassica 
rapa]
Length=663

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  VPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGH  462
            V ++W N +LSWQRTAFHFQP ++WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGH
Sbjct  107  VSFAWNNSVLSWQRTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGH  165

Query  463  AVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYP  636
            AVS+D+IHW+HLP AM+ DQ YD  GVWTGSAT L DG ++M+YTG+TD  VQVQNLAYP
Sbjct  166  AVSKDLIHWVHLPIAMVADQWYDANGVWTGSATFLDDGSLVMLYTGSTDKSVQVQNLAYP  225

Query  637  ANLSDPLL  660
             +L+DPLL
Sbjct  226  EDLNDPLL  233



>gb|AGO03823.1| soluble acid invertase [Sorghum bicolor]
Length=674

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A G+  P  W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  A+W 
Sbjct  108  DGAGGNAFP--WSNAMLQWQRTGFHFQPHKNWMNDPNGPVYYKGWYHLFYQYNPDGAIWG  165

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
              I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQ
Sbjct  166  NKIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQ  225

Query  616  VQNLAYPANLSDPLL  660
            VQ LA PA+ +DPLL
Sbjct  226  VQCLAVPADDADPLL  240



>gb|KJB37601.1| hypothetical protein B456_006G212600 [Gossypium raimondii]
Length=609

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
             GD   Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYHLFYQYNP++AVW  +I
Sbjct  100  GGDLPDYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPNAAVW-GHI  158

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQN  624
             WGHAVS+D+IHWLHLP AM  DQ YD  GVWTGSAT L DG+I+M+YTG+T   VQVQN
Sbjct  159  VWGHAVSKDLIHWLHLPLAMAADQWYDKNGVWTGSATILHDGKIVMLYTGSTTEGVQVQN  218

Query  625  LAYPANLSDPLL  660
            LAYPA+  DPLL
Sbjct  219  LAYPADQYDPLL  230



>gb|AAF87246.1|AF276704_1 vacuolar acid invertase [Oryza sativa]
Length=655

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query  220  SPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            S     A +++  +  AAG G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWY
Sbjct  93   SEKTSGAEEMVRLMGGAAG-GEAFPWSNAMLQWQRTGFHFQPERNWMNDPNGPVYYKGWY  151

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            HLFYQYNP  AVW   I WGHAVSRD++HW HLP AM+PDQ YD+ GVWTGSATTLPDG+
Sbjct  152  HLFYQYNPDGAVWGNKIAWGHAVSRDLVHWRHLPLAMVPDQWYDVNGVWTGSATTLPDGR  211

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            + M+YTG+T+  VQVQ LA P++  DPLL
Sbjct  212  LAMLYTGSTNASVQVQCLAVPSDPDDPLL  240



>ref|NP_001045626.1| Os02g0106100 [Oryza sativa Japonica Group]
 dbj|BAD28087.1| vacuolar acid invertase [Oryza sativa Japonica Group]
 dbj|BAF07540.1| Os02g0106100 [Oryza sativa Japonica Group]
 gb|EAY84112.1| hypothetical protein OsI_05495 [Oryza sativa Indica Group]
Length=662

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query  220  SPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            S     A +++  +  AAG G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWY
Sbjct  93   SEKTSGAEEMVRLMGGAAG-GEAFPWSNAMLQWQRTGFHFQPERNWMNDPNGPVYYKGWY  151

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            HLFYQYNP  AVW   I WGHAVSRD++HW HLP AM+PDQ YD+ GVWTGSATTLPDG+
Sbjct  152  HLFYQYNPDGAVWGNKIAWGHAVSRDLVHWRHLPLAMVPDQWYDVNGVWTGSATTLPDGR  211

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            + M+YTG+T+  VQVQ LA P++  DPLL
Sbjct  212  LAMLYTGSTNASVQVQCLAVPSDPDDPLL  240



>gb|AFV94475.1| soluble acid invertase 12 [Saccharum hybrid cultivar GT28]
Length=686

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 108/134 (81%), Gaps = 4/134 (3%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            +A G+  P  W+N ML WQRT FHFQP K+WM+DPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  124  DAGGNAFP--WSNAMLQWQRTGFHFQPQKNWMSDPNGPVYYKGWYHLFYQYNPDGAIWGN  181

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AMLPDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  182  KIAWGHAVSRDLIHWRHLPLAMLPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  241

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  242  QCLAVPADDADPLL  255



>gb|AAK62665.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
 gb|AAN18078.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
Length=648

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 114/149 (77%), Gaps = 13/149 (9%)
 Frame = +1

Query  250  IPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            +  V E + DGV           + W N +LSWQRTAFHFQP K+WMNDPNGPL++KGWY
Sbjct  72   MAGVSEKSNDGVWISSDDGKVEAFPWNNTILSWQRTAFHFQPEKNWMNDPNGPLFYKGWY  131

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            H FYQYNP++AVW  +I WGHAVS+D+IHWL+LP AM+PDQ YD  GVWTGSAT L DG 
Sbjct  132  HFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDDGS  190

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  191  IVMLYTGSTDEFVQVQNLAYPEDPSDPLL  219



>gb|EAZ21424.1| hypothetical protein OsJ_05029 [Oryza sativa Japonica Group]
Length=561

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +1

Query  268  AAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVEN  447
             A  G  + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  AVW   
Sbjct  7    GAAGGEAFPWSNAMLQWQRTGFHFQPERNWMNDPNGPVYYKGWYHLFYQYNPDGAVWGNK  66

Query  448  ITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQ  621
            I WGHAVSRD++HW HLP AM+PDQ YD+ GVWTGSATTLPDG++ M+YTG+T+  VQVQ
Sbjct  67   IAWGHAVSRDLVHWRHLPLAMVPDQWYDVNGVWTGSATTLPDGRLAMLYTGSTNASVQVQ  126

Query  622  NLAYPANLSDPLL  660
             LA P++  DPLL
Sbjct  127  CLAVPSDPDDPLL  139



>emb|CAA64781.1| beta-fructosidase [Arabidopsis thaliana]
Length=639

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 114/149 (77%), Gaps = 13/149 (9%)
 Frame = +1

Query  250  IPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            +  V E + DGV           + W N +LSWQRTAFHFQP K+WMNDPNGPL++KGWY
Sbjct  63   MAGVSEKSNDGVWISSDDGKVEAFPWNNTILSWQRTAFHFQPEKNWMNDPNGPLFYKGWY  122

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            H FYQYNP++AVW  +I WGHAVS+D+IHWL+LP AM+PDQ YD  GVWTGSAT L DG 
Sbjct  123  HFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDDGS  181

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  182  IVMLYTGSTDEFVQVQNLAYPEDPSDPLL  210



>gb|ACY78467.1| soluble acid invertase, partial [Sorghum bicolor]
Length=558

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +1

Query  295  WTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSR  474
            W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  A+W   I WGHAVSR
Sbjct  1    WSNAMLQWQRTGFHFQPHKNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGNKIAWGHAVSR  60

Query  475  DMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLS  648
            D+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQVQ LA PA+ +
Sbjct  61   DLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQVQCLAVPADDA  120

Query  649  DPLL  660
            DPLL
Sbjct  121  DPLL  124



>gb|AAB47172.1| vacuolar invertase 2, GIN2 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 664 aa]
Length=664

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 139/224 (62%), Gaps = 23/224 (10%)
 Frame = +1

Query  49   YTPLSDRTESAGAPENLRRSLKFFTCTlisllcvvlsvlvvlnhsselvKDE-----TSQ  213
            YTPL D    AG  EN RR LK F   L  L+ V L + ++  +   + +D      T  
Sbjct  26   YTPLLDVDPPAG--ENSRRPLKGFLVILSGLVLVGLLMALISENGPSVSQDSQQNDLTLN  83

Query  214  QPSPSLKAAGDVIPSVEEAAGDGV-------------PYSWTNRMLSWQRTAFHFQPPKS  354
             P+ S   +   +         GV             P+ W+N ML+WQRT +HFQP K+
Sbjct  84   APAESTNISAQFLEPASRGPSTGVSEKSFRLHSGVRAPFPWSNTMLTWQRTGYHFQPEKN  143

Query  355  WMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDL  534
            WMNDPNGP+++ GWYH FYQYNP +AVW  NI WGHAVS+D+I WLHLP AM+ DQ YD 
Sbjct  144  WMNDPNGPMFYGGWYHFFYQYNPDAAVW-GNIVWGHAVSKDLIEWLHLPLAMVADQWYDT  202

Query  535  RGVWTGSATTLPDGQIMMVYTG--NTDVQVQNLAYPANLSDPLL  660
             GVWTGSAT L DGQ++M+YTG  N  VQVQNLAYPA+LSDPLL
Sbjct  203  NGVWTGSATLLSDGQVIMLYTGATNESVQVQNLAYPADLSDPLL  246



>ref|NP_564798.1| acid beta-fructofuranosidase 3 [Arabidopsis thaliana]
 sp|Q43348.1|INVA3_ARATH RecName: Full=Acid beta-fructofuranosidase 3, vacuolar; Short=At 
beta fruct3; Short=AtBETAFRUCT3; AltName: Full=Acid invertase 
3; Short=AI 3; AltName: Full=Acid sucrose hydrolase 3; 
AltName: Full=Vacuolar invertase 3; Short=Inv-V3; Short=VAC-INV 
3; Short=VI 3; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67560.1| beta-fructosidase [Arabidopsis thaliana]
 gb|AAK82531.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
 gb|AAL32559.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAL36260.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAM45114.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AEE33991.1| beta-fructofuranosidase [Arabidopsis thaliana]
Length=648

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 114/149 (77%), Gaps = 13/149 (9%)
 Frame = +1

Query  250  IPSVEEAAGDGV----------PYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            +  V E + DGV           + W N +LSWQRTAFHFQP K+WMNDPNGPL++KGWY
Sbjct  72   MAGVSEKSNDGVWISSDDGKVEAFPWNNTILSWQRTAFHFQPEKNWMNDPNGPLFYKGWY  131

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            H FYQYNP++AVW  +I WGHAVS+D+IHWL+LP AM+PDQ YD  GVWTGSAT L DG 
Sbjct  132  HFFYQYNPNAAVW-GDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDDGS  190

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            I+M+YTG+TD  VQVQNLAYP + SDPLL
Sbjct  191  IVMLYTGSTDEFVQVQNLAYPEDPSDPLL  219



>ref|XP_010933713.1| PREDICTED: beta-fructofuranosidase 1 [Elaeis guineensis]
Length=644

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN ML WQRTA+HFQP K+WMNDP+GP+Y+KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  102  YPWTNAMLVWQRTAYHFQPQKNWMNDPDGPMYYKGWYHLFYQYNPDSAVW-GNITWGHAV  160

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPAN  642
            SRD+IHWL+LP AM+P   YD  GVWTGSAT LPDG+I MVYTG+T   VQVQNLA+PA+
Sbjct  161  SRDLIHWLYLPLAMVPSHWYDANGVWTGSATLLPDGRIAMVYTGSTTESVQVQNLAFPAD  220

Query  643  LSDPLL  660
              DPLL
Sbjct  221  PDDPLL  226



>gb|KJB37598.1| hypothetical protein B456_006G212600 [Gossypium raimondii]
Length=646

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +1

Query  271  AGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENI  450
             GD   Y W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYHLFYQYNP++AVW  +I
Sbjct  100  GGDLPDYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPNAAVW-GHI  158

Query  451  TWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQN  624
             WGHAVS+D+IHWLHLP AM  DQ YD  GVWTGSAT L DG+I+M+YTG+T   VQVQN
Sbjct  159  VWGHAVSKDLIHWLHLPLAMAADQWYDKNGVWTGSATILHDGKIVMLYTGSTTEGVQVQN  218

Query  625  LAYPANLSDPLL  660
            LAYPA+  DPLL
Sbjct  219  LAYPADQYDPLL  230



>ref|XP_008796841.1| PREDICTED: LOW QUALITY PROTEIN: beta-fructofuranosidase 1 [Phoenix 
dactylifera]
Length=648

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            Y WTN ML WQRTA+HFQP K+WMNDP+GP+Y+KGWYHLFYQYNP SAVW  NITWGHAV
Sbjct  106  YPWTNAMLVWQRTAYHFQPQKNWMNDPDGPMYYKGWYHLFYQYNPDSAVW-GNITWGHAV  164

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT--DVQVQNLAYPAN  642
            SRD+IHWL+LP A++PD  YD  GVWTGSAT LPDG+I +VYTG+T   VQVQNLA+PA+
Sbjct  165  SRDLIHWLYLPLALVPDHWYDANGVWTGSATLLPDGRIAVVYTGSTTESVQVQNLAFPAD  224

Query  643  LSDPLL  660
             +DPLL
Sbjct  225  PADPLL  230



>emb|CDY31826.1| BnaC09g13230D [Brassica napus]
Length=654

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 3/129 (2%)
 Frame = +1

Query  280  GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWG  459
            G  ++W N +LSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP+ AVW  +I WG
Sbjct  98   GEAFAWNNTVLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNGAVW-GDIFWG  156

Query  460  HAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAY  633
            HAVS+D+IHWL+LP+AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAY
Sbjct  157  HAVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAY  216

Query  634  PANLSDPLL  660
            P +  DPLL
Sbjct  217  PEDPKDPLL  225



>gb|AFV94467.1| soluble acid invertase 5 [Saccharum hybrid cultivar GT28]
Length=692

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 108/134 (81%), Gaps = 4/134 (3%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            +A G+  P  W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W  
Sbjct  127  DAGGNAFP--WSNAMLQWQRTGFHFQPQRNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGN  184

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  185  KIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  244

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  245  QCLAVPADDADPLL  258



>gb|AFV94473.1| soluble acid invertase 10 [Saccharum hybrid cultivar GT28]
Length=702

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +1

Query  265  EAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
             A G G  + W+N ML WQRT FHFQP ++WMNDPN P+Y+KGWYHLFYQYNP  A+W  
Sbjct  134  RADGGGNAFPWSNAMLQWQRTGFHFQPQRNWMNDPNAPVYYKGWYHLFYQYNPDGAIWGN  193

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQV  618
             I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQV
Sbjct  194  KIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQV  253

Query  619  QNLAYPANLSDPLL  660
            Q LA PA+ +DPLL
Sbjct  254  QCLAVPADDADPLL  267



>ref|XP_006646767.1| PREDICTED: sucrose:sucrose 1-fructosyltransferase-like [Oryza 
brachyantha]
Length=661

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W+N ML WQRT FHFQP ++WMNDPNGP+Y+KGWYHLFYQYNP  A+W   I WGHAV
Sbjct  116  FPWSNAMLQWQRTGFHFQPERNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGNKIAWGHAV  175

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD++HW HLP AM+PDQ YD+ GVWTGSATTLPDG+I M+YTG+T+  VQVQ LA P++
Sbjct  176  SRDLVHWRHLPLAMVPDQWYDVNGVWTGSATTLPDGRIAMLYTGSTNASVQVQCLAVPSD  235

Query  643  LSDPLL  660
             SDPLL
Sbjct  236  PSDPLL  241



>ref|XP_004951208.1| PREDICTED: LOW QUALITY PROTEIN: sucrose:sucrose 1-fructosyltransferase-like 
[Setaria italica]
Length=668

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  A+W   I WGHAV
Sbjct  114  FPWSNAMLQWQRTGFHFQPQKNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGNKIAWGHAV  173

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            SRD++HW HLP AM+PDQ YD+ GVWTGSATTLPDG++ M+YTG+T+  VQVQ LA P++
Sbjct  174  SRDLVHWRHLPLAMVPDQWYDINGVWTGSATTLPDGRLAMLYTGSTNESVQVQCLAVPSD  233

Query  643  LSDPLL  660
             SDPLL
Sbjct  234  PSDPLL  239



>ref|XP_010093687.1| Acid beta-fructofuranosidase [Morus notabilis]
 gb|EXB54467.1| Acid beta-fructofuranosidase [Morus notabilis]
Length=662

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N MLSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP+ AVW  NI WGHAV
Sbjct  116  FPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNGAVW-GNIVWGHAV  174

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+IHWLHLP AM+ DQ YD  GVW+GSAT LPD +++M+YTG+T+  VQVQNLAYP +
Sbjct  175  SKDLIHWLHLPLAMVADQWYDQNGVWSGSATILPDNRVVMLYTGSTNESVQVQNLAYPVD  234

Query  643  LSDPLL  660
             SDPLL
Sbjct  235  PSDPLL  240



>emb|CAA61624.1| beta-fructofuranosidase [Arabidopsis thaliana]
Length=562

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N +LSWQRTAFHFQP K+WMNDPNGPL++KGWYH FYQYNP++AVW  +I WGHAV
Sbjct  9    FPWNNTILSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNAAVW-GDIVWGHAV  67

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+IHWL+LP AM+PDQ YD  GVWTGSAT L DG I+M+YTG+TD  VQVQNLAYP +
Sbjct  68   SKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDDGSIVMLYTGSTDGFVQVQNLAYPED  127

Query  643  LSDPLL  660
             SDPLL
Sbjct  128  PSDPLL  133



>ref|XP_006417255.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
 gb|ESQ35608.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
Length=660

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            ++W N MLSWQRTAFHFQP ++WMNDPNGPL++KG+YH FYQYNP++AVW  +I WGHAV
Sbjct  106  FAWNNSMLSWQRTAFHFQPEQNWMNDPNGPLFYKGYYHFFYQYNPNAAVW-GDIVWGHAV  164

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S+D+IHW+HLP AM+ DQ YD  GVWTGSAT LPDG I+M+YTG+TD  VQVQNLAYP +
Sbjct  165  SKDLIHWVHLPLAMVADQWYDSNGVWTGSATILPDGSIVMLYTGSTDKSVQVQNLAYPED  224

Query  643  LSDPLL  660
             +DPLL
Sbjct  225  PNDPLL  230



>ref|XP_003608758.1| Acid beta-fructofuranosidase [Medicago truncatula]
Length=640

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 116/153 (76%), Gaps = 10/153 (7%)
 Frame = +1

Query  220  SPSLKAA----GDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYH  387
            SPS+ A      +V  S     G+   + W N MLSWQRT+FHFQP K+WMN   GP+Y+
Sbjct  74   SPSVSAGVSEKSNVFLSGPNKVGETESFPWNNTMLSWQRTSFHFQPEKNWMN---GPMYY  130

Query  388  KGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTL  567
            KGWYH FYQYNP+ AVW  +I WGHAVSRDMIHWLHLP AM+ DQ YD  GVWTGSAT L
Sbjct  131  KGWYHFFYQYNPNGAVW-GDIVWGHAVSRDMIHWLHLPLAMVADQWYDSNGVWTGSATIL  189

Query  568  PDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            PDGQ++M+YTG+T+  VQVQNLAYPA+L+DPLL
Sbjct  190  PDGQVIMLYTGSTNETVQVQNLAYPADLNDPLL  222



>gb|AAC16654.1| soluble acid invertase [Saccharum robustum]
Length=567

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G G  + W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  A+W   I 
Sbjct  3    GGGNAFPWSNAMLQWQRTGFHFQPQKNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGNKIA  62

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVSRD+IH  HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQVQ L
Sbjct  63   WGHAVSRDLIHRRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQVQCL  122

Query  628  AYPANLSDPLL  660
            A PA+ +DPLL
Sbjct  123  AVPADDADPLL  133



>gb|AAS88729.1| vacuolar invertase1 [Triticum monococcum]
Length=657

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  220  SPSLKAAGDVIPSVEEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWY  399
            S     A D +  +  A GD   + W+N ML WQRT FHFQP K+WMNDPNGP+Y++GWY
Sbjct  94   SEKTSGAADEMVGLLGAGGDADGFPWSNAMLQWQRTGFHFQPEKNWMNDPNGPVYYRGWY  153

Query  400  HLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQ  579
            HLFYQYNP  AVW  NI WGHAV RD+IHW HLP AM+PDQ YD+ GVWTGSAT LPDG 
Sbjct  154  HLFYQYNPEGAVW-GNIAWGHAVFRDLIHWRHLPLAMVPDQWYDINGVWTGSATVLPDGS  212

Query  580  IMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            ++M+YTG+T+  VQVQ LA PA+ +D LL
Sbjct  213  LVMLYTGSTNASVQVQCLAVPADPNDSLL  241



>gb|AAC16655.1| soluble acid invertase [Saccharum officinarum]
Length=567

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +1

Query  274  GDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENIT  453
            G G  + W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  A+W   I 
Sbjct  3    GGGNAFPWSNAMLQWQRTGFHFQPQKNWMNDPNGPVYYKGWYHLFYQYNPDGAIWGNKIA  62

Query  454  WGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNL  627
            WGHAVSRD+IH  HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQVQ L
Sbjct  63   WGHAVSRDLIHRRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQVQCL  122

Query  628  AYPANLSDPLL  660
            A PA+ +DPLL
Sbjct  123  AVPADDADPLL  133



>gb|ACJ04701.1| invertase 1 [Cucumis melo]
Length=665

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 115/159 (72%), Gaps = 11/159 (7%)
 Frame = +1

Query  208  SQQPSPSLKAAGDVIPSVEEAA-----GDGVPYS-WTNRMLSWQRTAFHFQPPKSWMNDP  369
            SQ P      +  V   V E A     G  V Y  W N MLSWQRTAFHFQP ++WMNDP
Sbjct  70   SQSPEILRPGSRGVPAGVSEKANRHFIGQNVAYFPWNNSMLSWQRTAFHFQPEENWMNDP  129

Query  370  NGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWT  549
            NGPLY+ GWYH FY  +P +AVW  NI WGHAVS D+IHW HLP A++PDQ YD+ GVWT
Sbjct  130  NGPLYYNGWYHFFY--DPRAAVW-GNIVWGHAVSTDLIHWFHLPLALVPDQWYDINGVWT  186

Query  550  GSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            GSAT LPDGQIMM+YTG+T   VQVQNLAYPANLSDPLL
Sbjct  187  GSATILPDGQIMMLYTGSTKEHVQVQNLAYPANLSDPLL  225



>ref|XP_010546426.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Tarenaya 
hassleriana]
Length=682

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = +1

Query  289  YSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAV  468
            + W N ML+WQRTAFHFQP K+WMNDPNGPL++KGWYHLFYQYNP  A W + I WGHAV
Sbjct  112  FPWDNSMLTWQRTAFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPKGAAWGDIIVWGHAV  171

Query  469  SRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPAN  642
            S D+IHWLHLP AM+PDQ YD  GVWTGSATTL DG ++M+YTG+T    QVQNLAYP +
Sbjct  172  SEDLIHWLHLPLAMVPDQWYDANGVWTGSATTLDDGSVVMLYTGSTHEFAQVQNLAYPKD  231

Query  643  LSDPLL  660
             +DPLL
Sbjct  232  PNDPLL  237



>ref|XP_011623822.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I [Amborella 
trichopoda]
Length=642

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 125/169 (74%), Gaps = 20/169 (12%)
 Frame = +1

Query  196  KDETSQQ--------PSPSLKAAGDVIPSVEEAA---GDGV-PYSWTNRMLSWQRTAFHF  339
            + ETS+Q        P    K+AG     V E A   G GV PY WTN ML+WQ T++HF
Sbjct  67   RQETSRQVGSPEVVRPISRGKSAG-----VSEKAVILGYGVSPYPWTNAMLAWQVTSYHF  121

Query  340  QPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVSRDMIHWLHLPYAMLPD  519
            QP ++WMNDPNGPLY+KGWYHLFYQYNP SAVW  NITWGH VS+D+IHWL+L  AM+ D
Sbjct  122  QPERNWMNDPNGPLYYKGWYHLFYQYNPDSAVW-GNITWGHTVSKDLIHWLYLDLAMVRD  180

Query  520  QPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANLSDPLL  660
            Q YD+ GVWTGSAT LP G+I+M+YTG+T+  VQVQNLA PA+ SDPLL
Sbjct  181  QWYDINGVWTGSATLLPTGEIIMLYTGSTNESVQVQNLAIPADPSDPLL  229



>gb|AAK72493.2| soluble acid invertase bfruct3 [Oryza sativa Japonica Group]
Length=688

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 108/130 (83%), Gaps = 3/130 (2%)
 Frame = +1

Query  280  GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVENITWG  459
            G  ++WTN ML+WQRT +HFQP ++WMNDPNGPLY+KGWYHLFYQ+NP +AVW   I+WG
Sbjct  122  GNDFAWTNIMLTWQRTTYHFQPAQNWMNDPNGPLYYKGWYHLFYQWNPDTAVWGNKISWG  181

Query  460  HAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNT---DVQVQNLA  630
            HAVS+D++HW HLP AM+PD  YDL GVW+GSAT LPDG++MM+YTG+T    VQ QNLA
Sbjct  182  HAVSKDLLHWHHLPIAMVPDNWYDLNGVWSGSATDLPDGKLMMLYTGSTVDQSVQDQNLA  241

Query  631  YPANLSDPLL  660
             P N++DPLL
Sbjct  242  DPVNITDPLL  251



>gb|ABB77251.1| vacuolar invertase BObetaFRUCT3 [Bambusa oldhamii]
Length=658

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +1

Query  268  AAGD-GVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWVE  444
            + GD G  + W+N ML WQRT FHFQP K+WMNDPNGP+Y+KGWYHLFYQYNP  AVW  
Sbjct  102  SGGDAGNAFPWSNAMLQWQRTGFHFQPQKNWMNDPNGPVYYKGWYHLFYQYNPEGAVWGN  161

Query  445  NITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTG--NTDVQV  618
             I WGHA SRD++HW HLP AMLPD+ YD+ GVWTGSATTLPDG++ ++YTG  NT VQV
Sbjct  162  KIAWGHAASRDLLHWRHLPIAMLPDRWYDINGVWTGSATTLPDGRLAVLYTGSTNTSVQV  221

Query  619  QNLAYPANLSDPLL  660
            Q LA P N  DPLL
Sbjct  222  QCLALPTNPEDPLL  235



>gb|AGO03820.1| soluble acid invertase [Sorghum bicolor]
Length=674

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A G+  P  W+N ML WQRT FHFQP  +WMNDPNGP+Y+KGWYHLFYQYNP  A+W 
Sbjct  108  DGAGGNAFP--WSNAMLQWQRTGFHFQPHMNWMNDPNGPVYYKGWYHLFYQYNPDGAIWG  165

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
              I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQ
Sbjct  166  NKIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQ  225

Query  616  VQNLAYPANLSDPLL  660
            VQ LA PA+ +DPLL
Sbjct  226  VQCLAVPADDADPLL  240



>gb|AFH57543.1| soluble acid invertase [Sorghum bicolor]
 gb|AGO03821.1| soluble acid invertase [Sorghum bicolor]
 gb|AGO03822.1| soluble acid invertase [Sorghum bicolor]
 gb|AIU48037.1| soluble acid invertase [Sorghum bicolor]
Length=674

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +1

Query  262  EEAAGDGVPYSWTNRMLSWQRTAFHFQPPKSWMNDPNGPLYHKGWYHLFYQYNPSSAVWV  441
            + A G+  P  W+N ML WQRT FHFQP  +WMNDPNGP+Y+KGWYHLFYQYNP  A+W 
Sbjct  108  DGAGGNAFP--WSNAMLQWQRTGFHFQPHMNWMNDPNGPVYYKGWYHLFYQYNPDGAIWG  165

Query  442  ENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQ  615
              I WGHAVSRD+IHW HLP AM+PDQ YD  GVWTGSATTLPDG++ M+YTG+T+  VQ
Sbjct  166  NKIAWGHAVSRDLIHWRHLPLAMVPDQWYDTNGVWTGSATTLPDGRLAMLYTGSTNASVQ  225

Query  616  VQNLAYPANLSDPLL  660
            VQ LA PA+ +DPLL
Sbjct  226  VQCLAVPADDADPLL  240



>emb|CBI24585.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 8/125 (6%)
 Frame = +1

Query  307  MLSWQRTAFHFQPPKSWMND-----PNGPLYHKGWYHLFYQYNPSSAVWVENITWGHAVS  471
            M +WQRTAFHFQP K+WMN      P+GPL+H GWYHLFYQYNP SAVW  NITWGHAVS
Sbjct  1    MFAWQRTAFHFQPEKNWMNGRNALYPDGPLFHMGWYHLFYQYNPDSAVW-GNITWGHAVS  59

Query  472  RDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLPDGQIMMVYTGNTD--VQVQNLAYPANL  645
            RDMIHWL+LP AM+PD+ +DL GVWTGSAT LP+GQI+M+YTG+T+  VQVQNLAYPANL
Sbjct  60   RDMIHWLYLPLAMVPDRWFDLNGVWTGSATILPNGQIIMLYTGDTNDSVQVQNLAYPANL  119

Query  646  SDPLL  660
            SDPLL
Sbjct  120  SDPLL  124



Lambda      K        H        a         alpha
   0.317    0.132    0.435    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1063448340092