BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1502

Length=976
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11965.1|  unnamed protein product                                125   7e-29   Coffea canephora [robusta coffee]
ref|XP_009602520.1|  PREDICTED: TOM1-like protein 2                     115   2e-25   Nicotiana tomentosiformis
ref|XP_009781390.1|  PREDICTED: TOM1-like protein 2                     114   3e-25   Nicotiana sylvestris
ref|XP_011102017.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    108   5e-23   
ref|XP_006356339.1|  PREDICTED: TOM1-like protein 1-like isoform X1     107   2e-22   Solanum tuberosum [potatoes]
ref|XP_004237704.1|  PREDICTED: target of Myb protein 1                 106   4e-22   Solanum lycopersicum
ref|XP_002520270.1|  protein transporter, putative                    81.6    4e-14   Ricinus communis
ref|XP_002285894.1|  PREDICTED: target of Myb protein 1-like          77.8    3e-13   Vitis vinifera
gb|EYU32476.1|  hypothetical protein MIMGU_mgv1a005006mg              76.6    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_007201782.1|  hypothetical protein PRUPE_ppa004229mg           73.9    2e-11   Prunus persica
ref|XP_006434325.1|  hypothetical protein CICLE_v10000887mg           74.3    2e-11   Citrus clementina [clementine]
ref|XP_012078346.1|  PREDICTED: TOM1-like protein 2                   73.6    4e-11   Jatropha curcas
ref|XP_008237773.1|  PREDICTED: target of Myb protein 1               72.0    6e-11   Prunus mume [ume]
gb|KDO83505.1|  hypothetical protein CISIN_1g0101502mg                71.6    8e-11   Citrus sinensis [apfelsine]
gb|KHG12036.1|  Target of Myb 1                                       72.4    1e-10   Gossypium arboreum [tree cotton]
gb|KJB59348.1|  hypothetical protein B456_009G250700                  71.6    2e-10   Gossypium raimondii
ref|XP_009342857.1|  PREDICTED: target of Myb protein 1-like          70.5    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_002300956.1|  VHS domain-containing family protein             67.8    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006472885.1|  PREDICTED: target of Myb protein 1-like isof...  70.9    4e-10   Citrus sinensis [apfelsine]
ref|XP_009360664.1|  PREDICTED: target of Myb protein 1-like          69.7    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_011006301.1|  PREDICTED: target of Myb protein 1-like          68.6    2e-09   Populus euphratica
ref|XP_011027423.1|  PREDICTED: target of Myb protein 1               65.1    2e-09   Populus euphratica
ref|XP_010112024.1|  TOM1-like protein 2                              67.4    4e-09   Morus notabilis
ref|XP_003523415.1|  PREDICTED: TOM1-like protein 2-like isoform X1   67.4    6e-09   Glycine max [soybeans]
ref|XP_010260421.1|  PREDICTED: target of Myb protein 1               63.2    8e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010270344.1|  PREDICTED: TOM1-like protein 2 isoform X2        62.4    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010270342.1|  PREDICTED: probable ADP-ribosylation factor-...  62.4    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_003526661.1|  PREDICTED: TOM1-like protein 2-like              64.7    3e-08   Glycine max [soybeans]
ref|XP_009366814.1|  PREDICTED: target of Myb protein 1-like          62.4    8e-08   Pyrus x bretschneideri [bai li]
gb|AFK38881.1|  unknown                                               62.8    1e-07   Lotus japonicus
gb|KHN46964.1|  TOM1-like protein 2                                   63.2    1e-07   Glycine soja [wild soybean]
ref|XP_008373307.1|  PREDICTED: uncharacterized protein LOC103436643  61.2    2e-07   
ref|XP_008338481.1|  PREDICTED: protein transport protein Sec31A-...  60.8    2e-07   
ref|XP_007137502.1|  hypothetical protein PHAVU_009G132300g           62.4    2e-07   Phaseolus vulgaris [French bean]
ref|XP_009346369.1|  PREDICTED: target of Myb protein 1-like          60.8    2e-07   
ref|XP_004290725.1|  PREDICTED: target of Myb protein 1-like          59.7    2e-07   Fragaria vesca subsp. vesca
ref|XP_007019271.1|  Target of Myb protein 1 isoform 1                61.2    5e-07   
ref|XP_004502554.1|  PREDICTED: ADP-ribosylation factor-binding p...  60.5    8e-07   Cicer arietinum [garbanzo]
ref|XP_004502552.1|  PREDICTED: ADP-ribosylation factor-binding p...  59.7    2e-06   Cicer arietinum [garbanzo]
ref|XP_004139800.1|  PREDICTED: TOM1-like protein 2                   58.5    4e-06   Cucumis sativus [cucumbers]
ref|XP_002307466.1|  VHS domain-containing family protein             58.2    4e-06   
ref|XP_002450494.1|  hypothetical protein SORBIDRAFT_05g006160        52.8    2e-05   Sorghum bicolor [broomcorn]
gb|KEH35378.1|  ENTH/VHS/GAT family protein                           53.9    1e-04   Medicago truncatula
ref|XP_006593776.1|  PREDICTED: hepatocyte growth factor-regulate...  53.5    2e-04   Glycine max [soybeans]
ref|XP_003541937.1|  PREDICTED: hepatocyte growth factor-regulate...  53.5    2e-04   Glycine max [soybeans]
ref|XP_006593778.1|  PREDICTED: hepatocyte growth factor-regulate...  53.5    2e-04   Glycine max [soybeans]
gb|AFK39489.1|  unknown                                               50.1    2e-04   Medicago truncatula
gb|EMS53515.1|  TOM1-like protein 2                                   49.3    2e-04   Triticum urartu
dbj|BAI66420.1|  seed protein B32E                                    49.3    2e-04   Triticum aestivum [Canadian hard winter wheat]
emb|CDP21682.1|  unnamed protein product                              51.6    2e-04   Coffea canephora [robusta coffee]
ref|XP_010062194.1|  PREDICTED: TOM1-like protein 2                   52.4    4e-04   Eucalyptus grandis [rose gum]
ref|XP_008447823.1|  PREDICTED: TOM1-like protein 2                   51.6    6e-04   Cucumis melo [Oriental melon]
ref|XP_010237854.1|  PREDICTED: uncharacterized protein LOC100820...  45.8    8e-04   Brachypodium distachyon [annual false brome]
gb|ACR38743.1|  unknown                                               47.4    9e-04   Zea mays [maize]
gb|AFW60668.1|  putative VHS/GAT domain containing family protein     47.4    9e-04   
ref|XP_003577738.1|  PREDICTED: TOM1-like protein 2 isoform X1        45.4    0.001   Brachypodium distachyon [annual false brome]



>emb|CDP11965.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 136/213 (64%), Gaps = 22/213 (10%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RDTSQG GQGRKP     EP RINPILPPPP S    + DAGM+DYLSG+ YQSERSSG 
Sbjct  306  RDTSQGQGQGRKPTNAYGEPSRINPILPPPPPSTKFSTPDAGMVDYLSGDAYQSERSSGT  365

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMF---------  594
            S SAP AV T SN+ I V+++ P             ++  D+F+NPTA+MF         
Sbjct  366  SASAPVAVPTQSNNKISVRTSSPSQPL---------SSPPDEFINPTATMFPPKSTYDEP  416

Query  593  ASKPKSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsyn----  426
             S  KSAD LP APWD  P  ++PPPP++ NQRQQ+FEQ+       S  S+        
Sbjct  417  TSLAKSADPLPSAPWDVPPPTSIPPPPSRHNQRQQFFEQKQNTIPGGSPHSSSGSGSSYD  476

Query  425  SLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            SLVGQT+NLS+   TPTKQ+K EDALFKDLVDF
Sbjct  477  SLVGQTQNLSLRTSTPTKQDKQEDALFKDLVDF  509



>ref|XP_009602520.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
 ref|XP_009602521.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
 ref|XP_009602522.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
Length=522

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 151/211 (72%), Gaps = 20/211 (9%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQ   QGRK + +KSEP+RI P LPPPPSSR PVSTDAGM+DYLSG+ ++SERS G 
Sbjct  305  RDPSQA--QGRKTVDVKSEPMRITPTLPPPPSSRKPVSTDAGMVDYLSGDRFESERSFGT  362

Query  746  SGSAPTAVSTHSND--SIPVksnppklsssppddLINPTAADDDFLNPTASMFA------  591
            +GS+P AVST+SN+  SIP  S  P  S+ P DDL+NPT ADDDF+NPTAS+F       
Sbjct  363  AGSSPIAVSTNSNNVSSIPRSSPKPSSSAPPSDDLLNPT-ADDDFVNPTASLFTGKSNNG  421

Query  590  ---SKPKSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
               +K KSADHLP APWDA P   LPPPPA+      Y ++Q  F  +     + SY+SL
Sbjct  422  ESDTKAKSADHLPPAPWDAPPPTTLPPPPAR------YNQRQQYFEKNVFGGGSSSYDSL  475

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQTKNLSIN  +P+KQEK EDALFKDLVDF
Sbjct  476  VGQTKNLSINSSSPSKQEKPEDALFKDLVDF  506



>ref|XP_009781390.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
Length=362

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 146/204 (72%), Gaps = 18/204 (9%)
 Frame = -3

Query  905  GQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGPSGSAPTA  726
             QGRK + +KSEP+RI P LPPPPSSR PVSTDAGM+DYLSGE ++SERS G +GS+P A
Sbjct  150  AQGRKTVDVKSEPMRITPTLPPPPSSRRPVSTDAGMVDYLSGERFESERSFGTAGSSPIA  209

Query  725  VSTHSND--SIPVksnppklsssppddLINPTAADDDFLNPTASMFA---------SKPK  579
            VST+SN+  SIP  S  P  S+ P DDL+NPT ADDDF+NPTAS+F          +K K
Sbjct  210  VSTNSNNVSSIPRSSPKPSSSAPPSDDLLNPT-ADDDFVNPTASLFTGKSNNGESDTKAK  268

Query  578  SADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNL  399
            SADHLP APWDA P   LPPPPA+      Y ++Q  F  +     + SY+S+VGQTKNL
Sbjct  269  SADHLPPAPWDAPPPTTLPPPPAR------YNQRQQYFEKNVFGGGSSSYDSVVGQTKNL  322

Query  398  SINPPTPTKQEKAEDALFKDLVDF  327
            SIN  + +KQEK EDALFKDLVDF
Sbjct  323  SINSSSQSKQEKPEDALFKDLVDF  346



>ref|XP_011102017.1| PREDICTED: LOW QUALITY PROTEIN: ADP-ribosylation factor-binding 
protein GGA3 [Sesamum indicum]
Length=517

 Score =   108 bits (270),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 129/212 (61%), Gaps = 25/212 (12%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RDT QGL   RKP  +KSEPV+I PILPPPPSS  P S D+GM+DYLSG+ Y++ERSS  
Sbjct  305  RDT-QGLA--RKPAVVKSEPVQIRPILPPPPSSARPTSMDSGMVDYLSGDVYETERSSRT  361

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKP-----  582
            SGS  T V TH+ +   +    PKLS          ++  DDF+NPTASMFA KP     
Sbjct  362  SGSTNTPVPTHATNQTTIAPPSPKLS----------SSPPDDFINPTASMFAPKPTHDEP  411

Query  581  ----KSADHLPQAPWDatpagal---ppppAKfnqrqqyfeqqhqFpgspsnssagsynS  423
                KSAD LP APW+   AG L   P    +  Q  +        P   S+ S  SY+S
Sbjct  412  APSSKSADQLPPAPWEVPAAGNLPPPPSRYNQRQQFFEQQHGHGGGPSRSSSGSGSSYDS  471

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            LVGQT+NLSI PP  +KQEK EDALF+DLVDF
Sbjct  472  LVGQTQNLSIKPPAASKQEKPEDALFRDLVDF  503


 Score = 27.3 bits (59),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESEDDF  L+RRS++
Sbjct  289  DDESEDDFAQLARRSSR  305



>ref|XP_006356339.1| PREDICTED: TOM1-like protein 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356340.1| PREDICTED: TOM1-like protein 1-like isoform X2 [Solanum tuberosum]
Length=529

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 153/211 (73%), Gaps = 14/211 (7%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QGRK + +KSEP+RI P LPPPPSSR PV TD  M+DYLSG+ ++SERS G 
Sbjct  306  RDPSQG--QGRKTIDVKSEPMRITPTLPPPPSSRRPVFTDGKMVDYLSGDRFESERSLGT  363

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppdd--LINPTAADDDFLNPTASMFA------  591
             GS+P A ST+SN++  +  + PK SSS P    L+NPTA D+DFLNPTASMF       
Sbjct  364  EGSSPIAASTNSNNASSIPWSSPKPSSSAPPPDDLLNPTA-DEDFLNPTASMFTGKNNHN  422

Query  590  ---SKPKSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
               SK KSAD+LP APWDA P  ALPPPPA+++QRQQYFE+       P+ + + SY+++
Sbjct  423  ESNSKAKSADNLPPAPWDAPPPTALPPPPARYDQRQQYFEKHVSGGSPPAKTGSTSYDNI  482

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQTKNLSIN  +P+K EK EDALFKDLVDF
Sbjct  483  VGQTKNLSINSSSPSKPEKPEDALFKDLVDF  513



>ref|XP_004237704.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
 ref|XP_010320006.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
 ref|XP_010320007.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
Length=529

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 153/211 (73%), Gaps = 14/211 (7%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QGRK + +KSEP+RI P LPPPPSSR PV TD  M+DYLSG+ ++SERS G 
Sbjct  306  RDPSQG--QGRKTIDVKSEPMRITPTLPPPPSSRRPVFTDGKMVDYLSGDRFESERSMGT  363

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppdd--LINPTAADDDFLNPTASMFA------  591
             GS+P A ST+SN++  +  + PK SSS P    L+NPTA D++FLNPTASMF       
Sbjct  364  EGSSPIAASTNSNNASSIPWSSPKPSSSAPPPDDLLNPTA-DENFLNPTASMFTGKNNQN  422

Query  590  ---SKPKSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
               SK KSAD+LP APWDA P  A+PPPPA+++QRQQYFE+       P+ + + SY+S+
Sbjct  423  ESNSKAKSADNLPPAPWDAPPPTAIPPPPARYDQRQQYFEKHVSGGSPPARTGSSSYDSI  482

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQTKNLSIN  +P+K EK EDALFKDLVDF
Sbjct  483  VGQTKNLSINSSSPSKPEKPEDALFKDLVDF  513



>ref|XP_002520270.1| protein transporter, putative [Ricinus communis]
 gb|EEF42056.1| protein transporter, putative [Ricinus communis]
Length=520

 Score = 81.6 bits (200),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 138/212 (65%), Gaps = 25/212 (12%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            R+ +QG  +GRKP+ +++EP R++P+LPPPP+S+ PVS D+GMIDYLSG+ Y+S+ S   
Sbjct  307  RENAQG--RGRKPVSVRTEPGRVSPLLPPPPASKRPVSVDSGMIDYLSGDAYKSQGSPEK  364

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKP-----  582
            S   P  V  HSN +     +P   +SSPP   +N           ++ +F  +P     
Sbjct  365  SDPTPFTVPIHSNKNSSPPYSPTLSASSPPSQAVN-----------SSPLFTGQPEYDEP  413

Query  581  ----KSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqF---pgspsnssagsynS  423
                KSAD LP APWD   + +LPPPP+++NQRQQ+FEQQH F       S+ S+ SY+S
Sbjct  414  APLRKSADGLPPAPWDTPSSVSLPPPPSRYNQRQQFFEQQHGFTPGASHSSSGSSSSYDS  473

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            LVGQT+NLS+N  TPTKQ K EDALFKDLVDF
Sbjct  474  LVGQTQNLSLNSSTPTKQTKPEDALFKDLVDF  505


 Score = 24.6 bits (52),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D ESEDDF  L+ RS++
Sbjct  291  DNESEDDFTQLAHRSSR  307



>ref|XP_002285894.1| PREDICTED: target of Myb protein 1-like [Vitis vinifera]
 ref|XP_010664147.1| PREDICTED: target of Myb protein 1-like [Vitis vinifera]
Length=514

 Score = 77.8 bits (190),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 131/202 (65%), Gaps = 17/202 (8%)
 Frame = -3

Query  902  QGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGPSGSAPTAV  723
            QGRK    K EP+R++P++PPPPSS+ P S D+ MIDYLSG+ Y+S+    P  S PT  
Sbjct  305  QGRKSANAKPEPLRVSPLIPPPPSSKKPTSADSSMIDYLSGDVYKSKPERSPETSEPTPY  364

Query  722  STHSNDSIPVksnppklsssppddLINPTAADDDFLNPTAS-MFASKP---------KSA  573
            +      +P   +    S+SP    ++ ++    F+NPTAS MF + P         KSA
Sbjct  365  A------VP-SHSNSTNSTSPWTPALSSSSPPSHFINPTASPMFTAHPVYDEPAPMSKSA  417

Query  572  DHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSI  393
            D LP APWDA    ++PPPP+K+NQRQQ+FEQQH   GSP +SS  S +SLVGQT+NLSI
Sbjct  418  DPLPSAPWDAPSPNSIPPPPSKYNQRQQFFEQQHASLGSPYSSSGSSSDSLVGQTQNLSI  477

Query  392  NPPTPTKQEKAEDALFKDLVDF  327
            N  + TKQ K EDALFKDLVDF
Sbjct  478  NSSSTTKQVKQEDALFKDLVDF  499


 Score = 25.4 bits (54),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTKR  922
            D+ESEDDF  L+ RS  R
Sbjct  290  DDESEDDFAQLAHRSQGR  307



>gb|EYU32476.1| hypothetical protein MIMGU_mgv1a005006mg [Erythranthe guttata]
Length=501

 Score = 76.6 bits (187),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 103/173 (60%), Gaps = 33/173 (19%)
 Frame = -3

Query  815  STDAGMIDYLSGETYQSERSSGPSGSAPTAVSTHSNDSIPVksnppklsssppddLINPT  636
            S D+G IDYLSG+ Y ++            V++ S +SI           +     ++P+
Sbjct  338  SADSGSIDYLSGDFYGTK-----------TVNSSSKNSI-----------ASTSPTLSPS  375

Query  635  AADDDFLNPTASMFASKP---------KSADHLPQAPWDatpagalppppAKfnqrqqyf  483
             +DD F+NPTASMFA K          KS D+LP APW+      LPPPPA+ NQRQQ+F
Sbjct  376  PSDD-FVNPTASMFAPKTTNDKNTPTIKSPDNLPPAPWEVPATENLPPPPARHNQRQQFF  434

Query  482  eqqhqFpgspsnssagsynSLVGQTKNLSINPPT-PTKQEKAEDALFKDLVDF  327
            +Q    P   S+ S  SY+SLVGQT+NLSI PP  P+KQEK EDALF+DLVDF
Sbjct  435  DQHAGGPSHSSSGSGSSYDSLVGQTQNLSIKPPAAPSKQEKPEDALFRDLVDF  487


 Score = 25.0 bits (53),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E EDDF  L+RRS++
Sbjct  291  DDEPEDDFSQLARRSSR  307



>ref|XP_007201782.1| hypothetical protein PRUPE_ppa004229mg [Prunus persica]
 gb|EMJ02981.1| hypothetical protein PRUPE_ppa004229mg [Prunus persica]
Length=522

 Score = 73.9 bits (180),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 117/218 (54%), Gaps = 33/218 (15%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG GQ  +    ++EPVR++P+LPPPPS + P+ T AGMIDYLSG+TY+SE S+  
Sbjct  305  RDNSQGPGQ--RSANARTEPVRLSPLLPPPPSPKRPIPTGAGMIDYLSGDTYKSEGSTAT  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTAS-MFASKP----  582
            S S   A   HS+ +                 L  P+ +    LN T S +F+ KP    
Sbjct  363  SESTSFAAPVHSSSN-------------STSRLTPPSPSPPSSLNTTPSPIFSGKPVYDE  409

Query  581  -----KSADHLPQAPWDatp--------agalppppAKfnqrqqyfeqqhqFpgspsnss  441
                 KS D LP APWDA           G  P        R    +Q  +  G P + S
Sbjct  410  PAPRSKSIDGLPPAPWDAQSPGNPQSPGNGNSPVSLPPPPSRYNQRQQFFEQQGFPGSGS  469

Query  440  agsynSLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
              SY+SLVGQT+NLS+N  TPTKQ K EDALFKDLVDF
Sbjct  470  GSSYDSLVGQTQNLSLNSSTPTKQVKQEDALFKDLVDF  507


 Score = 23.5 bits (49),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  289  DDESEDEFAQLAHRSSR  305



>ref|XP_006434325.1| hypothetical protein CICLE_v10000887mg [Citrus clementina]
 gb|ESR47565.1| hypothetical protein CICLE_v10000887mg [Citrus clementina]
Length=516

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 131/211 (62%), Gaps = 27/211 (13%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQGLG  RKP+  ++  V +NP+LPPPPSS+ PV T +G IDYLSG+TY+S+     
Sbjct  304  RDNSQGLG--RKPISARTNLVPVNPLLPPPPSSKKPVLTSSGPIDYLSGDTYKSDAYPET  361

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASM--FASKP---  582
            S   P    THS  +                  + PT      +  +AS   F+S P   
Sbjct  362  SEPTPFVAPTHSYKT--------------SSPPLTPTRTSSIPVGNSASPPPFSSGPLYD  407

Query  581  ------KSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
                  KSA+ LP APWDA PAG+LPPPP+++NQRQQ+FEQ H FPGS +  SA SY+SL
Sbjct  408  EPPPLSKSAEQLPPAPWDAQPAGSLPPPPSRYNQRQQFFEQNHAFPGSSARGSAASYDSL  467

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NL++N P P K+EK ED LFKDLVDF
Sbjct  468  VGQTQNLALNSPNPKKEEKPEDVLFKDLVDF  498



>ref|XP_012078346.1| PREDICTED: TOM1-like protein 2 [Jatropha curcas]
 gb|KDP32899.1| hypothetical protein JCGZ_12191 [Jatropha curcas]
Length=520

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 134/213 (63%), Gaps = 23/213 (11%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            R+ SQG  QG+KP+ ++++P  + P LPPPP+S+ PVSTD+GMIDYLSG+ Y+S+ S   
Sbjct  303  RENSQG--QGKKPVSVRTQPAGVTPWLPPPPASKRPVSTDSGMIDYLSGDAYKSQGSPQR  360

Query  746  SGSAPTAVSTHSN-DSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKP----  582
                P  V  HSN +S P  S     S  PP    N           ++ +F+++P    
Sbjct  361  PEPTPFTVPVHSNTNSSPPYSPTLSASPPPPPPPSNAVN--------SSPLFSAQPAYDE  412

Query  581  -----KSADHLPQAPWDatpagalppppAKfnqrqqyfeqq--hqFpgspsnssagsynS  423
                 KSAD LP APWDA  +G+LPPPP+++NQRQQ+F+Q          S+ S+ SY+S
Sbjct  413  PTPLSKSADRLPPAPWDAPASGSLPPPPSRYNQRQQFFDQHGFASGASHSSSGSSSSYDS  472

Query  422  LVGQTKNLSINPP-TPTKQEKAEDALFKDLVDF  327
            LVGQT+NLS+N   TPTKQ K EDALFKDLVDF
Sbjct  473  LVGQTQNLSLNSSTTPTKQSKPEDALFKDLVDF  505



>ref|XP_008237773.1| PREDICTED: target of Myb protein 1 [Prunus mume]
Length=522

 Score = 72.0 bits (175),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 113/208 (54%), Gaps = 13/208 (6%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG GQ  +    ++EPVR +P+LPPPPS + P+ T AGMIDYLSG+TY+SE S+  
Sbjct  305  RDNSQGPGQ--RSANARTEPVRPSPLLPPPPSPKRPIPTGAGMIDYLSGDTYKSEGSTAT  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S S   A   HS+ +    ++     S  P   +N T +      P     A + KS D 
Sbjct  363  SESTSFAAPVHSSSN---STSRLTPLSPSPPSSLNTTPSPIFSGKPVYDEPAPRSKSIDG  419

Query  566  LPQAPWDatp--------agalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQ  411
            LP APWDA           G  P        R    +Q  +  G P   S  SY+SLVGQ
Sbjct  420  LPPAPWDAQSPGNPQSPGNGNSPVSLPPPPSRYNQRQQFFEQQGFPGGGSGSSYDSLVGQ  479

Query  410  TKNLSINPPTPTKQEKAEDALFKDLVDF  327
            T+NLS+N  TPTKQ K EDALFKDLVDF
Sbjct  480  TQNLSLNSSTPTKQVKQEDALFKDLVDF  507


 Score = 23.5 bits (49),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  289  DDESEDEFAQLAHRSSR  305



>gb|KDO83505.1| hypothetical protein CISIN_1g0101502mg, partial [Citrus sinensis]
 gb|KDO83506.1| hypothetical protein CISIN_1g0101502mg, partial [Citrus sinensis]
 gb|KDO83507.1| hypothetical protein CISIN_1g0101502mg, partial [Citrus sinensis]
Length=306

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 129/211 (61%), Gaps = 27/211 (13%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQGLG  RKP+  ++  V +NP+LPPPPSS+ PV T +G IDYLSG+TY+SE     
Sbjct  94   RDNSQGLG--RKPISARTNLVPVNPLLPPPPSSKKPVLTSSGPIDYLSGDTYKSEAYPET  151

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASM--FASKP---  582
                P    THS  +                  + PT      +  +AS   F+S P   
Sbjct  152  PEPTPFVAPTHSYKT--------------SSPPLTPTRTSSIPVGNSASPPPFSSGPLYD  197

Query  581  ------KSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
                  KSA+ LP APWDA PAG+LPPPP+++NQRQQ+FEQ H FPGS +  SA SY+SL
Sbjct  198  EPPPLSKSAEQLPPAPWDAQPAGSLPPPPSRYNQRQQFFEQNHAFPGSSARGSAASYDSL  257

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NL++N   P K+EK ED LFKDLVDF
Sbjct  258  VGQTQNLALNSSNPKKEEKPEDVLFKDLVDF  288



>gb|KHG12036.1| Target of Myb 1 [Gossypium arboreum]
Length=508

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 110/202 (54%), Gaps = 18/202 (9%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG G+ R P   KSE  R++P LPPPP S++ V+T++GM+DYLSG+TY+SE S  P
Sbjct  307  RDNSQGHGR-RAP---KSETGRVDPFLPPPPPSKSLVATNSGMVDYLSGDTYKSENS--P  360

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
                P A S  +  S P   +    S        +P  +     +  AS+  SK   ++ 
Sbjct  361  ETREPAAHSVRTRTSSPPYPSGDSGS--------SPMLSGQPIYDKPASL--SKSADSEL  410

Query  566  LPQAPWDatpagalp--pppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSI  393
            LP APWD       P      +  Q  +          + SN S  SY+ LVGQT+NLS+
Sbjct  411  LPPAPWDTAAGNLPPPPSKFNQRQQFFEQQHGYPGGSSNSSNGSGSSYDGLVGQTQNLSL  470

Query  392  NPPTPTKQEKAEDALFKDLVDF  327
            N  TPTKQEK EDALFKDLVDF
Sbjct  471  NSTTPTKQEKPEDALFKDLVDF  492



>gb|KJB59348.1| hypothetical protein B456_009G250700 [Gossypium raimondii]
 gb|KJB59349.1| hypothetical protein B456_009G250700 [Gossypium raimondii]
Length=507

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 113/201 (56%), Gaps = 17/201 (8%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QGR+    KSEP R++P LPPPPSS++PV+T+AGM+DYLSG+TY+SE S  P
Sbjct  307  RDNSQG--QGRR--APKSEPGRVDPFLPPPPSSKSPVATNAGMVDYLSGDTYKSENS--P  360

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
                P A S  +  S P   +    S        +P  +     +  AS+  SK   ++ 
Sbjct  361  ETREPAAHSVRTRTSSPPYPSGDSGS--------SPMLSGQPIYDKPASL--SKSADSEL  410

Query  566  LPQAPWDatpagalpp-ppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSIN  390
            LP APWD       PP       Q+            + SN S  SY+ LVGQT+NLS+N
Sbjct  411  LPPAPWDNAAGNLPPPPSKFNQRQQFFEQHDYPGGSSNSSNGSGSSYDGLVGQTQNLSLN  470

Query  389  PPTPTKQEKAEDALFKDLVDF  327
              TPTKQEK EDALFKDLVDF
Sbjct  471  STTPTKQEKPEDALFKDLVDF  491



>ref|XP_009342857.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=520

 Score = 70.5 bits (171),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 110/208 (53%), Gaps = 15/208 (7%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QG++    K+E V+++P+LPPP SS+ P++   G+IDYLSGE Y+SE SS  
Sbjct  305  RDNSQG--QGQRSANAKAETVQVSPLLPPPLSSQRPITLGPGVIDYLSGEAYKSEGSSAT  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S S   A   HS+ +  +    P   SS      N T +      P     A + KS D 
Sbjct  363  SQSTSFAAPVHSSSTSRLTPLSPSPPSSQ-----NTTPSPIFTGKPVYDEPAPRSKSIDG  417

Query  566  LPQAPWDatp--------agalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQ  411
            LP APWD            G  P        R    +Q  +    P + S  SY++LVGQ
Sbjct  418  LPPAPWDTQSLGNPQSPGKGHSPVSLPPPPSRYNQRQQFFEKQSVPGSGSGSSYDNLVGQ  477

Query  410  TKNLSINPPTPTKQEKAEDALFKDLVDF  327
            T+NLS+N  TPTKQ K EDALFKDLVDF
Sbjct  478  TQNLSLNSSTPTKQVKQEDALFKDLVDF  505


 Score = 22.3 bits (46),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  289  DDESEDEFSQLAHRSSR  305



>ref|XP_002300956.1| VHS domain-containing family protein [Populus trichocarpa]
 gb|EEE80229.1| VHS domain-containing family protein [Populus trichocarpa]
Length=520

 Score = 67.8 bits (164),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 111/205 (54%), Gaps = 11/205 (5%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQGLGQ  KP+ ++++P  ++P LPPPP S+NPV+ + GMIDYLSG+ Y+SE S   
Sbjct  306  RDNSQGLGQ--KPVSVRTQPGPVSPFLPPPPLSKNPVNKETGMIDYLSGDVYKSEGSPQI  363

Query  746  SGSAPTAVSTHSN--DSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSA  573
            S   P  V  HSN   S P        S        +P        +  A +     +S 
Sbjct  364  SEPTPFKVPMHSNVSSSPPYSPTVSASSPPSSAVNSSPVLTGHPVFDEPAPL----SQSG  419

Query  572  DHLPQAPWDatpagal---ppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKN  402
            + LP APWDA PAG+L   P    +  Q  ++           S+ S  SY+SL  QT+N
Sbjct  420  ERLPPAPWDAQPAGSLPPPPSRYNQRQQFFEHNIGVVGGASHSSSGSGSSYDSLAVQTQN  479

Query  401  LSINPPTPTKQEKAEDALFKDLVDF  327
            LS+N  TP KQ K EDALFKDLVDF
Sbjct  480  LSLNSSTPPKQAKPEDALFKDLVDF  504


 Score = 25.0 bits (53),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESEDDF  L+ RS++
Sbjct  290  DDESEDDFTQLAHRSSR  306



>ref|XP_006472885.1| PREDICTED: target of Myb protein 1-like isoform X1 [Citrus sinensis]
 ref|XP_006472886.1| PREDICTED: target of Myb protein 1-like isoform X2 [Citrus sinensis]
Length=516

 Score = 70.9 bits (172),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 129/211 (61%), Gaps = 27/211 (13%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQGLG  RKP+  ++  V +NP+LPPPPSS+ PV T +G IDYLSG+TY+SE     
Sbjct  304  RDNSQGLG--RKPISARTNLVPVNPLLPPPPSSKKPVLTSSGPIDYLSGDTYKSEAYPET  361

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASM--FASKP---  582
                P    THS  +                  + PT      +  +AS   F+S P   
Sbjct  362  PEPTPFVAPTHSYKT--------------SSPPLTPTRTSSIPVGNSASPPPFSSGPLYD  407

Query  581  ------KSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
                  KSA+ LP APWDA PAG+LPPPP+++NQRQQ+FEQ H FPGS +  SA SY+SL
Sbjct  408  EPPPLSKSAEQLPPAPWDAQPAGSLPPPPSRYNQRQQFFEQNHAFPGSSARGSAASYDSL  467

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NL++N   P K+EK ED LFKDLVDF
Sbjct  468  VGQTQNLALNSSNPKKEEKPEDVLFKDLVDF  498



>ref|XP_009360664.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=520

 Score = 69.7 bits (169),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QG++    K+EPV+++P+LPPP SS+ P++   G+IDYLSGE Y+SE SS  
Sbjct  305  RDNSQG--QGQRSANAKAEPVQVSPLLPPPLSSQRPITLGPGVIDYLSGEAYKSEGSSAT  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S S   A   HS+ +  +    P   SS      N T +      P     A + KS D 
Sbjct  363  SQSTSFAAPVHSSSTSRLTPLSPSPPSSQ-----NTTPSPIFTGKPVYDEPAPRSKSIDG  417

Query  566  LPQAPWDatp--------agalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQ  411
            LP APWD            G  P        R    +Q  +    P + S  SY++LVGQ
Sbjct  418  LPPAPWDTQSLGNPQSPGKGHSPVSLPPPPSRYNQRQQFFEKQSVPGSGSGSSYDNLVGQ  477

Query  410  TKNLSINPPTPTKQEKAEDALFKDLVDF  327
            T+NLS+N  TPTKQ K EDALFKDLVDF
Sbjct  478  TQNLSLNSSTPTKQVKQEDALFKDLVDF  505


 Score = 22.3 bits (46),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  289  DDESEDEFSQLAHRSSR  305



>ref|XP_011006301.1| PREDICTED: target of Myb protein 1-like [Populus euphratica]
Length=517

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 119/204 (58%), Gaps = 12/204 (6%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQGL   RKP+ ++++P R++P +PPPPSS+  VS D+GMIDYLSG+ Y+SE    P
Sbjct  306  RDNSQGLN--RKPVSVRTQPGRVSPFIPPPPSSKKSVSADSGMIDYLSGDLYKSE--GPP  361

Query  746  SGSAPTAVST-HSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSAD  570
              S PT++   +   S P     P  S        +P        +  A +     +S D
Sbjct  362  QTSEPTSLKVPNVGSSPPYSPTLPASSPPSNAMNSSPVLTGLPMYDEPAPL----SQSGD  417

Query  569  HLPQAPWDatpagalppppAKfnqrqq---yfeqqhqFpgspsnssagsynSLVGQTKNL  399
             LP APWD    G LPPPP+++NQRQQ             + S+ S  SY+SLVGQT++L
Sbjct  418  RLPPAPWDVQSPGFLPPPPSRYNQRQQFFGQHHNVPGSASNSSSGSGSSYDSLVGQTQSL  477

Query  398  SINPPTPTKQEKAEDALFKDLVDF  327
            S+NP TP KQ + EDALFKDLVDF
Sbjct  478  SLNPSTPPKQARKEDALFKDLVDF  501



>ref|XP_011027423.1| PREDICTED: target of Myb protein 1 [Populus euphratica]
Length=520

 Score = 65.1 bits (157),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 114/203 (56%), Gaps = 7/203 (3%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQGLGQ  KP+ +++ P  ++P LPPPP S+NP++ + G IDYLSG+ Y+SE S   
Sbjct  306  RDNSQGLGQ--KPVSVRTHPGPVSPFLPPPPLSKNPINKETGTIDYLSGDVYKSEGSPRI  363

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S   P  V  HSN S     +P   +SSPP   +N +       +P     A   +S D 
Sbjct  364  SEPTPFKVPMHSNVSSSPAYSPTVSASSPPSSAVNSSPVLTG--HPVFDEPAPLSQSGDQ  421

Query  566  LPQAPWDatpagal---ppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLS  396
            LP APWDA P G+L   P    +  Q  +            S+ S+ SY+SL  QT+NLS
Sbjct  422  LPPAPWDAQPTGSLPPPPSRYNQRQQFFEQNIGGVGGASHSSSGSSSSYDSLAVQTQNLS  481

Query  395  INPPTPTKQEKAEDALFKDLVDF  327
            +N  TP KQ K EDALFKDLVDF
Sbjct  482  LNSSTPPKQAKPEDALFKDLVDF  504


 Score = 25.0 bits (53),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESEDDF  L+ RS++
Sbjct  290  DDESEDDFTQLAHRSSR  306



>ref|XP_010112024.1| TOM1-like protein 2 [Morus notabilis]
 gb|EXC32443.1| TOM1-like protein 2 [Morus notabilis]
Length=513

 Score = 67.4 bits (163),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 128/196 (65%), Gaps = 11/196 (6%)
 Frame = -3

Query  905  GQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQS---ERSSGPSGSA  735
            G G+KP   ++EPVR +P++PPPPSS+ PV+TDAG++DYLSG+ Y+S   E S   S   
Sbjct  309  GHGQKPANSRTEPVRASPLIPPPPSSKRPVATDAGLVDYLSGDNYKSGFDETSEHTSYVT  368

Query  734  PTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADHLPQA  555
            P   ST +  S       P LSSSPP + +N T+       P     A   +SA+HLP A
Sbjct  369  PPVHSTGNTSS-----LSPTLSSSPPSNTVNSTSLPLYTGKPVYDEPAPTSRSAEHLPPA  423

Query  554  PWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINPPTPT  375
            PW++  +G+LPPPP+++NQRQQ+FEQ  +   S S+SS  S   LVGQT+NLS+N   PT
Sbjct  424  PWESQSSGSLPPPPSRYNQRQQFFEQHTEHSSSGSSSSYDS---LVGQTRNLSLNSSAPT  480

Query  374  KQEKAEDALFKDLVDF  327
            KQ+K ED LFKDLVDF
Sbjct  481  KQDKPEDVLFKDLVDF  496


 Score = 21.9 bits (45),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E ED+F  L+ RS++
Sbjct  288  DDEPEDEFAQLAHRSSR  304



>ref|XP_003523415.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Glycine max]
 ref|XP_006578948.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Glycine max]
 gb|KHN44282.1| TOM1-like protein 2 [Glycine soja]
Length=514

 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 11/163 (7%)
 Frame = -3

Query  803  GMIDYLSGETYQSERSSGPSGSAPTAVST--HS--NDSIPVksnppklsssppddLINPT  636
            GM+DYLSG+TY++E S  P  S PT+ +   HS  N +     +             +P 
Sbjct  344  GMVDYLSGDTYKTEGS--PENSEPTSFTAPLHSSPNPTSSTIPSLSSSHPHAVSTTSSPI  401

Query  635  AADDDFLNPTASMFASKPKSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgs  456
             + +   +   S   S+ KS++ LP APWDA   G +PPPP+K+NQRQQ+FEQQ     S
Sbjct  402  FSSEPVYDEQPS---SEDKSSECLPAAPWDAQSPGIIPPPPSKYNQRQQFFEQQGVSHSS  458

Query  455  psnssagsynSLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
              +SS+     LVGQT+NLS+N  TPTKQ+K EDALFKDLVDF
Sbjct  459  SGSSSSYDS--LVGQTQNLSLNSSTPTKQQKPEDALFKDLVDF  499



>ref|XP_010260421.1| PREDICTED: target of Myb protein 1 [Nelumbo nucifera]
Length=530

 Score = 63.2 bits (152),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 119/212 (56%), Gaps = 23/212 (11%)
 Frame = -3

Query  911  GLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGPSGSAP  732
            GLGQ RK    K++ + ++P+LPPPP S+NPV+ DAG++DYLSG+ Y+SER   P  + P
Sbjct  309  GLGQARKSANAKNDQIAVSPLLPPPPPSKNPVNADAGIVDYLSGDVYRSERPELPERTPP  368

Query  731  TAVSTHSNDS------IPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSAD  570
             AV  HS+++      +P        + +      +       +  P  SM     KS +
Sbjct  369  -AVPLHSDNTNSTSPLMPTYPFSSPQTQAKELTSSSVFTGQPKYDEPVQSM-----KSTE  422

Query  569  HLPQAPWDatpagalppppAKfnqrqqyfeqqhqFp---gspsnssagsynSLVGQTKNL  399
              P APWD  P   LPPPP+K+NQRQQ+FEQQ        + S  S  S ++LVGQT+NL
Sbjct  423  QFPSAPWDIQPPSTLPPPPSKYNQRQQFFEQQQALSGGPSNASGGSGLSCDALVGQTQNL  482

Query  398  SI--------NPPTPTKQEKAEDALFKDLVDF  327
            S+        +    TKQ K EDALFKDLVDF
Sbjct  483  SLSQGKTDTQDSSISTKQVKPEDALFKDLVDF  514


 Score = 25.0 bits (53),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESEDDF  L+ RS++
Sbjct  290  DDESEDDFAQLAHRSSR  306



>ref|XP_010270344.1| PREDICTED: TOM1-like protein 2 isoform X2 [Nelumbo nucifera]
 ref|XP_010270345.1| PREDICTED: TOM1-like protein 2 isoform X2 [Nelumbo nucifera]
Length=529

 Score = 62.4 bits (150),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 124/214 (58%), Gaps = 31/214 (14%)
 Frame = -3

Query  908  LGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSG-PSGSAP  732
            L Q R P+  K + + ++P+LPPPPSS+ PVS DAGMIDYLSG+ Y S+R+S  P  ++P
Sbjct  310  LTQARMPVDAKKDQMPVSPLLPPPPSSKKPVSADAGMIDYLSGDVYGSQRASELPEKTSP  369

Query  731  TAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKP---------K  579
               + HSN + P   + P  S S     +  +         ++S+F  +P         K
Sbjct  370  ---AVHSNYTNPTSPSVPTYSFSSIPSQVKEST--------SSSIFTEQPKYDEPVRSSK  418

Query  578  SADHLPQ-APWDatpagalppppAKfnqrqqyfeqqhqF-pgspsnssagsynSLVGQTK  405
            SA+HLP  APWD   +  LPPPP+K+NQRQQ+FEQ       + S  S  SY+ L GQT+
Sbjct  419  SAEHLPSLAPWDIQSSSYLPPPPSKYNQRQQFFEQTLTNGASNASGGSGFSYDGLAGQTQ  478

Query  404  NLSI--------NPPTPTKQEKAEDALFKDLVDF  327
            NLS+        +P   TKQ K EDALFKDLVDF
Sbjct  479  NLSLSQGKTNIRDPLIETKQVKPEDALFKDLVDF  512


 Score = 25.0 bits (53),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESEDDF  L+ RS++
Sbjct  290  DDESEDDFTQLAHRSSR  306



>ref|XP_010270342.1| PREDICTED: probable ADP-ribosylation factor-binding protein C25H2.16c 
isoform X1 [Nelumbo nucifera]
Length=551

 Score = 62.4 bits (150),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 124/214 (58%), Gaps = 31/214 (14%)
 Frame = -3

Query  908  LGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSG-PSGSAP  732
            L Q R P+  K + + ++P+LPPPPSS+ PVS DAGMIDYLSG+ Y S+R+S  P  ++P
Sbjct  332  LTQARMPVDAKKDQMPVSPLLPPPPSSKKPVSADAGMIDYLSGDVYGSQRASELPEKTSP  391

Query  731  TAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKP---------K  579
               + HSN + P   + P  S S     +  +         ++S+F  +P         K
Sbjct  392  ---AVHSNYTNPTSPSVPTYSFSSIPSQVKEST--------SSSIFTEQPKYDEPVRSSK  440

Query  578  SADHLPQ-APWDatpagalppppAKfnqrqqyfeqqhqF-pgspsnssagsynSLVGQTK  405
            SA+HLP  APWD   +  LPPPP+K+NQRQQ+FEQ       + S  S  SY+ L GQT+
Sbjct  441  SAEHLPSLAPWDIQSSSYLPPPPSKYNQRQQFFEQTLTNGASNASGGSGFSYDGLAGQTQ  500

Query  404  NLSI--------NPPTPTKQEKAEDALFKDLVDF  327
            NLS+        +P   TKQ K EDALFKDLVDF
Sbjct  501  NLSLSQGKTNIRDPLIETKQVKPEDALFKDLVDF  534


 Score = 25.0 bits (53),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESEDDF  L+ RS++
Sbjct  312  DDESEDDFTQLAHRSSR  328



>ref|XP_003526661.1| PREDICTED: TOM1-like protein 2-like [Glycine max]
Length=512

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 105/171 (61%), Gaps = 28/171 (16%)
 Frame = -3

Query  803  GMIDYLSGETYQSERSSGPSGSAPTAVST--HSNDSIPVksnppklsssppddLINPTAA  630
            GM+DYLSG+TY++E S  P  S PT+++   HS+ +       P  S+ P      P A 
Sbjct  343  GMVDYLSGDTYKTEGS--PENSEPTSIAAPLHSSPN-------PTSSTIPSLSSSRPHA-  392

Query  629  DDDFLNPTASMFASKP----------KSADHLPQAPWDatpagalppppAKfnqrqqyfe  480
                ++ ++ + +S+P          KS++ LP APWDA   G +PPPP+K+NQRQQ+FE
Sbjct  393  ----MSTSSPILSSQPVYDEQPSSVDKSSEGLPAAPWDAQSPGIIPPPPSKYNQRQQFFE  448

Query  479  qqhqFpgspsnssagsynSLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            QQ     S  ++S+     LVGQT+NLS+N  +PTKQ+K EDALFKDLVDF
Sbjct  449  QQGASHSSSGSNSSSDS--LVGQTQNLSLNSSSPTKQQKPEDALFKDLVDF  497



>ref|XP_009366814.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=523

 Score = 62.4 bits (150),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 119/211 (56%), Gaps = 18/211 (9%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QGR+    K+EPVR++P+LPPPPSS+ P++   G+IDYLSGE Y+SE SS  
Sbjct  305  RDNSQG--QGRRSANAKAEPVRVSPLLPPPPSSQRPITLGPGLIDYLSGEAYKSEGSSAA  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S S   AV  HS+ +  +    P   SS      N T +      P     A + KS D 
Sbjct  363  SESTSFAVPVHSSATSRLAPLSPSPPSSQ-----NTTPSPVFVGKPVYDEPAPRSKSIDG  417

Query  566  LPQAPWDatp-----------agalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
            LP APWD              +    PPP     ++Q F +Q   PGS S SS  SY++L
Sbjct  418  LPPAPWDTQSLGNPQSPGNGHSPVSLPPPPSRYNQRQQFFEQQNVPGSGSGSSGASYDNL  477

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NLS+N   PTKQ K EDALFKDLVDF
Sbjct  478  VGQTQNLSLNSSNPTKQVKKEDALFKDLVDF  508


 Score = 22.3 bits (46),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  289  DDESEDEFSQLAHRSSR  305



>gb|AFK38881.1| unknown [Lotus japonicus]
Length=293

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 113/211 (54%), Gaps = 42/211 (20%)
 Frame = -3

Query  929  PRDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSG  750
            PR +     Q RKP   ++E  R+N   PPPP+SR PV +  G +DYLSG+ Y++E S  
Sbjct  100  PRSSRDTNAQNRKPAYDEAESGRVNSFSPPPPASRKPVYSGTGAVDYLSGDAYKAEGSR-  158

Query  749  PSGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKP----  582
               S PT+++      +P+                      D  LNPTAS+  +K     
Sbjct  159  -ENSEPTSLA------VPL----------------------DSSLNPTASLIFNKQPVYD  189

Query  581  ------KSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
                  K ++HLP APWD      +PPPP+K NQRQQ+FEQ   F  S  +SS+     L
Sbjct  190  EPFPMNKFSEHLPPAPWDTPSPVVIPPPPSKHNQRQQFFEQHGGFHFSNGSSSSSDG--L  247

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NL +N  TP KQ+K EDALFKD VDF
Sbjct  248  VGQTQNLFLNSSTPPKQQKPEDALFKDFVDF  278



>gb|KHN46964.1| TOM1-like protein 2 [Glycine soja]
Length=512

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 102/177 (58%), Gaps = 40/177 (23%)
 Frame = -3

Query  803  GMIDYLSGETYQSERSSGPSGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADD  624
            GM+DYLSG+TY++E S  P  S PT+ +   + S P                 NPT++  
Sbjct  343  GMVDYLSGDTYKTEGS--PENSEPTSFAAPLH-SCP-----------------NPTSSTI  382

Query  623  DF--------LNPTASMFASKP----------KSADHLPQAPWDatpagalppppAKfnq  498
                      ++ ++ + +S+P          KS++ LP APWDA   G +PPPP+K+NQ
Sbjct  383  PSLSSSRPHAMSTSSPILSSQPVYDEQPSSVDKSSEGLPAAPWDAQSPGIIPPPPSKYNQ  442

Query  497  rqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            RQQ+FEQQ     S  ++S+     LVGQT+NLS+N  +PTKQ+K EDALFKDLVDF
Sbjct  443  RQQFFEQQGASHSSSGSNSSSDS--LVGQTQNLSLNSSSPTKQQKPEDALFKDLVDF  497



>ref|XP_008373307.1| PREDICTED: uncharacterized protein LOC103436643 [Malus domestica]
Length=388

 Score = 61.2 bits (147),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 120/211 (57%), Gaps = 18/211 (9%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QG++    K+EPVR++P+LPPPPSS+ P++   G+IDYLSGE Y+SE SS  
Sbjct  170  RDNSQG--QGQRSANAKAEPVRVSPLLPPPPSSQRPITLGPGLIDYLSGEAYKSEGSSAA  227

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S S   AV  HS+ +  +    P   SS      N T +      P     A + KS D 
Sbjct  228  SESTSFAVPVHSSSTSRLAPLSPSPPSSQ-----NTTPSPIFTGKPVYDEPAPRSKSIDG  282

Query  566  LPQAPWDat-----------pagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
            LP APWD              +    PPP     ++Q F +Q   PGS S SS  SY++L
Sbjct  283  LPPAPWDTQXLGNPRSPGNDHSPVSLPPPPSRYNQRQQFFEQQNVPGSGSGSSGASYDNL  342

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NLS+N  TPTKQ K EDALFKDLVDF
Sbjct  343  VGQTQNLSLNSSTPTKQVKKEDALFKDLVDF  373


 Score = 22.3 bits (46),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  154  DDESEDEFSQLAHRSSR  170



>ref|XP_008338481.1| PREDICTED: protein transport protein Sec31A-like, partial [Malus 
domestica]
Length=340

 Score = 60.8 bits (146),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 120/211 (57%), Gaps = 18/211 (9%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QG++    K+EPVR++P+LPPPPSS+ P++   G+IDYLSGE Y+SE SS  
Sbjct  122  RDNSQG--QGQRSANAKAEPVRVSPLLPPPPSSQRPITLGPGLIDYLSGEAYKSEGSSAA  179

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S S   AV  HS+ +  +    P   SS      N T +      P     A + KS D 
Sbjct  180  SESTSFAVPVHSSSTSRLAPLSPSPPSSQ-----NTTPSPIFTGKPVYDEPAPRSKSIDG  234

Query  566  LPQAPWDat-----------pagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
            LP APWD              +    PPP     ++Q F +Q   PGS S SS  SY++L
Sbjct  235  LPPAPWDTQXLGNPRSPGNDHSPVSLPPPPSRYNQRQQFFEQQNVPGSGSGSSGASYDNL  294

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NLS+N  TPTKQ K EDALFKDLVDF
Sbjct  295  VGQTQNLSLNSSTPTKQVKKEDALFKDLVDF  325


 Score = 22.3 bits (46),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  106  DDESEDEFSQLAHRSSR  122



>ref|XP_007137502.1| hypothetical protein PHAVU_009G132300g [Phaseolus vulgaris]
 gb|ESW09496.1| hypothetical protein PHAVU_009G132300g [Phaseolus vulgaris]
Length=505

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 125/209 (60%), Gaps = 31/209 (15%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            R +     Q RKP+  K+EP RINP++PPPP+S+ PV +  G++DYLSG+TY++E S   
Sbjct  303  RSSRDSHAQNRKPVYDKAEPGRINPVIPPPPASKKPVYSGTGVVDYLSGDTYKTEGSPQN  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADD----DFLNPTASMFASKPK  579
            S     A   HS+                     NPT++        ++ +A +F+S+P 
Sbjct  363  SERTSFAAPVHSSP--------------------NPTSSVSSSRPHAVSTSAPIFSSQPV  402

Query  578  -----SADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVG  414
                 S++ LPQAP D   +G +PPPP+K+NQRQQ+FEQQ     S  ++S+     LVG
Sbjct  403  YDEQPSSERLPQAPLDTQSSGIIPPPPSKYNQRQQFFEQQGASHSSSGSNSSYDS--LVG  460

Query  413  QTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            QT+NLS+N  TPTK++K EDALFKDLVDF
Sbjct  461  QTQNLSLNSSTPTKEQKPEDALFKDLVDF  489



>ref|XP_009346369.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346370.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346371.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346375.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346376.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
 ref|XP_009346377.1| PREDICTED: target of Myb protein 1-like [Pyrus x bretschneideri]
Length=523

 Score = 60.8 bits (146),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 119/211 (56%), Gaps = 18/211 (9%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QG++    K+EPVR++P+LPPPPSS+ P++   G+IDYLSGE Y+SE SS  
Sbjct  305  RDNSQG--QGQRSANAKAEPVRVSPLLPPPPSSQRPITLGPGLIDYLSGEAYKSEGSSAA  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADH  567
            S S   AV  HS+ +  +    P   SS      N T +      P     A + KS D 
Sbjct  363  SESTSFAVPVHSSSTSRLAPLSPSPPSSQ-----NTTPSPVFVGKPVYDEPAPRSKSIDG  417

Query  566  LPQAPWDatp-----------agalppppAKfnqrqqyfeqqhqFpgspsnssagsynSL  420
            LP APWD              +    PPP     ++Q F +Q   PGS S SS  SY++L
Sbjct  418  LPPAPWDTQSLGNPQSPGNGHSPVSLPPPPSRYNQRQQFFEQQNVPGSGSGSSGASYDNL  477

Query  419  VGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            VGQT+NLS+N   PTKQ K EDALFKDLVDF
Sbjct  478  VGQTQNLSLNSSNPTKQVKKEDALFKDLVDF  508


 Score = 22.3 bits (46),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  289  DDESEDEFSQLAHRSSR  305



>ref|XP_004290725.1| PREDICTED: target of Myb protein 1-like [Fragaria vesca subsp. 
vesca]
Length=526

 Score = 59.7 bits (143),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 114/219 (52%), Gaps = 32/219 (15%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QG +    K+EPVR++P+LPPPPSS+ P++   G+IDYLSGE Y+SE SS  
Sbjct  306  RDNSQG--QGPRSANSKTEPVRVSPLLPPPPSSKRPITLGPGLIDYLSGEAYKSEGSSAT  363

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLINPTAADDDFLNPTAS-MFASKP----  582
            S S   AV  H++ +           SS     ++ +       N T S +F  KP    
Sbjct  364  SESTSFAVPAHASPN-----------SSSRLTPLSSSPPSSHSQNTTPSPLFTGKPIYDE  412

Query  581  -----KSADHLPQAPWDatpagalppppAKfn---------qrqqyfeqqhqFpgspsns  444
                 KS D LP APWDA        P    +         +  Q  +   Q  G PS  
Sbjct  413  PAPRSKSIDGLPPAPWDAQAPEGSLSPGGSQSPVILPPPPSRYNQRQQFFEQQAGGPSGG  472

Query  443  sagsynSLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            S  SY++LVGQT+ LS+N  T TKQ K EDALFKDLVDF
Sbjct  473  SGSSYDNLVGQTQTLSLNSSTATKQVKQEDALFKDLVDF  511


 Score = 23.5 bits (49),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+ESED+F  L+ RS++
Sbjct  290  DDESEDEFAQLAHRSSR  306



>ref|XP_007019271.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007019272.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY16496.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY16497.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
Length=521

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 111/206 (54%), Gaps = 12/206 (6%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGP  747
            RD SQG  QGR+     +EP R+ P+LPPPPSS+ PV+ +A M+DYLSG+ Y+SE S   
Sbjct  307  RDNSQG--QGRR--APNNEPGRVGPLLPPPPSSKRPVARNASMVDYLSGDAYKSEDSPER  362

Query  746  SGSAPTAVSTHSNDSIPVksnppklsssppddLIN----PTAADDDFLNPTASMFASKPK  579
            S   P +V TH+  +   +       SSPP   ++    P  +     +   S+  SK  
Sbjct  363  SEPTPYSVPTHTYANPSPQLISTVAPSSPPSRSVDSGSLPVFSGQPIYDKPGSL--SKSA  420

Query  578  SADHLPQAPWDatpagalp--pppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTK  405
             A+ LP APWD+      P      +  Q  +            +N S  S +SLVGQT+
Sbjct  421  DAEQLPPAPWDSPTVNLPPPPSKYNQRQQFFEQQHSYTGGASHSNNGSGSSNDSLVGQTQ  480

Query  404  NLSINPPTPTKQEKAEDALFKDLVDF  327
            NLS+N  TP+KQ K EDALFKDLVDF
Sbjct  481  NLSLNSSTPSKQVKPEDALFKDLVDF  506



>ref|XP_004502554.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X3 [Cicer arietinum]
Length=425

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 120/198 (61%), Gaps = 17/198 (9%)
 Frame = -3

Query  902  QGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERSSGPSGSAPTAV  723
            Q RKP   K+EP RIN ++PPPP+S+ PV +  GM+DYLSG+ Y++E S   S     A 
Sbjct  223  QNRKPAYDKAEPARINSLIPPPPASKKPVYSGTGMVDYLSGDAYKAEGSFENSEPTSFAA  282

Query  722  STHSND-----SIPVksnppklsssppddLINPTAADDDFLNPTASMFASKPKSADHLPQ  558
              HS+      +IP +S+P   ++S    + +     DD          S PKS++ LP 
Sbjct  283  PLHSSSNPASSTIPTESSPHPNATSTSSPIFSRQPIYDD---------PSPPKSSEQLPP  333

Query  557  APWDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINPP-T  381
            APWD      +PPPP+K+NQRQQ+FEQ+     S  +SS+     LVGQT+NLS+N   T
Sbjct  334  APWDTQAPVVIPPPPSKYNQRQQFFEQKGSSHSSNGSSSSHES--LVGQTQNLSLNSSST  391

Query  380  PTKQEKAEDALFKDLVDF  327
            PTK++K EDALFKDLVDF
Sbjct  392  PTKEQKPEDALFKDLVDF  409



>ref|XP_004502552.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X1 [Cicer arietinum]
 ref|XP_004502553.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
isoform X2 [Cicer arietinum]
Length=513

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 97/165 (59%), Gaps = 17/165 (10%)
 Frame = -3

Query  803  GMIDYLSGETYQSERSSGPSGSAPTAVSTHSND-----SIPVksnppklsssppddLINP  639
            GM+DYLSG+ Y++E S   S     A   HS+      +IP +S+P   ++S    + + 
Sbjct  344  GMVDYLSGDAYKAEGSFENSEPTSFAAPLHSSSNPASSTIPTESSPHPNATSTSSPIFSR  403

Query  638  TAADDDFLNPTASMFASKPKSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpg  459
                DD          S PKS++ LP APWD      +PPPP+K+NQRQQ+FEQ+     
Sbjct  404  QPIYDD---------PSPPKSSEQLPPAPWDTQAPVVIPPPPSKYNQRQQFFEQKGSSHS  454

Query  458  spsnssagsynSLVGQTKNLSINPP-TPTKQEKAEDALFKDLVDF  327
            S  +SS+     LVGQT+NLS+N   TPTK++K EDALFKDLVDF
Sbjct  455  SNGSSSSHES--LVGQTQNLSLNSSSTPTKEQKPEDALFKDLVDF  497



>ref|XP_004139800.1| PREDICTED: TOM1-like protein 2 [Cucumis sativus]
 ref|XP_011658998.1| PREDICTED: TOM1-like protein 2 [Cucumis sativus]
 gb|KGN44196.1| hypothetical protein Csa_7G219810 [Cucumis sativus]
Length=490

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            LVG T+NLS++PPTPTKQEK ED LFKDLVDF
Sbjct  444  LVGHTQNLSLSPPTPTKQEKQEDVLFKDLVDF  475



>ref|XP_002307466.1| VHS domain-containing family protein [Populus trichocarpa]
 gb|EEE94462.1| VHS domain-containing family protein [Populus trichocarpa]
Length=493

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 96/166 (58%), Gaps = 8/166 (5%)
 Frame = -3

Query  815  STDAGMIDYLSGETYQSERSSGPSGSAPTAVSTHSNDSIPVksnppklsssppddLINPT  636
            S D+GMIDYLSG+ Y+SE    P  S PT++    N S     +P   +SSPP + +N +
Sbjct  317  SADSGMIDYLSGDLYKSE--GPPQTSEPTSLKV-PNVSFSPPYSPTLPASSPPANAMNSS  373

Query  635  AADDDFLNPTASMFASKPKSADHLPQAPWDatpagalppppAKfnqrqq---yfeqqhqF  465
                    P     A   +S D LP APWD    G LPPPP+++NQRQQ           
Sbjct  374  PVLTGL--PVYDEPAPLSQSGDRLPPAPWDVQSPGFLPPPPSRYNQRQQFFGQHHSVPGG  431

Query  464  pgspsnssagsynSLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
              + S+ S  SY+SLVGQT++LS+NP TP KQ + EDALFKDLVDF
Sbjct  432  ASNSSSGSGSSYDSLVGQTQSLSLNPSTPPKQARKEDALFKDLVDF  477



>ref|XP_002450494.1| hypothetical protein SORBIDRAFT_05g006160 [Sorghum bicolor]
 gb|EES09482.1| hypothetical protein SORBIDRAFT_05g006160 [Sorghum bicolor]
Length=582

 Score = 52.8 bits (125),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 99/203 (49%), Gaps = 43/203 (21%)
 Frame = -3

Query  812  TDAGMIDYLSGETYQSERSS----GPSGSAPTAVSTHSNDSIPVksnppklsssppddLI  645
            ++A  IDYLSG++Y+SE+       P+  +  + S+HS   +    +      S  DD I
Sbjct  364  SEASSIDYLSGDSYKSEKVPDDFINPTAPSNISTSSHSKPEVYPPPSYGSRPDSVSDDFI  423

Query  644  NPTA-------------------------ADDDFLNPTA----SMFASKPKSADHLPQAP  552
            NPTA                          DDDF+NPTA    S  ++  +S++ LP+AP
Sbjct  424  NPTAPSFSAPSRPTNEEPTHSSVKRQESLPDDDFINPTALPGFSSSSASKESSEDLPKAP  483

Query  551  WDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINP-----  387
            W++  A A   PP     R    +Q  +       S+ G Y+ L+ QT+NLS+NP     
Sbjct  484  WESQAAAAGSLPP--PPARYGQRQQYFEQNVYSGGSNGGGYDGLMTQTENLSLNPRSSES  541

Query  386  ---PTPTKQEKAEDALFKDLVDF  327
               PT ++Q K ED+LFKDLVDF
Sbjct  542  ASRPTASRQAKPEDSLFKDLVDF  564


 Score = 23.5 bits (49),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E ED+F  LSRRS +
Sbjct  312  DDEPEDEFSVLSRRSAR  328



>gb|KEH35378.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=507

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 94/164 (57%), Gaps = 16/164 (10%)
 Frame = -3

Query  803  GMIDYLSGETYQSERSSGPSGSAPTAVSTHSN-----DSIPVksnppklsssppddLINP  639
             M+DYLSG+ Y++E S   S     A   HS+      +IP +S+    +++      +P
Sbjct  339  SMVDYLSGDAYKAEGSLENSEPTSFAAPLHSSPNPTSSAIPTESSTHPHATTTS----SP  394

Query  638  TAADDDFLNPTASMFASKPKSADHLPQAPWDatpagalppppAKfnqrqqyfeqqhqFpg  459
              +     +  + M  S+P     LP APWD      +PPPP+K+NQRQQ+FEQQ     
Sbjct  395  IYSRQPIYDEPSPMKTSEP-----LPPAPWDTQAPVVIPPPPSKYNQRQQFFEQQGSSHS  449

Query  458  spsnssagsynSLVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            S  +SS+     L+GQT+NLS+N  TPTK++K EDALFKDLVDF
Sbjct  450  SNGSSSSTDS--LLGQTQNLSLNSSTPTKEQKPEDALFKDLVDF  491



>ref|XP_006593776.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X2 [Glycine max]
 ref|XP_006593777.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X3 [Glycine max]
Length=530

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            L+ QT+NLS+N  TPTKQEK ED LFKDLVDF
Sbjct  484  LLAQTQNLSLNSSTPTKQEKTEDVLFKDLVDF  515



>ref|XP_003541937.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Glycine max]
Length=508

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            L+ QT+NLS+N  TPTKQEK ED LFKDLVDF
Sbjct  462  LLAQTQNLSLNSSTPTKQEKTEDVLFKDLVDF  493



>ref|XP_006593778.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X4 [Glycine max]
Length=498

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            L+ QT+NLS+N  TPTKQEK ED LFKDLVDF
Sbjct  452  LLAQTQNLSLNSSTPTKQEKTEDVLFKDLVDF  483



>gb|AFK39489.1| unknown [Medicago truncatula]
Length=100

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            L+GQT++LS+N  TPTK++K EDALFKDLVDF
Sbjct  53   LLGQTQSLSLNSSTPTKEQKPEDALFKDLVDF  84



>gb|EMS53515.1| TOM1-like protein 2 [Triticum urartu]
Length=603

 Score = 49.3 bits (116),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 99/199 (50%), Gaps = 40/199 (20%)
 Frame = -3

Query  812  TDAGMIDYLSGETYQSERS----SGPSGSAPTAVSTHSNDSIPVksnppklsssppddLI  645
            T+A  +DYLSG++Y+SE+       P+  A  +  +HS        N    S + PD+ I
Sbjct  390  TEASSVDYLSGDSYKSEKVPDDFVNPTAPANMSAPSHSKTETDQVPNYDSRSENVPDEFI  449

Query  644  NPTAA----------------------DDDFLNPTASMFASKPKSADHLPQAPWDatpag  531
            NPTAA                      DDDF+NPTA    S   +++ LP+APW+A    
Sbjct  450  NPTAAPSFSMPSRPMSEPSVNKLESLPDDDFINPTALPGFSSSSTSEDLPKAPWEAQAPV  509

Query  530  alppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINP-----------P  384
            +LPPPPA+     Q  +   Q  G P  ++ G Y+ ++ +T +LS+N             
Sbjct  510  SLPPPPAR---YGQRQQFFEQQHGFPGENNEGGYDEMLTRTGSLSLNQRNTENGKSASVS  566

Query  383  TPTKQEKAEDALFKDLVDF  327
            T ++Q K EDALFKDLVDF
Sbjct  567  TASRQPKPEDALFKDLVDF  585


 Score = 23.5 bits (49),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E ED+F  LSRRS +
Sbjct  338  DDEPEDEFSVLSRRSAR  354



>dbj|BAI66420.1| seed protein B32E [Triticum aestivum]
Length=576

 Score = 49.3 bits (116),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 99/199 (50%), Gaps = 40/199 (20%)
 Frame = -3

Query  812  TDAGMIDYLSGETYQSERS----SGPSGSAPTAVSTHSNDSIPVksnppklsssppddLI  645
            T+A  +DYLSG++Y+SE+       P+  A  +  +HS        N    S + PD+ I
Sbjct  363  TEASSVDYLSGDSYKSEKVPDDFVNPTAPANMSAPSHSKTETDQVPNYDSRSENVPDEFI  422

Query  644  NPTAA----------------------DDDFLNPTASMFASKPKSADHLPQAPWDatpag  531
            NPTAA                      DDDF+NPTA    S   +++ LP+APW+A    
Sbjct  423  NPTAAPSFSMPSRPMSEPSVNKLESLPDDDFINPTALPGFSSSSTSEDLPKAPWEAQAPV  482

Query  530  alppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINP-----------P  384
            +LPPPPA+     Q  +   Q  G P  ++ G Y+ ++ +T +LS+N             
Sbjct  483  SLPPPPAR---YGQRQQFFEQQHGFPGENNEGGYDEMLTRTGSLSLNQRNTENGKSASVS  539

Query  383  TPTKQEKAEDALFKDLVDF  327
            T ++Q K EDALFKDLVDF
Sbjct  540  TASRQPKPEDALFKDLVDF  558


 Score = 23.5 bits (49),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E ED+F  LSRRS +
Sbjct  311  DDEPEDEFSVLSRRSAR  327



>emb|CDP21682.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  926  RDTSQGLGQGRKPLGLKSEpvrinpilppppssrnpVSTDAGMIDYLSGETYQSERS  756
            RDTSQG GQGRKP     EP RINPILPPPP S    + D GM+DYLSG+ YQSERS
Sbjct  151  RDTSQGQGQGRKPTNANGEPSRINPILPPPPPSTKFSTPDTGMVDYLSGDAYQSERS  207



>ref|XP_010062194.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 ref|XP_010062195.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 gb|KCW69277.1| hypothetical protein EUGRSUZ_F02773 [Eucalyptus grandis]
Length=508

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            LVG T+N+S+N  TPTKQ K EDALFKDLVDF
Sbjct  459  LVGHTQNMSLNSSTPTKQAKQEDALFKDLVDF  490



>ref|XP_008447823.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
 ref|XP_008447824.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
Length=488

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = -3

Query  422  LVGQTKNLSINPPTPTKQEKAEDALFKDLVDF  327
            LVG T+NLS++P TPTKQEK ED LFKDLVDF
Sbjct  443  LVGHTQNLSLSP-TPTKQEKQEDVLFKDLVDF  473



>ref|XP_010237854.1| PREDICTED: uncharacterized protein LOC100820952 isoform X2 [Brachypodium 
distachyon]
Length=492

 Score = 45.8 bits (107),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 96/202 (48%), Gaps = 43/202 (21%)
 Frame = -3

Query  812  TDAGMIDYLSGETYQSERS----SGPSGSAPTAVSTHSNDSIPVksnppklsssppddLI  645
            T++  +DYLSG++Y+SE+       P+  A  +  ++S      + +    S S  DD I
Sbjct  276  TESSSVDYLSGDSYKSEKVPDDFVNPTAPANISAPSYSKAETNRQPSYDNRSESVSDDFI  335

Query  644  NPTAA-------------------------DDDFLNPTASMFASKPKSADHLPQAPWDat  540
            NPTA                          DDDF+NPTA    S   +++ LP+APW+A 
Sbjct  336  NPTAVHSFSMPSRPVSEPNSSSVNQHESLPDDDFINPTALPGFSSSSTSEDLPKAPWEAQ  395

Query  539  pagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSIN----------  390
               +LPPPPA+     Q  +   Q    P  ++ G Y+ L+ QT NLS+N          
Sbjct  396  APVSLPPPPAR---YGQRQQFFEQNHVFPGGNNGGGYDELLTQTGNLSLNQRNTEHEKSA  452

Query  389  -PPTPTKQEKAEDALFKDLVDF  327
               T  +Q K ED+LFKDLVDF
Sbjct  453  SASTAPRQPKPEDSLFKDLVDF  474


 Score = 25.4 bits (54),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E EDDF  LSRRS +
Sbjct  224  DDEPEDDFSVLSRRSAR  240



>gb|ACR38743.1| unknown [Zea mays]
 gb|AFW60669.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=584

 Score = 47.4 bits (111),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 91/206 (44%), Gaps = 47/206 (23%)
 Frame = -3

Query  812  TDAGMIDYLSGETYQSERSS----GPSGSAPTAVSTHSNDSIPVksnppklsssppddLI  645
            T+A  +DYLSG++Y+SE+ S     P+  A  + S+HS        +         DD I
Sbjct  364  TEASSVDYLSGDSYKSEKVSDDFINPTAPANISTSSHSKAEAHPPPSYGGRPDRVSDDFI  423

Query  644  NPTA-------------------------ADDDFLNPTA----SMFASKPKSADHLPQAP  552
            NPTA                          DDDF+NPTA    S  ++  +S + LP+AP
Sbjct  424  NPTAPSFSAPSRPTNEEPARPSVKRQESLPDDDFINPTALPGFSSSSATKESGEDLPKAP  483

Query  551  WDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINPPTPTK  372
            W+A  A    PP      R    +Q  +       S+ G YN L  QT+ LS+NP +   
Sbjct  484  WEAQAAAGSLPP---PPARYGQRQQYFEQNVYSGGSNEGGYNGLTTQTEGLSLNPRSSEN  540

Query  371  Q-----------EKAEDALFKDLVDF  327
            +            K ED+LFKDLVDF
Sbjct  541  ERSAARPAASRPAKPEDSLFKDLVDF  566


 Score = 23.5 bits (49),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E ED+F  LSRRS +
Sbjct  312  DDEPEDEFSVLSRRSAR  328



>gb|AFW60668.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=585

 Score = 47.4 bits (111),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 91/206 (44%), Gaps = 47/206 (23%)
 Frame = -3

Query  812  TDAGMIDYLSGETYQSERSS----GPSGSAPTAVSTHSNDSIPVksnppklsssppddLI  645
            T+A  +DYLSG++Y+SE+ S     P+  A  + S+HS        +         DD I
Sbjct  365  TEASSVDYLSGDSYKSEKVSDDFINPTAPANISTSSHSKAEAHPPPSYGGRPDRVSDDFI  424

Query  644  NPTA-------------------------ADDDFLNPTA----SMFASKPKSADHLPQAP  552
            NPTA                          DDDF+NPTA    S  ++  +S + LP+AP
Sbjct  425  NPTAPSFSAPSRPTNEEPARPSVKRQESLPDDDFINPTALPGFSSSSATKESGEDLPKAP  484

Query  551  WDatpagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSINPPTPTK  372
            W+A  A    PP      R    +Q  +       S+ G YN L  QT+ LS+NP +   
Sbjct  485  WEAQAAAGSLPP---PPARYGQRQQYFEQNVYSGGSNEGGYNGLTTQTEGLSLNPRSSEN  541

Query  371  Q-----------EKAEDALFKDLVDF  327
            +            K ED+LFKDLVDF
Sbjct  542  ERSAARPAASRPAKPEDSLFKDLVDF  567


 Score = 23.5 bits (49),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E ED+F  LSRRS +
Sbjct  313  DDEPEDEFSVLSRRSAR  329



>ref|XP_003577738.1| PREDICTED: TOM1-like protein 2 isoform X1 [Brachypodium distachyon]
Length=579

 Score = 45.4 bits (106),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 96/202 (48%), Gaps = 43/202 (21%)
 Frame = -3

Query  812  TDAGMIDYLSGETYQSERS----SGPSGSAPTAVSTHSNDSIPVksnppklsssppddLI  645
            T++  +DYLSG++Y+SE+       P+  A  +  ++S      + +    S S  DD I
Sbjct  363  TESSSVDYLSGDSYKSEKVPDDFVNPTAPANISAPSYSKAETNRQPSYDNRSESVSDDFI  422

Query  644  NPTAA-------------------------DDDFLNPTASMFASKPKSADHLPQAPWDat  540
            NPTA                          DDDF+NPTA    S   +++ LP+APW+A 
Sbjct  423  NPTAVHSFSMPSRPVSEPNSSSVNQHESLPDDDFINPTALPGFSSSSTSEDLPKAPWEAQ  482

Query  539  pagalppppAKfnqrqqyfeqqhqFpgspsnssagsynSLVGQTKNLSIN----------  390
               +LPPPPA+     Q  +   Q    P  ++ G Y+ L+ QT NLS+N          
Sbjct  483  APVSLPPPPAR---YGQRQQFFEQNHVFPGGNNGGGYDELLTQTGNLSLNQRNTEHEKSA  539

Query  389  -PPTPTKQEKAEDALFKDLVDF  327
               T  +Q K ED+LFKDLVDF
Sbjct  540  SASTAPRQPKPEDSLFKDLVDF  561


 Score = 25.4 bits (54),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  975  DEESEDDFVXLSRRSTK  925
            D+E EDDF  LSRRS +
Sbjct  311  DDEPEDDFSVLSRRSAR  327



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2380164130925