BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1550

Length=810
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                484   5e-169   Erythranthe guttata [common monkey flower]
gb|AFU34347.1|  70-kDa heat shock protein                               494   7e-169   Ipomoea batatas [batate]
ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          482   1e-166   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    488   2e-166   Tarenaya hassleriana [spider flower]
gb|KJB46580.1|  hypothetical protein B456_007G375600                    488   2e-166   Gossypium raimondii
ref|XP_002532297.1|  heat shock protein, putative                       488   3e-166   Ricinus communis
ref|XP_004142076.1|  PREDICTED: heat shock cognate 70 kDa protein 2     487   4e-166   
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    487   4e-166   Solanum tuberosum [potatoes]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    487   5e-166   Solanum lycopersicum
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     487   5e-166   Cucumis melo [Oriental melon]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    487   6e-166   Tarenaya hassleriana [spider flower]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     487   7e-166   Sesamum indicum [beniseed]
gb|AAR17080.1|  heat shock protein 70-3                                 486   1e-165   Nicotiana tabacum [American tobacco]
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     486   1e-165   
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    486   1e-165   Nicotiana tomentosiformis
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     486   1e-165   
ref|XP_002527736.1|  heat shock protein, putative                       486   1e-165   Ricinus communis
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     485   1e-165   Eucalyptus grandis [rose gum]
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         484   2e-165   Jatropha curcas
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    484   2e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    486   2e-165   Nicotiana sylvestris
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         486   2e-165   Jatropha curcas
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     485   2e-165   Eucalyptus grandis [rose gum]
ref|XP_012089411.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    486   2e-165   
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    485   2e-165   Eucalyptus grandis [rose gum]
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    485   3e-165   Solanum tuberosum [potatoes]
ref|XP_012074911.1|  PREDICTED: probable mediator of RNA polymera...    485   3e-165   Jatropha curcas
ref|NP_001068540.1|  Os11g0703900                                       485   3e-165   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    485   3e-165   Solanum tuberosum [potatoes]
gb|ADD71975.1|  heat shock protein 70                                   485   3e-165   Rhododendron calophytum
gb|ABP35942.1|  heat shock protein 70                                   485   3e-165   Cyclamen persicum
gb|KJB16980.1|  hypothetical protein B456_002G258500                    484   4e-165   Gossypium raimondii
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    485   4e-165   Sesamum indicum [beniseed]
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     485   4e-165   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312089.1|  heat shock protein 70 cognate                      484   5e-165   
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     484   6e-165   Nelumbo nucifera [Indian lotus]
gb|ACJ11740.1|  heat shock protein 70                                   484   7e-165   Gossypium hirsutum [American cotton]
gb|AGR45355.1|  HSP70                                                   484   7e-165   Dendrobium officinale
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    484   9e-165   Oryza brachyantha
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    484   9e-165   Solanum tuberosum [potatoes]
gb|AIZ68155.1|  heat shock protein 70                                   484   1e-164   Ornithogalum longebracteatum [sea-onion]
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    484   1e-164   Petunia x hybrida [garden petunia]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    483   1e-164   Solanum lycopersicum
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        483   1e-164   Morus notabilis
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    483   2e-164   Oryza brachyantha
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     483   2e-164   Nicotiana tomentosiformis
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     483   2e-164   Nicotiana sylvestris
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    483   2e-164   Nicotiana sylvestris
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     483   2e-164   Prunus mume [ume]
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    483   3e-164   Nicotiana tomentosiformis
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    483   3e-164   Glycine max [soybeans]
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       483   3e-164   Cucurbita maxima [Boston marrow]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     483   3e-164   Vitis vinifera
gb|KJB36734.1|  hypothetical protein B456_006G174000                    483   3e-164   Gossypium raimondii
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    483   3e-164   Tarenaya hassleriana [spider flower]
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    483   3e-164   Sesamum indicum [beniseed]
gb|EPS60056.1|  heat shock protein 70                                   483   3e-164   Genlisea aurea
gb|KJB16979.1|  hypothetical protein B456_002G258500                    482   4e-164   Gossypium raimondii
gb|ACJ11742.1|  heat shock protein 70                                   482   4e-164   Gossypium hirsutum [American cotton]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    482   4e-164   Nelumbo nucifera [Indian lotus]
gb|ACJ11741.1|  heat shock protein 70                                   482   4e-164   Gossypium hirsutum [American cotton]
gb|AGL07711.1|  heat shock protein 70                                   482   4e-164   Ziziphus jujuba [Chinese jujube]
emb|CCA29121.1|  heat shock protein 70 isoform 2                        482   5e-164   Solanum lycopersicum
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             482   5e-164   Prunus persica
emb|CCA29120.1|  heat shock protein 70 isoform 1                        482   5e-164   Solanum lycopersicum
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             482   6e-164   Citrus clementina [clementine]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    482   6e-164   
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    482   7e-164   Solanum lycopersicum
emb|CDP09040.1|  unnamed protein product                                481   7e-164   Coffea canephora [robusta coffee]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     481   7e-164   
gb|ACJ11745.1|  heat shock protein 70                                   481   8e-164   Gossypium hirsutum [American cotton]
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    481   8e-164   Populus euphratica
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     481   9e-164   Eucalyptus grandis [rose gum]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    481   9e-164   Zea mays [maize]
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    481   1e-163   Populus euphratica
ref|XP_002311161.1|  heat shock protein 70                              481   1e-163   Populus trichocarpa [western balsam poplar]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    483   1e-163   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             481   1e-163   Phaseolus vulgaris [French bean]
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                481   1e-163   
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     481   1e-163   Populus euphratica
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     481   1e-163   Vitis vinifera
gb|KJB55903.1|  hypothetical protein B456_009G100400                    481   1e-163   Gossypium raimondii
ref|XP_006833219.1|  PREDICTED: heat shock cognate 70 kDa protein 2     481   1e-163   Amborella trichopoda
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           481   1e-163   Cucurbita maxima [Boston marrow]
gb|AFA51946.1|  heat shock protein 70                                   481   2e-163   Paeonia suffruticosa [moutan peony]
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein       481   2e-163   Cucumis sativus [cucumbers]
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    481   2e-163   Nicotiana tomentosiformis
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             481   2e-163   Populus trichocarpa [western balsam poplar]
dbj|BAJ34054.1|  unnamed protein product                                480   2e-163   Eutrema halophilum
emb|CAB72130.1|  heat shock protein 70                                  480   3e-163   Cucumis sativus [cucumbers]
gb|AEK70336.1|  heat shock protein 70                                   480   3e-163   Paeonia lactiflora [common garden peony]
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     480   3e-163   Glycine soja [wild soybean]
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             480   3e-163   Eutrema salsugineum [saltwater cress]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    480   3e-163   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        480   3e-163   Morus notabilis
ref|NP_001051724.1|  Os03g0821100                                       480   3e-163   
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     480   4e-163   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     480   4e-163   Phoenix dactylifera
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     483   4e-163   Eucalyptus grandis [rose gum]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     483   4e-163   Eucalyptus grandis [rose gum]
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          479   5e-163   
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    479   6e-163   Cicer arietinum [garbanzo]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     479   6e-163   Elaeis guineensis
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    479   6e-163   Glycine max [soybeans]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             479   7e-163   Phaseolus vulgaris [French bean]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     479   7e-163   Glycine soja [wild soybean]
gb|AAP04522.1|  heat shock protein 70                                   479   7e-163   Nicotiana tabacum [American tobacco]
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       479   8e-163   Nicotiana tomentosiformis
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    479   8e-163   Setaria italica
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    474   8e-163   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    479   8e-163   Setaria italica
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                479   9e-163   Erythranthe guttata [common monkey flower]
ref|XP_007009369.1|  Heat shock protein 70                              479   9e-163   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    479   9e-163   Brassica rapa
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          479   1e-162   Sorghum bicolor [broomcorn]
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             479   1e-162   Eutrema salsugineum [saltwater cress]
emb|CAA47948.2|  heat shock protein 70                                  478   1e-162   Oryza sativa Indica Group [Indian rice]
gb|AAS09825.1|  heat shock cognate protein 70                           478   1e-162   Eutrema halophilum
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    478   2e-162   Arabis alpina [alpine rockcress]
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       478   2e-162   Nicotiana sylvestris
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   464   2e-162   Citrus sinensis [apfelsine]
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    478   2e-162   
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    478   2e-162   Tarenaya hassleriana [spider flower]
ref|XP_001759874.1|  predicted protein                                  478   2e-162   
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     478   2e-162   Vigna radiata [mung bean]
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       478   2e-162   Glycine soja [wild soybean]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    478   2e-162   Arabis alpina [alpine rockcress]
gb|EPS68565.1|  hypothetical protein M569_06198                         478   3e-162   Genlisea aurea
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    478   3e-162   Populus euphratica
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    478   3e-162   Brassica rapa
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       477   3e-162   Cucumis melo [Oriental melon]
ref|XP_002316294.1|  heat shock protein 70                              477   3e-162   Populus trichocarpa [western balsam poplar]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             477   4e-162   Phaseolus vulgaris [French bean]
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       477   4e-162   Cucurbita maxima [Boston marrow]
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       477   4e-162   Solanum lycopersicum
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    477   5e-162   Phoenix dactylifera
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    472   5e-162   Brassica rapa
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    477   5e-162   Fragaria vesca subsp. vesca
gb|AAB97316.1|  cytosolic heat shock 70 protein                         477   6e-162   Spinacia oleracea
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    477   6e-162   Elaeis guineensis
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    476   7e-162   
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     476   8e-162   Vitis vinifera
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    476   8e-162   Solanum tuberosum [potatoes]
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    476   8e-162   Solanum tuberosum [potatoes]
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     476   9e-162   Vigna radiata [mung bean]
gb|AIA22210.1|  heat shock protein 70                                   476   9e-162   Chrysanthemum indicum
ref|NP_001119156.1|  heat shock cognate protein 70-1                    472   1e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    476   1e-161   Prunus mume [ume]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     476   1e-161   
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             476   1e-161   Citrus clementina [clementine]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    476   2e-161   
gb|ACR38891.1|  heat shock protein 70                                   476   2e-161   Apopellia endiviifolia (species B)
ref|XP_012089450.1|  PREDICTED: probable mediator of RNA polymera...    476   2e-161   Jatropha curcas
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             476   2e-161   Capsella rubella
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    476   2e-161   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    475   2e-161   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB88009.1|  heat shock cognate protein HSC70                        475   2e-161   Brassica napus [oilseed rape]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    475   2e-161   Phoenix dactylifera
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    475   2e-161   Brassica rapa
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    475   2e-161   Pyrus x bretschneideri [bai li]
gb|AIU34470.1|  putative heat shock protein                             475   3e-161   Taraxacum brevicorniculatum
ref|NP_001183165.1|  uncharacterized protein LOC100501536               475   3e-161   Zea mays [maize]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    475   3e-161   Populus euphratica
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     475   3e-161   Glycine max [soybeans]
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     475   3e-161   Fragaria vesca subsp. vesca
ref|WP_039310754.1|  molecular chaperone DnaK                           475   3e-161   Paenibacillus sp. IHB B 3415
ref|XP_001767839.1|  predicted protein                                  475   3e-161   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    476   3e-161   
ref|XP_002312090.1|  heat shock protein 70 cognate                      475   3e-161   Populus trichocarpa [western balsam poplar]
ref|XP_001751923.1|  predicted protein                                  475   3e-161   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    475   3e-161   Tarenaya hassleriana [spider flower]
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          475   3e-161   Zea mays [maize]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                475   4e-161   Erythranthe guttata [common monkey flower]
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    474   4e-161   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     474   4e-161   Petunia x hybrida [garden petunia]
gb|AAA62445.1|  heat shock protein                                      474   5e-161   Spinacia oleracea
ref|XP_002528432.1|  heat shock protein, putative                       474   5e-161   Ricinus communis
ref|NP_001292565.1|  heat shock cognate 70 kDa protein 2-like           474   6e-161   Malus domestica [apple tree]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    474   6e-161   Cicer arietinum [garbanzo]
ref|XP_006378714.1|  heat shock protein 70 cognate                      474   7e-161   Populus trichocarpa [western balsam poplar]
ref|NP_001044757.1|  Os01g0840100                                       474   7e-161   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    474   7e-161   Populus euphratica
emb|CAB72129.1|  heat shock protein 70                                  474   7e-161   Cucumis sativus [cucumbers]
ref|XP_003621869.1|  Heat shock protein                                 474   7e-161   Medicago truncatula
dbj|BAP90755.1|  heat shock protein 70                                  474   9e-161   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAV97978.1|  heat shock protein hsp70                                474   9e-161   Saussurea medusa
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    474   1e-160   Prunus mume [ume]
emb|CDP09035.1|  unnamed protein product                                474   1e-160   Coffea canephora [robusta coffee]
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    469   1e-160   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             473   1e-160   Prunus persica
gb|ACB70177.1|  70 kDa heat shock protein                               473   1e-160   Capparis spinosa [caper]
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       473   1e-160   Brachypodium distachyon [annual false brome]
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    473   2e-160   Cicer arietinum [garbanzo]
gb|ADZ46371.1|  HSP70                                                   473   2e-160   Malus hupehensis
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    473   2e-160   Phoenix dactylifera
gb|ACM42161.1|  heat shock protein 70.58                                473   2e-160   Ageratina adenophora
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          473   2e-160   Sorghum bicolor [broomcorn]
gb|ACD93209.1|  heat shock protein 70                                   474   2e-160   Camellia sinensis [black tea]
ref|NP_001055754.1|  Os05g0460000                                       473   2e-160   
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    473   2e-160   Fragaria vesca subsp. vesca
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    473   3e-160   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    473   3e-160   Setaria italica
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     472   3e-160   
dbj|BAJ91305.1|  predicted protein                                      472   3e-160   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001783048.1|  predicted protein                                  472   4e-160   
ref|NP_176036.1|  heat shock protein ERD2                               471   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        472   4e-160   Camelina sativa [gold-of-pleasure]
ref|XP_002873056.1|  HSC70-1                                            472   5e-160   Arabidopsis lyrata subsp. lyrata
emb|CDP00073.1|  unnamed protein product                                471   6e-160   Coffea canephora [robusta coffee]
gb|EPS64948.1|  hypothetical protein M569_09829                         471   6e-160   Genlisea aurea
gb|AAM48131.1|AF509336_1  heat shock protein 70                         471   7e-160   Saussurea medusa
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        471   7e-160   Camelina sativa [gold-of-pleasure]
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       471   7e-160   Medicago truncatula
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     471   7e-160   Triticum urartu
gb|ABX76301.1|  heat shock protein 70                                   471   8e-160   Ageratina adenophora
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    471   8e-160   
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             470   9e-160   Phaseolus vulgaris [French bean]
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     471   9e-160   Brachypodium distachyon [annual false brome]
ref|NP_195870.1|  heat shock cognate protein 70-1                       471   1e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    471   1e-159   
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                471   1e-159   Erythranthe guttata [common monkey flower]
ref|NP_001049712.1|  Os03g0276500                                       471   1e-159   
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     474   1e-159   Glycine soja [wild soybean]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    471   1e-159   Gossypium raimondii
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             471   1e-159   Citrus clementina [clementine]
ref|XP_001785822.1|  predicted protein                                  471   1e-159   
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       471   2e-159   Medicago truncatula
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       469   2e-159   Triticum urartu
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    470   2e-159   Camelina sativa [gold-of-pleasure]
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    470   2e-159   Camelina sativa [gold-of-pleasure]
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             470   2e-159   Capsella rubella
emb|CAA52684.1|  heat shock protein 70 cognate                          470   3e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             470   3e-159   Phaseolus vulgaris [French bean]
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    470   3e-159   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             470   3e-159   Camelina sativa [gold-of-pleasure]
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    470   3e-159   Cucumis melo [Oriental melon]
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     469   3e-159   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    469   4e-159   
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    469   4e-159   Nicotiana sylvestris
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                469   5e-159   Erythranthe guttata [common monkey flower]
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    469   6e-159   Phoenix dactylifera
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    469   6e-159   Brachypodium distachyon [annual false brome]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    469   7e-159   Pyrus x bretschneideri [bai li]
ref|NP_187555.1|  heat shock protein 70-3                               469   7e-159   Arabidopsis thaliana [mouse-ear cress]
emb|CCD74508.1|  early-responsive to dehydration 2                      468   8e-159   Arabidopsis halleri subsp. halleri
gb|AFV46216.1|  hypothetical protein                                    453   8e-159   Scutellaria baicalensis [Baikal skullcap]
gb|ABD32895.1|  Heat shock protein Hsp70                                469   9e-159   Medicago truncatula
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    469   1e-158   Brachypodium distachyon [annual false brome]
gb|ACD45076.1|  heat-shock protein 70                                   469   1e-158   Dactylis glomerata [cocksfoot]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    468   1e-158   Nicotiana tomentosiformis
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       468   1e-158   
ref|XP_002873055.1|  predicted protein                                  468   1e-158   Arabidopsis lyrata subsp. lyrata
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    468   1e-158   Fragaria vesca subsp. vesca
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    468   1e-158   Solanum lycopersicum
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     472   1e-158   Triticum urartu
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    468   1e-158   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    468   2e-158   Brachypodium distachyon [annual false brome]
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    468   2e-158   Pyrus x bretschneideri [bai li]
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    468   2e-158   Solanum lycopersicum
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    465   2e-158   
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     463   2e-158   Eucalyptus grandis [rose gum]
ref|XP_002891955.1|  early-responsive to dehydration 2                  466   2e-158   
ref|NP_195869.1|  heat shock protein 70                                 468   3e-158   Arabidopsis thaliana [mouse-ear cress]
gb|AAB42159.1|  Hsc70                                                   467   4e-158   Solanum lycopersicum
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    467   5e-158   Pyrus x bretschneideri [bai li]
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    467   5e-158   Fragaria vesca subsp. vesca
ref|XP_003621886.1|  Heat shock protein                                 467   5e-158   Medicago truncatula
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    467   5e-158   Tarenaya hassleriana [spider flower]
gb|ACJ85522.1|  unknown                                                 467   5e-158   Medicago truncatula
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          466   6e-158   Sorghum bicolor [broomcorn]
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    466   7e-158   Setaria italica
gb|AAB99745.1|  HSP70                                                   466   9e-158   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             466   1e-157   Citrus clementina [clementine]
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    466   1e-157   Citrus sinensis [apfelsine]
gb|AAV98051.1|  heat shock protein 70                                   466   1e-157   Medicago sativa [alfalfa]
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    466   1e-157   Phoenix dactylifera
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       466   1e-157   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  466   1e-157   Morus notabilis
dbj|BAK07857.1|  predicted protein                                      469   2e-157   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     465   2e-157   
dbj|BAK00257.1|  predicted protein                                      465   2e-157   
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    465   2e-157   
gb|AIU40169.1|  heat shock protein 70                                   464   4e-157   
ref|XP_003625487.1|  Heat shock protein                                 467   4e-157   
dbj|BAJ86014.1|  predicted protein                                      464   4e-157   
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    464   4e-157   
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       464   5e-157   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    464   6e-157   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    468   8e-157   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    463   9e-157   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    463   1e-156   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    463   1e-156   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             463   1e-156   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    463   1e-156   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    463   1e-156   
emb|CDY50531.1|  BnaA01g30490D                                          463   1e-156   
emb|CDX73815.1|  BnaA03g32320D                                          463   2e-156   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    462   2e-156   
emb|CDY00784.1|  BnaC03g37680D                                          462   2e-156   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    462   2e-156   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    462   2e-156   
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    462   2e-156   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    485   3e-156   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       464   3e-156   
gb|KJB20110.1|  hypothetical protein B456_003G133400                    462   3e-156   
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       462   3e-156   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          462   3e-156   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    462   3e-156   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    462   3e-156   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    462   4e-156   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                462   5e-156   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    461   5e-156   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    461   5e-156   
emb|CAA83548.1|  PsHSC71.0                                              461   6e-156   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          461   6e-156   
gb|ABR18415.1|  unknown                                                 461   6e-156   
ref|NP_187864.1|  heat shock protein 70-4                               461   6e-156   
emb|CDY52661.1|  BnaC01g38510D                                          461   1e-155   
ref|XP_001767221.1|  predicted protein                                  461   1e-155   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       461   1e-155   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    459   2e-155   
gb|ACJ54890.1|  heat shock protein 70                                   461   2e-155   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    461   2e-155   
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             460   2e-155   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                460   2e-155   
dbj|BAK02194.1|  predicted protein                                      460   2e-155   
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    460   2e-155   
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    460   2e-155   
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    460   2e-155   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    460   3e-155   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       459   4e-155   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    459   6e-155   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             459   7e-155   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    459   8e-155   
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             458   1e-154   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               457   2e-154   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       457   4e-154   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    455   8e-154   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    464   1e-153   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             456   1e-153   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             456   1e-153   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    455   1e-153   
emb|CAA05547.1|  heat shock protein 70                                  455   2e-153   
ref|XP_001781229.1|  predicted protein                                  455   2e-153   
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     454   5e-153   
ref|XP_012067472.1|  PREDICTED: heat shock cognate 70 kDa protein...    454   5e-153   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    465   7e-153   
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             454   7e-153   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    454   8e-153   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               453   1e-152   
ref|XP_007023492.1|  Heat shock protein 70B                             452   2e-152   
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    442   2e-152   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             452   2e-152   
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          452   2e-152   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             452   3e-152   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             452   3e-152   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             452   3e-152   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    452   3e-152   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               452   4e-152   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             451   1e-151   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    451   1e-151   
ref|XP_002512741.1|  heat shock protein, putative                       450   1e-151   
ref|XP_006368489.1|  heat shock protein 70 cognate                      450   1e-151   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             450   3e-151   
gb|ACC93947.1|  heat-shock protein 70                                   449   4e-151   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     469   4e-151   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          449   5e-151   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        448   6e-151   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  448   7e-151   
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             448   8e-151   
ref|XP_007013854.1|  Heat shock protein 70B                             448   1e-150   
ref|XP_002512742.1|  heat shock protein, putative                       448   1e-150   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   447   2e-150   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          447   2e-150   
ref|XP_012067473.1|  PREDICTED: heat shock 70 kDa protein 5-like        447   2e-150   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          447   2e-150   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          447   3e-150   
gb|KJB49429.1|  hypothetical protein B456_008G119200                    446   3e-150   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          447   4e-150   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    446   5e-150   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          446   1e-149   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               445   1e-149   
prf||1205208A  heat shock protein hsp70                                 445   1e-149
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               445   2e-149   
dbj|BAA04848.1|  HSP70                                                  445   2e-149   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             445   2e-149   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    445   2e-149   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          445   2e-149   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               444   2e-149   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          444   3e-149   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          444   3e-149   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                444   4e-149   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          444   6e-149   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    443   7e-149   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          443   7e-149   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          443   8e-149   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    443   8e-149   
gb|ABK25453.1|  unknown                                                 443   1e-148   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    443   1e-148   
gb|AAA82975.1|  PsHSP71.2                                               442   1e-148   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               442   2e-148   
ref|XP_012089365.1|  PREDICTED: heat shock cognate 70 kDa protein...    442   2e-148   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               442   2e-148   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          442   2e-148   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    442   3e-148   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          442   3e-148   
emb|CDY53148.1|  BnaAnng12070D                                          427   3e-148   
ref|XP_006368490.1|  heat shock protein 70 cognate                      442   3e-148   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     445   5e-148   
ref|XP_012089389.1|  PREDICTED: heat shock cognate 70 kDa protein...    441   5e-148   
emb|CAA54419.1|  heat shock cognate 70-1                                441   6e-148   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               441   8e-148   
ref|XP_003610287.1|  Heat-shock protein                                 440   1e-147   
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    439   2e-147   
ref|XP_010063602.1|  PREDICTED: probable mediator of RNA polymera...    435   3e-147   
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             439   3e-147   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    439   3e-147   
emb|CDY16175.1|  BnaA09g29090D                                          424   4e-147   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               439   5e-147   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             438   8e-147   
emb|CDX85038.1|  BnaC05g20170D                                          424   1e-146   
gb|AGT97046.1|  heat shock protein 70                                   437   1e-146   
emb|CDO98244.1|  unnamed protein product                                437   1e-146   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein               437   2e-146   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    437   3e-146   
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       434   3e-146   
ref|XP_010091163.1|  Heat shock 70 kDa protein                          437   3e-146   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             436   4e-146   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          436   6e-146   
ref|XP_006826662.1|  PREDICTED: heat shock 70 kDa protein 5             436   7e-146   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                436   7e-146   
ref|XP_010063601.1|  PREDICTED: probable mediator of RNA polymera...    434   9e-146   
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427             436   9e-146   
emb|CDY31804.1|  BnaC01g27600D                                          427   2e-145   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    435   2e-145   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    434   2e-145   
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126             434   3e-145   
ref|XP_010537859.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    433   4e-145   
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like          434   5e-145   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             433   7e-145   
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     432   1e-144   
emb|CDP02832.1|  unnamed protein product                                433   1e-144   
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          432   1e-144   
dbj|BAJ34597.1|  unnamed protein product                                431   3e-144   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               431   4e-144   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        431   6e-144   
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          431   8e-144   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          430   1e-143   
gb|KHN14134.1|  Heat shock 70 kDa protein                               429   2e-143   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               429   2e-143   
ref|NP_173055.1|  heat shock protein 70B                                429   2e-143   
ref|XP_008864395.1|  hsp70-like protein                                 417   2e-143   
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...    420   3e-143   
ref|XP_005643450.1|  heat shock protein 70                              429   4e-143   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   427   6e-143   
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          428   9e-143   
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          428   9e-143   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             427   1e-142   
dbj|BAE48223.1|  heat shock protein 70                                  427   1e-142   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             427   2e-142   
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        427   2e-142   
ref|XP_005843891.1|  heat shock protein 70                              426   2e-142   
ref|XP_010678398.1|  PREDICTED: heat shock 70 kDa protein-like          427   2e-142   
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like          427   3e-142   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        426   5e-142   
gb|EPS69582.1|  heat shock protein hsp70                                424   6e-142   
gb|ABR01232.1|  heat shock protein 70                                   425   7e-142   
emb|CDX96825.1|  BnaA08g23680D                                          425   8e-142   
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        425   8e-142   
gb|KDO67637.1|  hypothetical protein CISIN_1g041815mg                   419   1e-141   
ref|XP_002303859.2|  heat shock protein 70 cognate                      424   2e-141   
gb|ABR01238.1|  heat shock protein 70                                   424   2e-141   
dbj|BAM44861.1|  heat shock protein                                     412   2e-141   
emb|CDX83960.1|  BnaC08g16850D                                          424   3e-141   
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg                424   3e-141   
ref|XP_002892893.1|  HSP70B                                             424   3e-141   
gb|AAL68968.1|  heat shock protein 70                                   423   3e-141   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             423   5e-141   
gb|KDD74618.1|  heat shock protein Hsp70                                422   7e-141   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    423   8e-141   
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          422   3e-140   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          421   3e-140   
ref|XP_009844359.1|  hsp70-like protein                                 419   4e-140   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    420   4e-140   
ref|XP_008864401.1|  hsp70-like protein                                 420   7e-140   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     423   9e-140   
ref|XP_011020578.1|  PREDICTED: heat shock 70 kDa protein-like          419   2e-139   
emb|CAN66715.1|  hypothetical protein VITISV_041184                     419   2e-139   
ref|XP_002279097.1|  PREDICTED: heat shock cognate 70 kDa protein       418   5e-139   
gb|KEI41539.1|  hypothetical protein L969DRAFT_85334                    418   6e-139   
gb|AAL79999.3|  heat shock protein 70a                                  418   6e-139   
ref|XP_003333898.1|  heat shock protein HSS1                            417   1e-138   
ref|XP_002140852.1|  heat shock protein 70                              418   2e-138   
dbj|GAA95638.1|  hypothetical protein E5Q_02294                         418   2e-138   
ref|XP_008616175.1|  hsp70-like protein                                 416   3e-138   
emb|CDP00080.1|  unnamed protein product                                414   3e-138   
gb|KDO30632.1|  hsp70-like protein                                      416   3e-138   
ref|XP_002947129.1|  heat-shock inducible Hsp70                         416   4e-138   
gb|AFP57558.1|  heat shock cognate protein 70                           402   8e-138   
gb|AEY80026.1|  heat shock protein 70                                   414   1e-137   



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   484 bits (1247),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRFNDASVQSDIKLWPFK++PGPGDKP+IVV YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDASVQSDIKLWPFKLIPGPGDKPLIVVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   494 bits (1273),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 239/242 (99%), Positives = 241/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKV+PGPGDKPMIVVTYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   482 bits (1240),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 231/249 (93%), Positives = 241/249 (97%), Gaps = 0/249 (0%)
 Frame = +3

Query  57   TPHSKRAMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERL  236
            T   ++ MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERL
Sbjct  10   TAKEEKVMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERL  69

Query  237  IGDAAKNQVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKG  416
            IGDAAKNQVAMNP+NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV+YKG
Sbjct  70   IGDAAKNQVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKG  129

Query  417  EEKQFAAEEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV  596
            EEKQFAAEEISSMVL+KM+EIAEA+LG  VKNAVVTVPAYFNDSQRQATKDAGVIAGLNV
Sbjct  130  EEKQFAAEEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV  189

Query  597  MRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTH  776
            MRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTH
Sbjct  190  MRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTH  249

Query  777  LGXEDFDNR  803
            LG EDFDNR
Sbjct  250  LGGEDFDNR  258



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   488 bits (1257),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   488 bits (1256),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD KLWPFKV+PGPGDKPMI VTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIPGPGDKPMICVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   488 bits (1256),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004142076.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   487 bits (1254),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMI+V+YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   487 bits (1254),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 235/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   487 bits (1254),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 235/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   487 bits (1254),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   487 bits (1253),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   487 bits (1253),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF DASVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   486 bits (1251),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 235/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   486 bits (1251),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   486 bits (1251),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 235/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   486 bits (1251),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVVYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   486 bits (1251),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF DASVQSDIKLWPFKV+PGPGDKPMI+V+YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIIVSYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   485 bits (1248),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND+SVQSDIKLWPFKV+PGPG+KPMI+VTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   484 bits (1247),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGITVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ABA95501.2| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   484 bits (1247),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   486 bits (1250),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 235/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   486 bits (1250),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPGDKPMIVV+YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   485 bits (1248),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND+SVQSDIKLWPFKV+PGPG+KPMI+VTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_012089411.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate 70 kDa protein 
2-like [Jatropha curcas]
Length=661

 Score =   486 bits (1251),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPGDKPMIVV+YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   485 bits (1249),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND+SVQSDIKLWPFKV+PGPG+KPMI+VTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   485 bits (1249),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 240/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_012074911.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Jatropha curcas]
 gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   485 bits (1249),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIKLWPFKV+ GPGDKPMIVV+YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   485 bits (1249),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   485 bits (1249),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DA+VQSDIK WPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   485 bits (1248),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKV+ GPG+KPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIAGPGEKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLVKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   485 bits (1248),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 235/242 (97%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   484 bits (1245),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D+SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   485 bits (1248),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF DASVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGATVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   485 bits (1248),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMIVV YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   484 bits (1247),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR++DASVQSDIKLWPFKV+PGP +KPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDASVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   484 bits (1247),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 234/242 (97%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   484 bits (1246),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD KLWPFKV+ GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIAGPGDKPMICVAYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   484 bits (1246),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPGDKPMIVV YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   484 bits (1246),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   484 bits (1245),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQ D+KLWPFKV+PGPGDKPMIVVTYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   484 bits (1245),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIKLWPFK++ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKLISGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   484 bits (1245),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQSDIKLWPFKV+PGPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   483 bits (1244),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LG+TVKNAVVTVPAY NDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYSNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   483 bits (1244),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDPSVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   483 bits (1244),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D SVQSDIKLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDTSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   483 bits (1244),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PG GDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   483 bits (1244),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PG GDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   483 bits (1244),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIK WPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   483 bits (1243),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVVTYKGEE+QFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGASVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   483 bits (1243),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIK WPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   483 bits (1243),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PG  DKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGAADKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DA VQSDIKLWPFKV+ GPGDKPMIVV+YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAPVQSDIKLWPFKVIAGPGDKPMIVVSYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIK W FKVVPGPGDKPMI VTYKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGPGDKPMITVTYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+DA+VQSDIKLWPFKV+PG GDKPMIVV+YKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDAAVQSDIKLWPFKVIPGSGDKPMIVVSYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD KLWPFKV+PGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV+YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   483 bits (1242),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR++DASVQSDI+LWPFKV+PGPGDKPMIVV+YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIQLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   482 bits (1241),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D+SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   482 bits (1241),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR++D+SVQSD+KLWPFKV+ GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   482 bits (1241),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVVTYKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   482 bits (1241),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D+SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   482 bits (1241),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTV DAKRLIGRR++DASVQSDIKLWPFKV+PG GDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVLDAKRLIGRRYSDASVQSDIKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   482 bits (1240),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLI+MKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIRMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNV IFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVPIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   482 bits (1241),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVVTYKGEE+QFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG +VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGLSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   482 bits (1240),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQ D+KLWPFKV+PGPGDKPMIVVTYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   482 bits (1240),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DA+VQSD KLWPFKV+ G GDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDTKLWPFKVIAGAGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   482 bits (1240),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D+SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   482 bits (1240),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DA+VQSDIK WPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   481 bits (1239),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   481 bits (1239),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVXYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGS+VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   481 bits (1239),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR++D+SVQSD+KLWPFKV+ GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   481 bits (1239),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+ GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   481 bits (1239),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIK WPFKV PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   481 bits (1239),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 239/242 (99%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPG+KPMIVV +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGEKPMIVVQHKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR+ D SVQSDIKLWPFKV+PGP +KPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+ GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   483 bits (1244),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 234/248 (94%), Positives = 241/248 (97%), Gaps = 1/248 (0%)
 Frame = +3

Query  60   PHSKRAMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLI  239
            PH++  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLI
Sbjct  63   PHAE-TMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLI  121

Query  240  GDAAKNQVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGE  419
            GDAAKNQVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+ G  DKPMIVV YKGE
Sbjct  122  GDAAKNQVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGAADKPMIVVNYKGE  181

Query  420  EKQFAAEEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVM  599
            EKQFAAEEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVM
Sbjct  182  EKQFAAEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVM  241

Query  600  RIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL  779
            RIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL
Sbjct  242  RIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL  301

Query  780  GXEDFDNR  803
            G EDFDNR
Sbjct  302  GGEDFDNR  309



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D +VQSD+KLWPFKVVPGP DKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTTVQSDVKLWPFKVVPGPADKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVA+NPINTVFDAKRLIGRRF+DASVQ D+KLWPFKV+PGPGDKPMIVVTYKGEEK+FAA
Sbjct  61   QVALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR+ D SVQSDIKLWPFKV+PGP +KPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DA+VQSDIKLWPFKVV GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKLWPFKVVAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D+SVQSD+KLWPFKV+PGPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006833219.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPGDKPMIVV YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIG+AAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGNAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIEVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG  VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFNVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFK++PGP +KPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGS+VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQ D+KLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQGDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIKLWPFKV+ GPGDKPMI VTYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   480 bits (1236),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMIVV YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   480 bits (1236),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QV MNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+PGPGDKPMI+V+YKG EKQFAA
Sbjct  61   QVTMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGGEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNV IFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVSIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   480 bits (1236),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFK++PGP +KPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   480 bits (1236),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR +DASVQSD+KLWPFKV+PGP DKPMIVV YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   480 bits (1236),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMIVV YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   480 bits (1235),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRR++DASVQSDIKLWPFKVVPGPGDKPMI+V Y+GE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDASVQSDIKLWPFKVVPGPGDKPMIIVQYRGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   480 bits (1235),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001051724.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|AAO65876.1| heat shock protein cognate 70 [Oryza sativa Japonica Group]
 gb|ABF99592.1| Heat shock cognate 70 kDa protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13638.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|EAZ29089.1| hypothetical protein OsJ_13143 [Oryza sativa Japonica Group]
 dbj|BAG91581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   480 bits (1235),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 237/239 (99%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  266
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  64

Query  267  MNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEEI  446
            MNPINTVFDAKRLIGRRF+DASVQSDIK+WP+KV+PGPGDKPMIVV YKGEEKQF+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  447  SSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  626
            SSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  184

Query  627  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  185  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  243



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   480 bits (1235),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PGP DKPMIVV YKG+EKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGDEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   480 bits (1235),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKVV GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKE AEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKN+LIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSVGEKNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   483 bits (1243),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 232/243 (95%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = +3

Query  75   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  254
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  93   SMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  152

Query  255  NQVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFA  434
            NQVAMNPINTVFDAKRLIGRRF DASVQSDIK WPFKV PGPGDKPMIVV YKGEEKQFA
Sbjct  153  NQVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFA  212

Query  435  AEEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  614
            AEEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  213  AEEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  272

Query  615  PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDF  794
            PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDF
Sbjct  273  PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF  332

Query  795  DNR  803
            DNR
Sbjct  333  DNR  335



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   483 bits (1242),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 232/243 (95%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = +3

Query  75   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  254
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  93   SMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  152

Query  255  NQVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFA  434
            NQVAMNPINTVFDAKRLIGRRF DASVQSDIK WPFKV PGPGDKPMIVV YKGEEKQFA
Sbjct  153  NQVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFA  212

Query  435  AEEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  614
            AEEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  213  AEEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  272

Query  615  PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDF  794
            PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDF
Sbjct  273  PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF  332

Query  795  DNR  803
            DNR
Sbjct  333  DNR  335



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   479 bits (1234),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV+YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEA+LG  VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   479 bits (1234),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR +DASVQSD+KLWPFKV+PGP DKPMIVV YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   479 bits (1234),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+PGPGDKPMIVV YKGE+KQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGYTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAASVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   479 bits (1233),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PGP DKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   479 bits (1233),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DA+VQSD+KLWPFKV+ GPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAAVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   479 bits (1233),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PGP DKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   479 bits (1233),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 232/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFK + GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM LIKMKE+AEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMGLIKMKEMAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   479 bits (1233),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQSD+KLWPFKV+ GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004962705.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   479 bits (1233),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPG+KPMIVV +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score =   474 bits (1221),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DAS+QSD+KLWPFKV+PG GDKP IVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004981251.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Setaria 
italica]
Length=648

 Score =   479 bits (1232),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  266
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  64

Query  267  MNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEEI  446
            MNPINTVFDAKRLIGRRF+DASVQSDIK+WP+KV+PGPGDKPMIVV YKGEEKQF+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  447  SSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  626
            SSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  125  SSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  184

Query  627  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  185  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  243



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   479 bits (1232),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DA VQ D+K+WPFKV+PGPG+KPMIVV YKGE+KQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDAPVQGDMKMWPFKVIPGPGEKPMIVVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   479 bits (1232),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DA+VQSDIKLWPFKV+ GP DKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDATVQSDIKLWPFKVIAGPADKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIE+GIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009102555.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=647

 Score =   479 bits (1232),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPPYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002442353.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|EES16191.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|AHV91025.1| Hsp70 [Saccharum hybrid cultivar]
Length=649

 Score =   479 bits (1232),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPG+KPMIVV +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   479 bits (1232),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   478 bits (1231),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 238/242 (98%), Gaps = 1/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVF AKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVF-AKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  119

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  120  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  179

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  180  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  239

Query  798  NR  803
            NR
Sbjct  240  NR  241



>gb|AAS09825.1| heat shock cognate protein 70 [Eutrema halophilum]
Length=651

 Score =   478 bits (1231),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   478 bits (1231),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMI+V YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEDKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   478 bits (1231),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQSD+KLWPFKV+ GPGDKPMIVVTYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   464 bits (1195),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+ G GDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   478 bits (1230),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPG+KPMIVV +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   478 bits (1230),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR++D SVQ+D+KLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDPSVQADMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_001759874.1| predicted protein [Physcomitrella patens]
 gb|EDQ75378.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   478 bits (1230),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   478 bits (1230),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIKLWPFKV  GPGDKPMI V YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVFSGPGDKPMIQVNYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   478 bits (1230),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+ G  DKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGAADKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   478 bits (1229),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   478 bits (1229),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ G GDKPMIVV+YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGVGDKPMIVVSYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIA+AYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIADAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   478 bits (1229),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D SVQSDIKLWPFKV+ GPGDKPMI VTYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDVSVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009115390.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=649

 Score =   478 bits (1229),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 228/240 (95%), Positives = 235/240 (98%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  263
            GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKNQV
Sbjct  4    GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63

Query  264  AMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEE  443
            AMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMIVV YKGEEKQFAAEE
Sbjct  64   AMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVDYKGEEKQFAAEE  123

Query  444  ISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  623
            ISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA
Sbjct  124  ISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  183

Query  624  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  184  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  243



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   477 bits (1228),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+ GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGS+VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   477 bits (1228),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQSDIKLWPFKVV GPGDKPMIVVTYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LG++V NAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGTSVNNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   477 bits (1228),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DA VQSDIKLWPFKV+ GP DKP IVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAPVQSDIKLWPFKVIAGPADKPTIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   477 bits (1228),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVLIKMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK+TS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSTSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score =   477 bits (1228),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 227/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = +3

Query  75   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  254
            A AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  2    AAAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  61

Query  255  NQVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFA  434
            NQVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVVTYKGEEKQF+
Sbjct  62   NQVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFS  121

Query  435  AEEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  614
            AEEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINE
Sbjct  122  AEEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINE  181

Query  615  PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDF  794
            PTAAAIAYGLDKK+TS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDF
Sbjct  182  PTAAAIAYGLDKKSTSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF  241

Query  795  DNR  803
            DNR
Sbjct  242  DNR  244



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   477 bits (1227),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DA VQSD+KLWPFKVV GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDACVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLGSTVKN VVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNGVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   472 bits (1215),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLW FK++ GP +KPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWLFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   477 bits (1227),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQ D+KLWPFKVV GPGDKPMIVV+YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQGDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   477 bits (1227),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKV+PG GDKPMIVV+YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVSYKGEDKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   477 bits (1227),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSDIKLWPFKVV GPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDVSVQSDIKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   476 bits (1226),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSD+KLWPFKV+ GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   476 bits (1226),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 238/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV+ GPGDKPMIVV Y+GEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYRGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   476 bits (1226),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGP DKPMIVVTYKGEEKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK+TS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSTSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   476 bits (1226),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGP DKPMIVVTYKGEEKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK+TS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSTSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   476 bits (1226),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ G GDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGAGDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   476 bits (1225),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   472 bits (1214),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK+  GP DKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   476 bits (1225),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFKV PGPGDKPMI V+YKGEEK FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGPGDKPMIGVSYKGEEKVFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   476 bits (1224),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR +D SVQSD+KLWPFKV+ GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRVSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   476 bits (1224),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQ D+KLWPFKV+ GP DKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   476 bits (1224),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GP DKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK++S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSSSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   476 bits (1224),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQ D+KLWPFKV PGPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDGSVQDDMKLWPFKVTPGPGDKPMIGVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_012089450.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Jatropha curcas]
 gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   476 bits (1224),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQ D+KLWPFKV+ GPGDKPMIVV+YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQGDMKLWPFKVIAGPGDKPMIVVSYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   476 bits (1224),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK++PGP DKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKILPGPADKPMIYVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   476 bits (1224),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI+ANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIVANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND SVQSDIK WPFKVV G  DKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDPSVQSDIKHWPFKVVAGAADKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   475 bits (1223),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF DASVQSDIKLWPFKV  GPGDKPMI V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVTSGPGDKPMIAVQYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   475 bits (1223),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++ GP +KPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   475 bits (1223),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD++LWPFKV+PGPGDKP+IVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDTSVQSDMRLWPFKVIPGPGDKPLIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAASVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   475 bits (1223),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD+KLWPFK++ GP +KPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   475 bits (1223),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQ D+K WPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGNTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001183165.1| uncharacterized protein LOC100501536 [Zea mays]
 gb|ACR35910.1| unknown [Zea mays]
 gb|AFW84633.1| heat shock protein1 [Zea mays]
Length=648

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 228/240 (95%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  263
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  61

Query  264  AMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEE  443
            AMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQFAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  444  ISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  623
            ISSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA
Sbjct  122  ISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  181

Query  624  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  182  AAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQ+DIKLWPFKVV GPGDKPMIVVTYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQNDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LG+ V NAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGTAVNNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKAT+VGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATTVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQ D+KLWPFKV+PGP +KPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQ D+KLWPFKVV GPGDKPMI V+YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDMKLWPFKVVAGPGDKPMINVSYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF DASVQSD+KLWPFKV+ GPGDKPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVS+LTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSILTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007016452.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34071.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=677

 Score =   476 bits (1225),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGWAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRFNDASVQSDIKLWPFKV PG GDKPMI VTYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFNDASVQSDIKLWPFKVSPGAGDKPMITVTYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVL+KMKE AEAYLGSTVKN VVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEVSSMVLMKMKETAEAYLGSTVKNGVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQ DIK WPFKV PG GDKPMI V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDIKHWPFKVTPGAGDKPMISVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVMYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVS+LTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSILTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQ DIKLWPFKV+PGP DKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQGDIKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVI GLNVMRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVIGGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008674843.1| PREDICTED: heat shock 70 kDa protein-like [Zea mays]
 tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays]
Length=648

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 227/240 (95%), Positives = 234/240 (98%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  263
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  264  AMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEE  443
            AMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV+YKGEEKQFAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAAEE  121

Query  444  ISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  623
            ISSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA
Sbjct  122  ISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  181

Query  624  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  182  AAIAYGLDKKASSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   475 bits (1222),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D SVQ+D+KLWPFKV+PGP +KPMIVV+YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIPGPAEKPMIVVSYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGKTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   474 bits (1221),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR++D+SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKAT+ GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATTSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   474 bits (1221),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 227/237 (96%), Positives = 233/237 (98%), Gaps = 0/237 (0%)
 Frame = +3

Query  93   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMN  272
            EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKNQVAMN
Sbjct  1    EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN  60

Query  273  PINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEEISS  452
            PINTVFDAKRLIGRRF+D SVQSDIKLWPFKV+PGPGDKPMIVVTYKGEEKQFAAEEISS
Sbjct  61   PINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAAEEISS  120

Query  453  MVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAI  632
            MVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAI
Sbjct  121  MVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAI  180

Query  633  AYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  181  AYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  237



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   474 bits (1221),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQ+D+K WPFKVV GPG+KPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQADMKHWPFKVVSGPGEKPMIGVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   474 bits (1221),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR++DASVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIKLWPFKVIAGPGDKPMIVVAYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001292565.1| heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   474 bits (1220),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR++D SVQ D+K WPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   474 bits (1220),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRR +DASVQSD+KLWPFKV+PGP +KPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   474 bits (1220),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DA+VQSDIK W FKVVPG GDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAAVQSDIKHWSFKVVPGAGDKPMIQVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   474 bits (1220),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 227/240 (95%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  263
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  264  AMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEE  443
            AMNPINTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQF+AEE
Sbjct  62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  444  ISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  623
            ISSMVLIKM+EIAEAYLGS +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA
Sbjct  122  ISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  181

Query  624  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  182  AAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   474 bits (1220),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIK W FKVVPG GDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGAGDKPMIQVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   474 bits (1220),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI ANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIFANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GP DKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK++S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSSSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   474 bits (1219),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR +DASVQSD+KLWPFKV+ GPG+KPMI V YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGPGEKPMIGVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   474 bits (1219),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDPERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   474 bits (1219),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVMYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVTRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   474 bits (1219),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DAS+QSD+KLWPFKV+PG GDKP IVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CDP09035.1| unnamed protein product [Coffea canephora]
Length=650

 Score =   474 bits (1219),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRR +D+SVQ+DIKLWPFKV+ GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRLSDSSVQNDIKLWPFKVIAGPGDKPMIAVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKE+AEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEVAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score =   469 bits (1206),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF DA++QSD+KLWPFKV+ G GDKP IVV YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGSTVKN+VVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNSVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   473 bits (1218),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DAS+QSD+KLWPFKV+PG GDKP IVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   473 bits (1218),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR++D+SVQ+D+KLWPFKVVPG GDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQADMKLWPFKVVPGSGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LG T+KN VVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGCTIKNGVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAASVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003564580.1| PREDICTED: heat shock cognate 70 kDa protein [Brachypodium distachyon]
Length=654

 Score =   473 bits (1218),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEI EAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   473 bits (1218),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFK++ GP +KPMI V YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIISGPAEKPMIGVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   473 bits (1218),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRR++D SVQ D+K WPFK +PGPGDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKAIPGPGDKPMIVVMYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   473 bits (1217),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV+ GPGDKPMI V YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIGVQYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVL+KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGPG+KPMI V YKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGEKPMISVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDF 
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFG  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002456611.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
 gb|EES01731.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
Length=648

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  263
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  264  AMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEE  443
            AMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQFAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  444  ISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  623
            ISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA
Sbjct  122  ISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  181

Query  624  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  182  AAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   474 bits (1219),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF DASVQSD+KLWPFKV+ GPGDKPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  266
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  267  MNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEEI  446
            MNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKVVPGPGDKPMIVV YKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI  122

Query  447  SSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  626
            SSMVLIKM+EIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  627  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  183  AIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRFND SVQ DIK WPFKVV GP +KPMIVV+YKGEEKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDPSVQGDIKHWPFKVVAGPAEKPMIVVSYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   473 bits (1217),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFK++ GP +KPMI V YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIISGPAEKPMIGVNYKGEDKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004970526.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=648

 Score =   473 bits (1216),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  263
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  264  AMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEE  443
            AMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQFAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  444  ISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  623
            ISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA
Sbjct  122  ISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  181

Query  624  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  182  AAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   472 bits (1215),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D++VQSDIKLWPFKVV GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   472 bits (1215),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D++VQSDIKLWPFKVV GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   472 bits (1215),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSD+KLWPFKV PG  DKPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGAADKPMISVQYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_176036.1| heat shock protein ERD2 [Arabidopsis thaliana]
 sp|Q9C7X7.1|HSP7N_ARATH RecName: Full=Heat shock 70 kDa protein 18; AltName: Full=Heat 
shock protein 70-18; Short=AtHsp70-18; AltName: Full=Heat-shock 
protein 70T-1 [Arabidopsis thaliana]
 gb|AAG51503.1|AC058785_6 heat shock protein, putative [Arabidopsis thaliana]
 gb|ABE65717.1| heat shock cognate 70 kDa protein/HSC70/HSP70 [Arabidopsis thaliana]
 gb|AEE33389.1| heat shock protein ERD2 [Arabidopsis thaliana]
Length=617

 Score =   471 bits (1212),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+DASVQSD+K WPFKV PG  DKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKFWPFKVTPGQADKPMIFVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVG KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGIKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010473075.1| PREDICTED: heat shock 70 kDa protein 3-like [Camelina sativa]
Length=649

 Score =   472 bits (1215),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND+SVQSD +LWPFK++ GPG+KPMIVV YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDRQLWPFKIISGPGEKPMIVVNYKGEDKEFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   472 bits (1214),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK+ PGP DKPMI V YKGEEK FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQPGPADKPMIYVEYKGEEKMFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   471 bits (1212),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFKV+ G GDKPMIVV YKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLNKMKEIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|EPS64948.1| hypothetical protein M569_09829, partial [Genlisea aurea]
Length=635

 Score =   471 bits (1212),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  9    MAVKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  68

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQSDIKLWPFKV+ G GDKPMIVV+YKGEEKQF+A
Sbjct  69   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGAGDKPMIVVSYKGEEKQFSA  128

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKE AEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  129  EEISSMVLIKMKETAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  188

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKAT+VGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  189  TAAAIAYGLDKKATAVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  248

Query  798  NR  803
            NR
Sbjct  249  NR  250



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   471 bits (1213),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVMYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
             EISSMVLIKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  GEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAA AYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAATAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010486515.1| PREDICTED: heat shock 70 kDa protein 3-like [Camelina sativa]
Length=649

 Score =   471 bits (1213),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND+SVQSD +LWPFK++ GPG+KPMIVV YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDRQLWPFKIISGPGEKPMIVVNYKGEDKEFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   471 bits (1213),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF D SVQSD+KLWPFKV+PGP DKPMIVV YK EEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFGDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   471 bits (1213),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D++VQSDIKLWPFKVV GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ABX76301.1| heat shock protein 70 [Ageratina adenophora]
Length=649

 Score =   471 bits (1213),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPPYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   471 bits (1213),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  266
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  62

Query  267  MNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEEI  446
            MNP NTVFDAKRLIGRR++D SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEKQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEI  122

Query  447  SSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  626
            SSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI GLNVMRIINEPTAA
Sbjct  123  SSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIGGLNVMRIINEPTAA  182

Query  627  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  183  AIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>ref|XP_007144450.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16444.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=614

 Score =   470 bits (1209),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR +DASVQSD+KLWPFKV  GPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDASVQSDMKLWPFKVFAGPGDKPMIQVSYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   471 bits (1212),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D++VQSDIKLWPFKVV GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK+  GP DKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 234/240 (98%), Gaps = 0/240 (0%)
 Frame = +3

Query  84   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  263
            GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQV
Sbjct  4    GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  63

Query  264  AMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEE  443
            AMNPINTVFDAKRLIGRR++D SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEKQF+AEE
Sbjct  64   AMNPINTVFDAKRLIGRRYSDPSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFSAEE  123

Query  444  ISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  623
            ISSMVLIKMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEPTA
Sbjct  124  ISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTA  183

Query  624  AAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  184  AAIAYGLDKKASSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  243



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+K WPFKV+PGP +KPMIVV++KGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKHWPFKVIPGPAEKPMIVVSHKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_001049712.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|ABF95258.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11626.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|EAZ26443.1| hypothetical protein OsJ_10329 [Oryza sativa Japonica Group]
 dbj|BAG93163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADR66978.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=650

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQSD KLWPFKV+PGPGDKPMI V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKE AEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK++SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSSSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KHN13890.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=729

 Score =   474 bits (1219),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV F DSE LIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFIDSECLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTV+DAKRLIGRRF+DASVQSD+KLWPFKV+PGP DKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVYDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D+SVQSDIKLWP+KV+ G GDKPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPYKVIAGSGDKPMIIVSYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQ DIK WPFKV+PG GDKP IVV YKGEEKQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDSSVQGDIKHWPFKVIPGAGDKPTIVVVYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSNVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_001785822.1| predicted protein [Physcomitrella patens]
 gb|EDQ49366.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   471 bits (1211),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+DASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVLIKMKEIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   471 bits (1211),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRR +D SVQSD+KLWPFKV+PGP DKPMIVV YK EEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|EMS51135.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=610

 Score =   469 bits (1207),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/243 (93%), Positives = 234/243 (96%), Gaps = 1/243 (0%)
 Frame = +3

Query  78   MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  254
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  255  NQVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFA  434
            NQVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGP DKPMIVV YKGEEKQFA
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  435  AEEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  614
            AEEISSMVLIKMKEI EAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  121  AEEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  180

Query  615  PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDF  794
            PTAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDF
Sbjct  181  PTAAAIAYGLDKKASSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF  240

Query  795  DNR  803
            DNR
Sbjct  241  DNR  243



>ref|XP_010423853.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   470 bits (1210),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK+  GP DKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVNYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010452093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Camelina sativa]
 ref|XP_010452094.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Camelina sativa]
 ref|XP_010490701.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   470 bits (1210),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK+  GP DKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVNYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   470 bits (1210),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D+SVQSD  LWPFK++ GPG+KPMIVV YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDRALWPFKIISGPGEKPMIVVNYKGEDKEFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   470 bits (1209),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSD+KLWPFK+  GP DKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKAT+VGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATTVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   470 bits (1209),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR +DASVQSD+KLWPFKV  GPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDASVQSDMKLWPFKVFAGPGDKPMIQVSYKGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   470 bits (1209),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR +DASVQSD+KLWPFKV  GPGDKPMI V+YKGE+K FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRISDASVQSDMKLWPFKVTSGPGDKPMIGVSYKGEDKLFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010464591.1| PREDICTED: heat shock 70 kDa protein 3 [Camelina sativa]
Length=649

 Score =   470 bits (1209),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRFND+SVQSD +LWPFK++ GP +KPMIVV YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDRQLWPFKIISGPAEKPMIVVNYKGEDKEFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   470 bits (1209),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQSDIKLWPFKV+ GP DKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK++S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSSSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   469 bits (1208),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGP DKPMIVV +KGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNHKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EE+SSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   469 bits (1208),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRR +DASVQSD+KLWPFKV+ G  +KPMI V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGTAEKPMIGVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   469 bits (1208),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRFND SVQSD+KLWPFKV+PGP DKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFNDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAG I+GLNVMRIINEP
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   469 bits (1208),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+D SVQ+D+K WPFKV+PGP +KPMI V YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQADMKHWPFKVIPGPAEKPMIEVAYKGEQKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGKTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_008776699.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   469 bits (1207),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVA+NPINTVFDAKRLIGRRF+DASVQ+D+KLWPFKVV GPGDKP+I V YKGEEKQFAA
Sbjct  61   QVAINPINTVFDAKRLIGRRFSDASVQNDMKLWPFKVVAGPGDKPLIAVQYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGL+VMRI+NEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLSVMRIVNEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLD+KA S GEKN+LIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDRKAGSAGEKNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            +R
Sbjct  241  SR  242



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   469 bits (1207),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = +3

Query  87   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  266
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  267  MNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAAEEI  446
            MNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV +KGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQHKGEEKQFAAEEI  122

Query  447  SSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  626
            SSMVLIKM+EIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMREIAEAYLGNSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  627  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFDNR  803
            AIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFDNR
Sbjct  183  AIAYGLDKKATSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR  241



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   469 bits (1207),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRR +DASVQSD+KLWPFKV  GPGDKPMI V+YKGE+K FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRISDASVQSDMKLWPFKVTSGPGDKPMIGVSYKGEDKLFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|NP_187555.1| heat shock protein 70-3 [Arabidopsis thaliana]
 ref|NP_001189847.1| heat shock protein 70-3 [Arabidopsis thaliana]
 sp|O65719.1|HSP7C_ARATH RecName: Full=Heat shock 70 kDa protein 3; AltName: Full=Heat 
shock cognate 70 kDa protein 3; AltName: Full=Heat shock cognate 
protein 70-3; Short=AtHsc70-3; AltName: Full=Heat shock 
protein 70-3; Short=AtHsp70-3 [Arabidopsis thaliana]
 gb|AAF14038.1|AC011436_22 heat-shock protein (At-hsc70-3) [Arabidopsis thaliana]
 gb|AAF23276.1|AC016661_1 heat shock cognate 70kD protein [Arabidopsis thaliana]
 emb|CAA76606.1| At-hsc70-3 [Arabidopsis thaliana]
 gb|AAK92833.1| putative heat-shock protein At-hsc70-3 [Arabidopsis thaliana]
 gb|AAM20310.1| putative heat-shock protein [Arabidopsis thaliana]
 gb|AAM26685.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AAN46823.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AEE74767.1| heat shock protein 70-3 [Arabidopsis thaliana]
 gb|AEE74768.1| heat shock protein 70-3 [Arabidopsis thaliana]
Length=649

 Score =   469 bits (1206),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF D+SVQSDIKLWPF +  GP +KPMIVV YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSM+LIKM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>emb|CCD74508.1| early-responsive to dehydration 2 [Arabidopsis halleri subsp. 
halleri]
Length=622

 Score =   468 bits (1204),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP+NTVFDAKRLIGR F++ASVQSD+KLWPFK++PG  DKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRIFSNASVQSDMKLWPFKIIPGQEDKPMILVNYKGEEKQFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVG KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGNKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   453 bits (1166),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 217/233 (93%), Positives = 227/233 (97%), Gaps = 0/233 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGPGDKPMIVV +KGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNHKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTH  776
            TAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTH
Sbjct  181  TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTH  233



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   469 bits (1206),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD+KLWPFK++ GP +KP+I V YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIISGPAEKPLIGVNYKGEDKEFAA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KM+EIAEAYLGS +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   469 bits (1206),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNPINTVFDAKRLIGRRF+DASVQSD KLWPFKV+PGPGDKPMI V Y+GE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIGVQYRGEDKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL KMKE AEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKK+TSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKSTSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



>gb|ACD45076.1| heat-shock protein 70 [Dactylis glomerata]
Length=656

 Score =   469 bits (1206),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 227/243 (93%), Positives = 234/243 (96%), Gaps = 1/243 (0%)
 Frame = +3

Query  78   MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  254
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  255  NQVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFA  434
            NQVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGP DKPMIVV YKGEEKQFA
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  435  AEEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  614
            AEEISSMVLIKMKEI EAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  121  AEEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  180

Query  615  PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDF  794
            PTAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG EDF
Sbjct  181  PTAAAIAYGLDKKASSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF  240

Query  795  DNR  803
            DNR
Sbjct  241  DNR  243



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   468 bits (1205),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = +3

Query  78   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  257
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  258  QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVVPGPGDKPMIVVTYKGEEKQFAA  437
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKV+PGP DKPMIVV YKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  438  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  617
            EEISSMVL+KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAG+I+GLNVMRIINEP
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGIISGLNVMRIINEP  180

Query  618  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGXEDFD  797
            TAAAIAYGLDKKA S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLG EDFD
Sbjct  181  TAAAIAYGLDKKAGSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD  240

Query  798  NR  803
            NR
Sbjct  241  NR  242



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1697011271292