BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1453

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623669.1|  PREDICTED: rhodanese-like domain-containing ...    127   5e-30   Nicotiana tomentosiformis
ref|XP_010326928.1|  PREDICTED: rhodanese-like domain-containing ...    126   1e-29   Solanum lycopersicum
ref|XP_006339688.1|  PREDICTED: rhodanese-like domain-containing ...    125   2e-29   Solanum tuberosum [potatoes]
ref|XP_010055036.1|  PREDICTED: rhodanese-like domain-containing ...    125   3e-29   
gb|KHN06295.1|  Hypothetical protein glysoja_021133                     124   4e-29   Glycine soja [wild soybean]
ref|XP_003528797.1|  PREDICTED: rhodanese-like domain-containing ...    124   6e-29   Glycine max [soybeans]
gb|KDO86421.1|  hypothetical protein CISIN_1g013011mg                   122   2e-28   Citrus sinensis [apfelsine]
ref|XP_006444874.1|  hypothetical protein CICLE_v10020161mg             122   2e-28   Citrus clementina [clementine]
gb|KJB49531.1|  hypothetical protein B456_008G124200                    121   7e-28   Gossypium raimondii
ref|XP_009761641.1|  PREDICTED: rhodanese-like domain-containing ...    121   8e-28   Nicotiana sylvestris
ref|XP_007135236.1|  hypothetical protein PHAVU_010G112100g             120   1e-27   Phaseolus vulgaris [French bean]
ref|XP_010661901.1|  PREDICTED: rhodanese-like domain-containing ...    120   2e-27   Vitis vinifera
gb|KHG21564.1|  hypothetical protein F383_26582                         119   2e-27   Gossypium arboreum [tree cotton]
ref|XP_002320855.1|  hydroxyproline-rich glycoprotein                   119   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010261520.1|  PREDICTED: rhodanese-like domain-containing ...    117   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_012083235.1|  PREDICTED: rhodanese-like domain-containing ...    116   3e-26   Jatropha curcas
ref|XP_008437912.1|  PREDICTED: rhodanese-like domain-containing ...    116   4e-26   Cucumis melo [Oriental melon]
ref|XP_003548475.1|  PREDICTED: rhodanese-like domain-containing ...    115   8e-26   Glycine max [soybeans]
ref|XP_011037916.1|  PREDICTED: rhodanese-like domain-containing ...    114   1e-25   Populus euphratica
ref|XP_011650694.1|  PREDICTED: rhodanese-like domain-containing ...    114   1e-25   Cucumis sativus [cucumbers]
ref|XP_010915675.1|  PREDICTED: rhodanese-like domain-containing ...    114   3e-25   Elaeis guineensis
ref|XP_009601089.1|  PREDICTED: rhodanese-like domain-containing ...    113   4e-25   Nicotiana tomentosiformis
ref|XP_006491251.1|  PREDICTED: rhodanese-like domain-containing ...    113   4e-25   Citrus sinensis [apfelsine]
ref|XP_011023203.1|  PREDICTED: rhodanese-like domain-containing ...    111   8e-25   Populus euphratica
ref|XP_010266472.1|  PREDICTED: rhodanese-like domain-containing ...    112   9e-25   Nelumbo nucifera [Indian lotus]
emb|CDP08699.1|  unnamed protein product                                112   1e-24   Coffea canephora [robusta coffee]
gb|KHG13147.1|  hypothetical protein F383_04098                         112   1e-24   Gossypium arboreum [tree cotton]
ref|XP_004516405.1|  PREDICTED: rhodanese-like domain-containing ...    110   5e-24   Cicer arietinum [garbanzo]
ref|XP_011468943.1|  PREDICTED: rhodanese-like domain-containing ...    110   5e-24   Fragaria vesca subsp. vesca
ref|XP_002302622.2|  hydroxyproline-rich glycoprotein                   108   7e-24   Populus trichocarpa [western balsam poplar]
gb|KJB24583.1|  hypothetical protein B456_004G152500                    109   1e-23   Gossypium raimondii
ref|XP_007135235.1|  hypothetical protein PHAVU_010G112100g             109   1e-23   Phaseolus vulgaris [French bean]
ref|XP_009789972.1|  PREDICTED: rhodanese-like domain-containing ...    109   1e-23   Nicotiana sylvestris
ref|XP_009421248.1|  PREDICTED: rhodanese-like domain-containing ...    109   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783830.1|  PREDICTED: rhodanese-like domain-containing ...    108   1e-23   Phoenix dactylifera
gb|KJB24582.1|  hypothetical protein B456_004G152500                    108   2e-23   Gossypium raimondii
emb|CBI40498.3|  unnamed protein product                                107   3e-23   Vitis vinifera
ref|XP_006847355.1|  PREDICTED: rhodanese-like domain-containing ...    107   3e-23   Amborella trichopoda
ref|XP_007051586.1|  Thylakoid rhodanese-like, putative isoform 1       107   4e-23   
ref|XP_007219299.1|  hypothetical protein PRUPE_ppa018863mg             107   4e-23   
ref|XP_002523373.1|  chitinase, putative                                108   1e-22   
gb|ACJ86240.1|  unknown                                                 103   2e-22   Medicago truncatula
gb|KEH18685.1|  thylakoid rhodanese-like protein                        103   2e-22   Medicago truncatula
ref|XP_008233203.1|  PREDICTED: rhodanese-like domain-containing ...    105   3e-22   Prunus mume [ume]
ref|XP_009134504.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...    105   4e-22   Brassica rapa
ref|XP_010095787.1|  Uncharacterized protein L484_017594                106   7e-22   
gb|KDO86422.1|  hypothetical protein CISIN_1g013011mg                   103   1e-21   Citrus sinensis [apfelsine]
gb|KHG13146.1|  hypothetical protein F383_04098                         103   1e-21   Gossypium arboreum [tree cotton]
gb|KFK30681.1|  hypothetical protein AALP_AA6G014200                    102   2e-21   Arabis alpina [alpine rockcress]
ref|XP_006396308.1|  hypothetical protein EUTSA_v10028649mg             102   3e-21   
ref|XP_006396307.1|  hypothetical protein EUTSA_v10028649mg             102   3e-21   Eutrema salsugineum [saltwater cress]
ref|XP_009111413.1|  PREDICTED: rhodanese-like domain-containing ...    102   3e-21   Brassica rapa
gb|KJB24584.1|  hypothetical protein B456_004G152500                    102   4e-21   Gossypium raimondii
ref|NP_567209.1|  thylakoid rhodanese-like protein                      102   4e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48498.1|  BnaA09g00250D                                          102   4e-21   Brassica napus [oilseed rape]
gb|EYU38901.1|  hypothetical protein MIMGU_mgv1a006323mg                101   6e-21   Erythranthe guttata [common monkey flower]
ref|XP_010534211.1|  PREDICTED: rhodanese-like domain-containing ...    100   7e-21   Tarenaya hassleriana [spider flower]
emb|CDY07169.1|  BnaCnng01840D                                          102   7e-21   
gb|ABR16588.1|  unknown                                                 101   8e-21   Picea sitchensis
ref|XP_010669158.1|  PREDICTED: rhodanese-like domain-containing ...    100   1e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006286665.1|  hypothetical protein CARUB_v10002584mg             100   3e-20   Capsella rubella
emb|CDX91872.1|  BnaC03g31740D                                          101   3e-20   
emb|CDX74366.1|  BnaA03g26810D                                        99.8    3e-20   
ref|XP_010427922.1|  PREDICTED: rhodanese-like domain-containing ...  99.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010456200.1|  PREDICTED: rhodanese-like domain-containing ...  99.8    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008350777.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...  98.2    6e-20   
ref|XP_010422759.1|  PREDICTED: rhodanese-like domain-containing ...  99.4    8e-20   
ref|NP_001131286.1|  uncharacterized protein LOC100192599             96.3    4e-19   Zea mays [maize]
ref|XP_008681054.1|  PREDICTED: uncharacterized protein LOC100192...  96.3    4e-19   Zea mays [maize]
ref|XP_006366560.1|  PREDICTED: rhodanese-like domain-containing ...  96.3    5e-19   Solanum tuberosum [potatoes]
ref|XP_007051589.1|  Thylakoid rhodanese-like, putative isoform 4     95.1    7e-19   
ref|XP_009336808.1|  PREDICTED: rhodanese-like domain-containing ...  94.7    9e-19   Pyrus x bretschneideri [bai li]
gb|EPS66030.1|  hypothetical protein M569_08743                       94.4    1e-18   Genlisea aurea
ref|XP_003572147.1|  PREDICTED: rhodanese-like domain-containing ...  95.5    1e-18   Brachypodium distachyon [annual false brome]
ref|XP_004248078.2|  PREDICTED: rhodanese-like domain-containing ...  95.1    1e-18   
ref|XP_009336810.1|  PREDICTED: rhodanese-like domain-containing ...  92.8    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_004951282.1|  PREDICTED: rhodanese-like domain-containing ...  91.3    1e-17   Setaria italica
emb|CCJ09774.1|  rhodanese homology domain protein                    89.4    2e-17   Hirudo medicinalis
ref|XP_006648515.1|  PREDICTED: rhodanese-like domain-containing ...  90.1    2e-17   Oryza brachyantha
ref|XP_002451894.1|  hypothetical protein SORBIDRAFT_04g009380        90.1    2e-17   Sorghum bicolor [broomcorn]
gb|AFW71054.1|  hypothetical protein ZEAMMB73_066102                  90.1    3e-17   
ref|NP_001046473.1|  Os02g0257300                                     88.2    1e-16   
gb|EAY85255.1|  hypothetical protein OsI_06628                        85.1    9e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002991602.1|  hypothetical protein SELMODRAFT_448468           84.0    6e-15   Selaginella moellendorffii
ref|XP_002971531.1|  hypothetical protein SELMODRAFT_441569           84.0    7e-15   Selaginella moellendorffii
ref|XP_007051587.1|  Thylakoid rhodanese-like, putative isoform 2     79.7    1e-13   
ref|XP_001770053.1|  predicted protein                                79.0    5e-13   
gb|EMS45759.1|  hypothetical protein TRIUR3_22780                     74.7    1e-12   Triticum urartu
ref|XP_002875001.1|  hypothetical protein ARALYDRAFT_352729           78.2    1e-12   
gb|AAB61039.1|  A_IG002N01.31 gene product                            78.2    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EMT20251.1|  hypothetical protein F775_01839                       72.8    4e-12   
ref|XP_007051591.1|  Thylakoid rhodanese-like, putative isoform 6     75.1    4e-12   
emb|CAB80914.1|  hypothetical protein                                 72.4    5e-11   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009623669.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana tomentosiformis]
Length=437

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 99/139 (71%), Gaps = 3/139 (2%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFL TKVAPKELVDEIKQ+GKA
Sbjct  290  FSEVETILQLLGSAALVQLIGKKLLFAEDRKQTLQQVDEFLTTKVAPKELVDEIKQLGKA  349

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAK--TEVVQaeeap  476
            LLP  VSS ALPAP EES  AA  +V     + P+E+ APP + + ++   EV    +A 
Sbjct  350  LLPETVSSDALPAPAEESLAAATGTVEKTE-SVPQEDIAPPKVEASSQPTQEVNSVNKAD  408

Query  475  tatptPRPLSPYPNYPDFK  419
                + RPLSPYPNYPDFK
Sbjct  409  ALPASSRPLSPYPNYPDFK  427



>ref|XP_010326928.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Solanum lycopersicum]
Length=442

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 99/147 (67%), Gaps = 15/147 (10%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+ SKKLLFAEDRKKTL+QVDEFL TKVAPKELVDEIKQIGKA
Sbjct  291  FSEVETILQLLGSAALVQLVSKKLLFAEDRKKTLQQVDEFLTTKVAPKELVDEIKQIGKA  350

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAP----------PVINSVAKTE  500
            LLP  VSS ALPAP E SP AA  +V     + PKE+ AP          P ++SV   E
Sbjct  351  LLPDSVSSNALPAPVEASPAAATSTVEETE-SVPKEDIAPPKVEAISPPTPEVSSVPNAE  409

Query  499  VVQaeeaptatptPRPLSPYPNYPDFK  419
            V    +A     + RPLSPYPNYPD K
Sbjct  410  V----KADALPESSRPLSPYPNYPDLK  432



>ref|XP_006339688.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=442

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 95/146 (65%), Gaps = 13/146 (9%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+ SKKLLFAEDRKKTL+QVDEFL+TKVAPKELVDEIKQIGKA
Sbjct  291  FSEVEIILQLLGSAALVQLVSKKLLFAEDRKKTLQQVDEFLSTKVAPKELVDEIKQIGKA  350

Query  649  LLPTPVSSKAL------papteesppaaaesvsnvSIATPKEEA-APPV--INSVAKTEV  497
            LLP  VSS AL            S     ESV+   IA PK EA +PP   +N+V   EV
Sbjct  351  LLPDSVSSNALPAPVEASPAAATSTVEETESVAKEDIAPPKVEATSPPTPEVNAVPNAEV  410

Query  496  VQaeeaptatptPRPLSPYPNYPDFK  419
                +      + RPLSPYPNYPD K
Sbjct  411  ----KTDALPESSRPLSPYPNYPDLK  432



>ref|XP_010055036.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Eucalyptus grandis]
 gb|KCW71521.1| hypothetical protein EUGRSUZ_E00068 [Eucalyptus grandis]
Length=456

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 98/147 (67%), Gaps = 14/147 (10%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q  SKKLLFAEDRK TL+QVDEFLNTKVAPKELVDEIKQIG+A
Sbjct  304  FSEVETILQLLGSAAIVQFVSKKLLFAEDRKGTLQQVDEFLNTKVAPKELVDEIKQIGRA  363

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIAT-------PKEEAA--PPV-INSVAKTE  500
            LLPT  S KALP PTE S   A+ + +   I T       PK EAA  PP+ +NSV + E
Sbjct  364  LLPTTASGKALPPPTETSSEPASTNNTMQKIETPAAPIPEPKVEAAAEPPIEVNSVPQKE  423

Query  499  VVQaeeaptatptPRPLSPYPNYPDFK  419
            V     A +     R LSPYP YPDFK
Sbjct  424  VT----AESLPGFMRALSPYPYYPDFK  446



>gb|KHN06295.1| Hypothetical protein glysoja_021133 [Glycine soja]
Length=441

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 6/140 (4%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q++GSAA+IQ  SKKLLFAEDRK+T++Q+DEFLNTKVAPKELVDEIK IGKA
Sbjct  295  FSEIESILQVVGSAALIQFASKKLLFAEDRKQTVKQLDEFLNTKVAPKELVDEIKDIGKA  354

Query  649  LLPTPVSSKAL-papteesppaaaesvsnvSIAT--PKEEAAPPVINSVAKTEVVQaeea  479
            LLP+  ++KAL     + S  A A+S    ++AT  PK +A  P +NSV KTEV   +  
Sbjct  355  LLPSSTNNKALPAPEEKSSELATADSTVQNAVATPEPKADAVAPEVNSVPKTEV---KAE  411

Query  478  ptatptPRPLSPYPNYPDFK  419
             +    PRPLSPYP YPDFK
Sbjct  412  ESLPAQPRPLSPYPYYPDFK  431



>ref|XP_003528797.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Glycine max]
Length=444

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 6/140 (4%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q++GSAA+IQ  SKKLLFAEDRK+T++Q+DEFLNTKVAPKELVDEIK IGKA
Sbjct  298  FSEIESILQVVGSAALIQFASKKLLFAEDRKQTVKQLDEFLNTKVAPKELVDEIKDIGKA  357

Query  649  LLPTPVSSKAL-papteesppaaaesvsnvSIAT--PKEEAAPPVINSVAKTEVVQaeea  479
            LLP+  ++KAL     + S  A A+S    ++AT  PK +A  P +NSV KTEV   +  
Sbjct  358  LLPSSTNNKALPAPEEKSSELATADSTVQNAVATPEPKADAVAPEVNSVPKTEV---KAE  414

Query  478  ptatptPRPLSPYPNYPDFK  419
             +    PRPLSPYP YPDFK
Sbjct  415  ESFPAQPRPLSPYPYYPDFK  434



>gb|KDO86421.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=442

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 9/140 (6%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q  SKKLLFAEDRK+TL+QVDEFLNTKVAPKEL D+IKQIGK 
Sbjct  299  FSEIETILQILGSAALVQFASKKLLFAEDRKQTLQQVDEFLNTKVAPKELADDIKQIGKT  358

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAA---PPVINSVAKTEVVQaeea  479
            LLP+P + KAL  P            S  ++  PK EAA   PP +NSV KTEV    +A
Sbjct  359  LLPSPANGKAL--PASTDSKVQKADDSPEAVPQPKVEAAADPPPQVNSVPKTEV----KA  412

Query  478  ptatptPRPLSPYPNYPDFK  419
             +     R LSPYP YPD K
Sbjct  413  DSLPRFQRSLSPYPAYPDLK  432



>ref|XP_006444874.1| hypothetical protein CICLE_v10020161mg [Citrus clementina]
 ref|XP_006491252.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR58114.1| hypothetical protein CICLE_v10020161mg [Citrus clementina]
 gb|KDO86423.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=443

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 91/140 (65%), Gaps = 9/140 (6%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q  SKKLLFAEDRK+TL+QVDEFLNTKVAPKEL D+IKQIGK 
Sbjct  300  FSEIETILQILGSAALVQFASKKLLFAEDRKQTLQQVDEFLNTKVAPKELADDIKQIGKT  359

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAA---PPVINSVAKTEVVQaeea  479
            LLP+P + KAL  P            S  ++  PK EAA   PP +NSV KTEV    +A
Sbjct  360  LLPSPANGKAL--PASTDSKVQKADDSPEAVPQPKVEAAADPPPQVNSVPKTEV----KA  413

Query  478  ptatptPRPLSPYPNYPDFK  419
             +     R LSPYP YPD K
Sbjct  414  DSLPRFQRSLSPYPAYPDLK  433



>gb|KJB49531.1| hypothetical protein B456_008G124200 [Gossypium raimondii]
Length=415

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 98/140 (70%), Gaps = 20/140 (14%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAAIIQ+ SKKLLFAEDRKKTL+QVDEFL+TKVAP ELVD+IKQIG A
Sbjct  283  FSEIETILQVLGSAAIIQLLSKKLLFAEDRKKTLQQVDEFLSTKVAPNELVDDIKQIGVA  342

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAA---PPVINSVAKTEVVQaeea  479
            L+PT  +SKALPAPTE +P              PK E +   PP IN+V ++E      A
Sbjct  343  LIPTTTTSKALPAPTEANPE-------------PKSEVSAEPPPQINAVPESE----SRA  385

Query  478  ptatptPRPLSPYPNYPDFK  419
              ++ TPRPLSPYP+YPDFK
Sbjct  386  KGSSGTPRPLSPYPSYPDFK  405



>ref|XP_009761641.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana sylvestris]
Length=441

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 99/146 (68%), Gaps = 13/146 (9%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA+IQ+  KKLLFAEDRK TL+QVDEFL+TK+APKELVDEIKQIGKA
Sbjct  290  FSEVETILQLLGSAALIQLIGKKLLFAEDRKLTLQQVDEFLSTKIAPKELVDEIKQIGKA  349

Query  649  LLPTPVSSKALpapteesppaaaesvsnvS------IATPKEEAAP---PVINSVAKTEV  497
            LLP  +SS ALPAP E SP A+  +V          IA PK EA+    P +NS A  EV
Sbjct  350  LLPETMSSDALPAPAEASPAASTGTVEKTESVPQEDIAPPKVEASSQPTPEVNSAANAEV  409

Query  496  VQaeeaptatptPRPLSPYPNYPDFK  419
                +A     + RPLSPYPNYPDFK
Sbjct  410  ----KADALPKSSRPLSPYPNYPDFK  431



>ref|XP_007135236.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
 gb|ESW07230.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
Length=451

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 94/149 (63%), Gaps = 16/149 (11%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q  SKKLLFAEDRK+T++Q+DEFLNTKVAPKELVDEIK IG A
Sbjct  297  FSEIESILQVLGSAALVQFASKKLLFAEDRKQTVKQLDEFLNTKVAPKELVDEIKDIGNA  356

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATP------------KEEAAPPVINSVAK  506
            LLPT  S     +  + S  A A+S    ++ATP            K EA  P +NSV K
Sbjct  357  LLPTSTSKALPASSDKSSELATADSTVQTAVATPVAVTTEVATPVTKAEAVAPEVNSVPK  416

Query  505  TEVVQaeeaptatptPRPLSPYPNYPDFK  419
            TE+ +     +    PRPLSPYP YPDFK
Sbjct  417  TEIKE----ESLPVQPRPLSPYPYYPDFK  441



>ref|XP_010661901.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Vitis vinifera]
Length=440

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 87/146 (60%), Gaps = 28/146 (19%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q   KK LFAEDRK+TL+QVDEFL TK+APK+ VDEIK IGKA
Sbjct  304  FSEVETLLQLLGSAAIVQFVGKKFLFAEDRKETLQQVDEFLTTKIAPKDFVDEIKDIGKA  363

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPK---------EEAAPPVINSVAKTEV  497
            LLP+P    +L                  ++ATP+         E AAPP INSV K EV
Sbjct  364  LLPSPAYGNSL---------------PAPAVATPEPPTSTEPKVEAAAPPEINSVPKPEV  408

Query  496  VQaeeaptatptPRPLSPYPNYPDFK  419
                +A +     RPLSPYP YPDFK
Sbjct  409  ----QAESIPSLSRPLSPYPYYPDFK  430



>gb|KHG21564.1| hypothetical protein F383_26582 [Gossypium arboreum]
Length=420

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 99/140 (71%), Gaps = 20/140 (14%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAAIIQ+ SKKLLFAEDRKKTL+QVDEFL+TKVAPKELVD+IKQIG A
Sbjct  288  FSEIETILQVLGSAAIIQLLSKKLLFAEDRKKTLQQVDEFLSTKVAPKELVDDIKQIGVA  347

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAA---PPVINSVAKTEVVQaeea  479
            L+PT  +SKALPAPTE +P              PK E +   P  IN+V ++E     +A
Sbjct  348  LIPTTTTSKALPAPTEANPE-------------PKSEVSAETPTQINAVPESE----SKA  390

Query  478  ptatptPRPLSPYPNYPDFK  419
              ++ TPRPLSPYP+YPDFK
Sbjct  391  KGSSGTPRPLSPYPSYPDFK  410



>ref|XP_002320855.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99170.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=434

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 92/137 (67%), Gaps = 10/137 (7%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA+IQ  SKKLLFAEDRK+TLEQVDEFL TK+APKELVDE+K IGKA
Sbjct  298  FSEIEAILQVLGSAALIQFVSKKLLFAEDRKQTLEQVDEFLTTKIAPKELVDELKDIGKA  357

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP  V+SKALPAP E SP  AA        ++ +   A P INS  KTE     +A   
Sbjct  358  LLPVAVTSKALPAPAEASPEPAAAD------SSVQNAEAAPQINSAPKTEA----KAEPL  407

Query  469  tptPRPLSPYPNYPDFK  419
            +   RPLSPYP YPD K
Sbjct  408  SGFSRPLSPYPTYPDLK  424



>ref|XP_010261520.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nelumbo nucifera]
Length=450

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 8/141 (6%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q  SKKLLFAEDRK TL+QVDEFLNTKVAPKEL+DEIKQIGKA
Sbjct  304  FSEIETILQLLGSAALVQFVSKKLLFAEDRKVTLKQVDEFLNTKVAPKELIDEIKQIGKA  363

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPK--EEAAPPV--INSVAKTEVVQaee  482
            +LP+P+ +KALPAP E +P    ++ +   + T    E+ A P   +NSV +T+V    +
Sbjct  364  VLPSPIDNKALPAPVERAPDTVKKAEAVPELNTEPTLEKTAEPSSEVNSVPQTDV----K  419

Query  481  aptatptPRPLSPYPNYPDFK  419
            A +     R LSPYP YPDFK
Sbjct  420  AESVPGLSRSLSPYPYYPDFK  440



>ref|XP_012083235.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Jatropha curcas]
 gb|KDP28507.1| hypothetical protein JCGZ_14278 [Jatropha curcas]
Length=444

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 91/150 (61%), Gaps = 22/150 (15%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAAI+Q  SKKLLFAEDRK+TL+QVDEFLNTKVAPKEL DEIKQIGKA
Sbjct  294  FSEIETILQVLGSAAIVQFASKKLLFAEDRKQTLQQVDEFLNTKVAPKELADEIKQIGKA  353

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAA-------------PPVINSVA  509
            LLP  V+SKALP P E S         + ++   +  AA              P INSV 
Sbjct  354  LLPAAVTSKALPPPVETSSAPNTAPAVDTNVQNAEASAADSTVQKAEAAVEPAPQINSV-  412

Query  508  KTEVVQaeeaptatptPRPLSPYPNYPDFK  419
            K E V           PRPLSPYP+YPD K
Sbjct  413  KAESVS--------AFPRPLSPYPSYPDLK  434



>ref|XP_008437912.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Cucumis melo]
Length=442

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 92/137 (67%), Gaps = 6/137 (4%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAIIQ  S+KLL+AEDRKKTL++VDEF NTKVAP++LVDE+K IGKA
Sbjct  302  FTEMETVLQLLGSAAIIQFVSRKLLYAEDRKKTLQEVDEFFNTKVAPQDLVDELKDIGKA  361

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            +LP P + KALPAP E +   A  S +        E A  P  NSVAK EV    +A + 
Sbjct  362  ILPLPATEKALPAPAEAAVEVATSSDTVQKAEAVVEPA--PETNSVAKQEV----KAESL  415

Query  469  tptPRPLSPYPNYPDFK  419
                RPLSPYP+YPDF+
Sbjct  416  PKISRPLSPYPSYPDFR  432



>ref|XP_003548475.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Glycine max]
 gb|KHN15949.1| Hypothetical protein glysoja_013165 [Glycine soja]
Length=455

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 93/150 (62%), Gaps = 16/150 (11%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q++GSAA+IQ  SKKLLFAEDR++T++Q+ EFLNTKVAPKELVDEIK IGKA
Sbjct  299  FSEIESILQVVGSAALIQFASKKLLFAEDREQTVKQLGEFLNTKVAPKELVDEIKDIGKA  358

Query  649  LLPTPVSSKAL-----------papteesppaaaesvsnvSIAT--PKEEAAPPVINSVA  509
            LLP+   +KAL            A +      A       ++AT  PK +A  P +NSV 
Sbjct  359  LLPSSTDNKALPAPAEKSSELATADSTVQRAVATPESKAEAVATPEPKVDAVAPEVNSVP  418

Query  508  KTEVVQaeeaptatptPRPLSPYPNYPDFK  419
            KTEV   +   +    PRPLSPYP YPDFK
Sbjct  419  KTEV---KAEESLPVQPRPLSPYPYYPDFK  445



>ref|XP_011037916.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Populus euphratica]
Length=425

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 86/137 (63%), Gaps = 19/137 (14%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA+IQ  SKKLLFAEDRK+TLEQVDEFL TK+APKEL DE+K IGKA
Sbjct  298  FSEIEAILQVLGSAALIQFVSKKLLFAEDRKQTLEQVDEFLTTKIAPKELGDELKDIGKA  357

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP  V+SKALPAP E                +P+   A   INS  KTE     +A   
Sbjct  358  LLPVAVTSKALPAPAE---------------VSPEPAPADSSINSAPKTEA----KAEPV  398

Query  469  tptPRPLSPYPNYPDFK  419
            +   RPLSPYP YPD K
Sbjct  399  SEFSRPLSPYPTYPDLK  415



>ref|XP_011650694.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Cucumis sativus]
 gb|KGN56436.1| hypothetical protein Csa_3G119690 [Cucumis sativus]
Length=442

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 10/139 (7%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAIIQ  S+KLL+AEDRKKTL++VDEFLNTKVAP++LVDE+K IGKA
Sbjct  302  FTEMETVLQLLGSAAIIQFVSRKLLYAEDRKKTLQEVDEFLNTKVAPQDLVDELKDIGKA  361

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVI--NSVAKTEVVQaeeap  476
            +LP P + KALPAP E +  AA  S +        E    P +  NSVAK EV    +A 
Sbjct  362  ILPLPATEKALPAPAEAAVEAATSSDTVQK----AEAVVEPALETNSVAKQEV----KAE  413

Query  475  tatptPRPLSPYPNYPDFK  419
            +     RPLSPYP+YPDF+
Sbjct  414  SLPKISRPLSPYPSYPDFR  432



>ref|XP_010915675.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Elaeis guineensis]
Length=456

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 90/148 (61%), Gaps = 15/148 (10%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA+IQ  +KKLLFAEDRK TL+Q DEFLNTKVAPKELVDEIK IGKA
Sbjct  303  FTEIETVLQLLGSAALIQFVTKKLLFAEDRKVTLQQADEFLNTKVAPKELVDEIKMIGKA  362

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIA-------TPKEEAA----PPVINSVAKT  503
            LLP P S KA      E  P  + S   V  A       T  +EAA     P +NSV K 
Sbjct  363  LLPAPSSVKASLPAPIEGNPDTSTSSIPVQKADVVPGTKTEMKEAASTERSPTVNSVPKA  422

Query  502  EVVQaeeaptatptPRPLSPYPNYPDFK  419
            EV +     +    PRPLSPYP YPDFK
Sbjct  423  EVRE----ESIPVMPRPLSPYPYYPDFK  446



>ref|XP_009601089.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana tomentosiformis]
Length=481

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 79/131 (60%), Gaps = 26/131 (20%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              QLLGSAA+IQ+ S KLLFAEDRK+TL+QVDEF+ T +APKEL  +IKQIG ALLPTPV
Sbjct  304  ILQLLGSAALIQLVSTKLLFAEDRKQTLQQVDEFVTTNIAPKELAGDIKQIGMALLPTPV  363

Query  631  SSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeaptatptPRP  452
            +SKAL                      P      P INSV K E+    +    T   +P
Sbjct  364  TSKAL----------------------PAAAETTPEINSVPKPEI----KVEALTGISKP  397

Query  451  LSPYPNYPDFK  419
            LSPYP+YPD K
Sbjct  398  LSPYPSYPDLK  408



>ref|XP_006491251.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|KDO86424.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=451

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 87/134 (65%), Gaps = 9/134 (7%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q  SKKLLFAEDRK+TL+QVDEFLNTKVAPKEL D+IKQIGK 
Sbjct  300  FSEIETILQILGSAALVQFASKKLLFAEDRKQTLQQVDEFLNTKVAPKELADDIKQIGKT  359

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAA---PPVINSVAKTEVVQaeea  479
            LLP+P + KAL  P            S  ++  PK EAA   PP +NSV KTEV    +A
Sbjct  360  LLPSPANGKAL--PASTDSKVQKADDSPEAVPQPKVEAAADPPPQVNSVPKTEV----KA  413

Query  478  ptatptPRPLSPYP  437
             +     R LSPYP
Sbjct  414  DSLPRFQRSLSPYP  427



>ref|XP_011023203.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Populus euphratica]
Length=436

 Score =   111 bits (278),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 91/136 (67%), Gaps = 10/136 (7%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA+IQ  SKKLLFAEDRK+TLEQVDEFL TK+APKEL DE+K IG+A
Sbjct  300  FSEMETILQVLGSAALIQFASKKLLFAEDRKQTLEQVDEFLTTKIAPKELGDELKDIGRA  359

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP PV+ KALPAPTE SP  A         A  K EAA   INSV  TE     +A + 
Sbjct  360  LLPVPVTIKALPAPTEASPEPAVADS-----AVQKAEAASQ-INSVPITEA----KAESV  409

Query  469  tptPRPLSPYPNYPDF  422
            +   RPLSPYP YPD 
Sbjct  410  SGFSRPLSPYPYYPDL  425


 Score = 30.4 bits (67),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETIL  807
            AAAG+G LAFSE+ETIL
Sbjct  291  AAAGLGVLAFSEMETIL  307



>ref|XP_010266472.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nelumbo nucifera]
Length=461

 Score =   112 bits (279),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 90/156 (58%), Gaps = 33/156 (21%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q  SKKLLFAEDRK TL+QVDEFLNTKVAPKE+V+EIKQIGKA
Sbjct  310  FSEVETILQLLGSAAIVQFVSKKLLFAEDRKVTLQQVDEFLNTKVAPKEIVNEIKQIGKA  369

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATP----KEEAA---------------PP  527
             LP+P   KALP P E +             ATP    K EAA                P
Sbjct  370  FLPSPTVKKALPKPVEGASNT----------ATPDIIQKTEAATELNPELKLQQASKPSP  419

Query  526  VINSVAKTEVVQaeeaptatptPRPLSPYPNYPDFK  419
             +NS  KTEV    +A       R LSPYP YPDFK
Sbjct  420  EVNSAPKTEV----KAEPFPGLSRSLSPYPYYPDFK  451


 Score = 29.6 bits (65),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LAFSEVETIL 
Sbjct  301  AATGLGLLAFSEVETILQ  318



>emb|CDP08699.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   112 bits (279),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 92/151 (61%), Gaps = 23/151 (15%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q+  +K LFAEDRKKTLE+VDEFL TKVAPKELV ++K IGKA
Sbjct  303  FSEVETILQVLGSAALVQLIGQKFLFAEDRKKTLEKVDEFLTTKVAPKELVGDVKLIGKA  362

Query  649  LLPTPVSSKALpapteesppaaaes--------------vsnvSIATPKEEAAPPVINSV  512
            LLP PV+SKALPAPTE +P     +                  ++A P  E     INSV
Sbjct  363  LLPLPVTSKALPAPTEANPGTIGSTIERVESVPGVSDAPSKVEAVAEPTAE-----INSV  417

Query  511  AKTEVVQaeeaptatptPRPLSPYPNYPDFK  419
             K EV    E  +     RPLSPYPNYPD K
Sbjct  418  PKAEV----ETDSLPGISRPLSPYPNYPDLK  444


 Score = 29.6 bits (65),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LAFSEVETIL 
Sbjct  294  AATGLGLLAFSEVETILQ  311



>gb|KHG13147.1| hypothetical protein F383_04098 [Gossypium arboreum]
Length=499

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 91/140 (65%), Gaps = 20/140 (14%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q+ SKK L+AE+RK+TL+QVDEFLNTKVAP ELVD++KQIG A
Sbjct  303  FSEIETILQLLGSAAIVQLVSKKFLYAENRKQTLKQVDEFLNTKVAPTELVDDVKQIGAA  362

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEA---APPVINSVAKTEVVQaeea  479
            LLPT  +SKALPAPTE  P              PK EA   APP  NSV +T      +A
Sbjct  363  LLPTTTTSKALPAPTEAKPE-------------PKVEAVAEAPPQTNSVPET----VPKA  405

Query  478  ptatptPRPLSPYPNYPDFK  419
               T   RPLSPY +YPD K
Sbjct  406  VGITGFSRPLSPYASYPDLK  425



>ref|XP_004516405.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Cicer arietinum]
Length=480

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 99/171 (58%), Gaps = 38/171 (22%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QL+GSAA++Q  SKKLLFAEDRKKTL+QVDEFL+TKVAPKELVDEIK IGKA
Sbjct  304  FSEIETILQLVGSAALVQFASKKLLFAEDRKKTLQQVDEFLSTKVAPKELVDEIKDIGKA  363

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSI-ATPKE----------EAAP---------  530
            LLPT  ++KALPAPT+ SP  A    +     A P            EAAP         
Sbjct  364  LLPTSTNNKALPAPTKNSPVLATAGGTVQEAEAIPDTVSEIKVEAVAEAAPETKVEAAAE  423

Query  529  --------------PVINSVAKTEVVQaeeaptatptPRPLSPYPNYPDFK  419
                          P INSV KTE V    A +    P+PLSPYP YPDFK
Sbjct  424  AAPETKVEAAAEAAPEINSVPKTETV----AESIPVQPKPLSPYPYYPDFK  470



>ref|XP_011468943.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=444

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q  SKKLLFAEDR KTL++VD FL+TKVAPKEL+ +IKQIG A
Sbjct  298  FTEVETILQLLGSAALVQFASKKLLFAEDRNKTLQEVDTFLSTKVAPKELLGDIKQIGIA  357

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPK---EEAAPPV--INSVAKTEVVQae  485
            LLP PV+SK+LPAP E SP   A      + A+P+   E AA P   INSV K EV +  
Sbjct  358  LLP-PVTSKSLPAPAEASPAPTAADTVVKAEASPEPKVEAAAEPAPEINSVPKAEVKE--  414

Query  484  eaptatptPRPLSPYPNYPDFK  419
               +     RPLSP+P YPDFK
Sbjct  415  --ESLPVNSRPLSPFPYYPDFK  434



>ref|XP_002302622.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE81895.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=436

 Score =   108 bits (269),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 90/136 (66%), Gaps = 10/136 (7%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA+IQ  SKKLLFAEDRK+TLEQVDEFL TK+APKEL DE+K IG+A
Sbjct  300  FSEMETILQVLGSAALIQFVSKKLLFAEDRKQTLEQVDEFLTTKIAPKELGDELKDIGRA  359

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP PV+ KALPAPTE SP  A         +T ++  A   INSV  TE     +A + 
Sbjct  360  LLPVPVTIKALPAPTEASPEPAVAD------STVQKAEAASQINSVPITEA----KAVSV  409

Query  469  tptPRPLSPYPNYPDF  422
            +   RPLSPYP Y D 
Sbjct  410  SGFSRPLSPYPYYSDL  425


 Score = 30.4 bits (67),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETIL  807
            AAAG+G LAFSE+ETIL
Sbjct  291  AAAGLGVLAFSEMETIL  307



>gb|KJB24583.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=434

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 85/142 (60%), Gaps = 25/142 (18%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q+ SKK L+AE+RK+TL+QVDEFLNTKVAPKELVD++KQIG A
Sbjct  303  FSEIETILQLLGSAAIVQLVSKKFLYAENRKQTLKQVDEFLNTKVAPKELVDDVKQIGAA  362

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQae-----  485
            LLPT  +SKALP                     P EE   P + +VA+     +      
Sbjct  363  LLPTTTTSKALP--------------------APTEEKPEPKVKAVAEAPQTNSVPETVP  402

Query  484  eaptatptPRPLSPYPNYPDFK  419
            EA   T   RPLSPY +YPD K
Sbjct  403  EADGITGFSRPLSPYASYPDLK  424



>ref|XP_007135235.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
 gb|ESW07229.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
Length=439

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 89/143 (62%), Gaps = 16/143 (11%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q  SKKLLFAEDRK+T++Q+DEFLNTKVAPKELVDEIK IG A
Sbjct  297  FSEIESILQVLGSAALVQFASKKLLFAEDRKQTVKQLDEFLNTKVAPKELVDEIKDIGNA  356

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATP------------KEEAAPPVINSVAK  506
            LLPT  S     +  + S  A A+S    ++ATP            K EA  P +NSV K
Sbjct  357  LLPTSTSKALPASSDKSSELATADSTVQTAVATPVAVTTEVATPVTKAEAVAPEVNSVPK  416

Query  505  TEVVQaeeaptatptPRPLSPYP  437
            TE+ +     +    PRPLSPYP
Sbjct  417  TEIKE----ESLPVQPRPLSPYP  435



>ref|XP_009789972.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana sylvestris]
Length=481

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 81/137 (59%), Gaps = 26/137 (19%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA+IQ+ S KLLFAE RK+TL+QVDEF+ T +APKELV +IKQIG A
Sbjct  298  FSEVETILQLLGSAALIQLVSTKLLFAEVRKQTLQQVDEFVTTNIAPKELVGDIKQIGMA  357

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLPTPV+SK+L                      P      P INSV K +V    +    
Sbjct  358  LLPTPVTSKSL----------------------PAPAETTPEINSVPKPQV----KVEAL  391

Query  469  tptPRPLSPYPNYPDFK  419
            T   +PLSPYP+YPD K
Sbjct  392  TGISKPLSPYPSYPDLK  408



>ref|XP_009421248.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=486

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 89/137 (65%), Gaps = 7/137 (5%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q+F+K+ LFAEDRK TL Q+DEFLNTKVAPKELVDEIK IGKA
Sbjct  347  FTEIETLLQVLGSAALVQLFTKRFLFAEDRKVTLRQLDEFLNTKVAPKELVDEIKMIGKA  406

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP   ++KA      ++  A A +    ++ + +     P +NSV K EV +     + 
Sbjct  407  LLPADSNAKASLPAPTDASAAPAPTQKTDAVTSTEPL---PAVNSVPKAEVKE----ESP  459

Query  469  tptPRPLSPYPNYPDFK  419
              TPRPLSPYP YPD K
Sbjct  460  PVTPRPLSPYPYYPDLK  476



>ref|XP_008783830.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Phoenix dactylifera]
Length=456

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 83/145 (57%), Gaps = 23/145 (16%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVS  629
             QLLGSAA+IQ  +KKLLFAEDR+ TL+Q DEFLNTKVAPKELVDEIK IG+ALLP P +
Sbjct  310  LQLLGSAALIQFVTKKLLFAEDRRVTLQQADEFLNTKVAPKELVDEIKMIGRALLPVPTT  369

Query  628  SKALpapteesppaaaesvsnvSIATPKEEAAP---------------PVINSVAKTEVV  494
             KA       +P       S  SI   K +A P               P +NSV   EV 
Sbjct  370  VKA----GLPAPVEGNPDTSTSSIPVQKGDAVPGTKAEMKEAASTEPSPTVNSVPIEEVR  425

Query  493  QaeeaptatptPRPLSPYPNYPDFK  419
            +           RPLSPYP YPDFK
Sbjct  426  EESVPVMP----RPLSPYPYYPDFK  446



>gb|KJB24582.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=498

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 85/142 (60%), Gaps = 25/142 (18%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q+ SKK L+AE+RK+TL+QVDEFLNTKVAPKELVD++KQIG A
Sbjct  303  FSEIETILQLLGSAAIVQLVSKKFLYAENRKQTLKQVDEFLNTKVAPKELVDDVKQIGAA  362

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQae-----  485
            LLPT  +SKALP                     P EE   P + +VA+     +      
Sbjct  363  LLPTTTTSKALP--------------------APTEEKPEPKVKAVAEAPQTNSVPETVP  402

Query  484  eaptatptPRPLSPYPNYPDFK  419
            EA   T   RPLSPY +YPD K
Sbjct  403  EADGITGFSRPLSPYASYPDLK  424



>emb|CBI40498.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 80/137 (58%), Gaps = 26/137 (19%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q   KK LFAEDRK+TL+QVDEFL TK+APK+ VDEIK IGKA
Sbjct  257  FSEVETLLQLLGSAAIVQFVGKKFLFAEDRKETLQQVDEFLTTKIAPKDFVDEIKDIGKA  316

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP+P    +LPAP    P                       INSV K EV    +A + 
Sbjct  317  LLPSPAYGNSLPAPAAAPPE----------------------INSVPKPEV----QAESI  350

Query  469  tptPRPLSPYPNYPDFK  419
                RPLSPYP YPDFK
Sbjct  351  PSLSRPLSPYPYYPDFK  367



>ref|XP_006847355.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Amborella trichopoda]
 gb|ERN08936.1| hypothetical protein AMTR_s00015p00257490 [Amborella trichopoda]
Length=455

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 81/138 (59%), Gaps = 17/138 (12%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVS  629
             QLLGSAA  Q  +KKLLFAEDRK TL+Q+DEFLNTKVAPKE VDEIK IGKALLP   +
Sbjct  317  LQLLGSAAAFQFITKKLLFAEDRKVTLQQIDEFLNTKVAPKEHVDEIKGIGKALLPASTN  376

Query  628  SKALpapteesppaaaesvsnvSIATPKEEAAPPV--------INSVAKTEVVQaeeapt  473
            S  +         +  +      +AT +E+  P          +NSV K E+       +
Sbjct  377  SGTV-----VDAASVQKVEDATPVATTEEKVDPCTNPSPKEFEVNSVPKPEITS----SS  427

Query  472  atptPRPLSPYPNYPDFK  419
                PRPLSPYPNYPD K
Sbjct  428  IPGLPRPLSPYPNYPDLK  445



>ref|XP_007051586.1| Thylakoid rhodanese-like, putative isoform 1 [Theobroma cacao]
 gb|EOX95743.1| Thylakoid rhodanese-like, putative isoform 1 [Theobroma cacao]
Length=430

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 88/134 (66%), Gaps = 21/134 (16%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              QLLGSAAI+Q+ SKKLLFAEDRK+TL+QVDEFL TK+AP E VDEIKQIG ALLPT  
Sbjct  305  ILQLLGSAAIVQLVSKKLLFAEDRKQTLQQVDEFLTTKIAPNEFVDEIKQIGVALLPT-T  363

Query  631  SSKALpapteesppaaaesvsnvSIATPKEEAA---PPVINSVAKTEVVQaeeaptatpt  461
            + K+LPAPTE  P              P+ EAA   PP INSV  T      +A   +  
Sbjct  364  TGKSLPAPTEAKPE-------------PRVEAAAEPPPQINSVPTTGA----KADEPSGF  406

Query  460  PRPLSPYPNYPDFK  419
            PRPLSPY +YPD K
Sbjct  407  PRPLSPYASYPDLK  420



>ref|XP_007219299.1| hypothetical protein PRUPE_ppa018863mg, partial [Prunus persica]
 gb|EMJ20498.1| hypothetical protein PRUPE_ppa018863mg, partial [Prunus persica]
Length=336

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 93/148 (63%), Gaps = 20/148 (14%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q  SKKLLFAEDRK TL++VD+FL TKVAPKELVD+IKQIG A
Sbjct  188  FTELETILQLLGSAALVQFASKKLLFAEDRKATLQEVDKFLTTKVAPKELVDDIKQIGTA  247

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAA-----------PPVINSVAKT  503
            LLP  V+SK LPAP E +P   A + +       K EAA            P INSV K 
Sbjct  248  LLPVSVTSKGLPAPAEATPEPTAANDTVQ-----KAEAAVELKVEAAAEAAPEINSVPKP  302

Query  502  EVVQaeeaptatptPRPLSPYPNYPDFK  419
            EV    +A +     +PLSP+P YPDFK
Sbjct  303  EV----KAESLPGISKPLSPFPYYPDFK  326



>ref|XP_002523373.1| chitinase, putative [Ricinus communis]
 gb|EEF39089.1| chitinase, putative [Ricinus communis]
Length=938

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 84/129 (65%), Gaps = 11/129 (9%)
 Frame = -1

Query  805  QLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVSS  626
            Q+LGSAAIIQ  SKKLL+AE+RK+TL+QVDEFLNTK+APKEL DEIKQIGKALLP+  ++
Sbjct  811  QVLGSAAIIQFASKKLLYAEERKQTLKQVDEFLNTKIAPKELADEIKQIGKALLPSTTTN  870

Query  625  KALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeaptatptPRPLS  446
            KALP P E S   AA   +        E A  P INS     V         +   RPLS
Sbjct  871  KALPPPAEASSEPAAAENTVQKAEAVAEPA--PQINSAKAGSV---------SGFSRPLS  919

Query  445  PYPNYPDFK  419
            PY +YPD K
Sbjct  920  PYASYPDLK  928



>gb|ACJ86240.1| unknown [Medicago truncatula]
Length=480

 Score =   103 bits (258),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QL+GSAAI+Q  SKKLLFAEDRKKTL+QV+EFLNTKVAPKELVDEIK IGKA
Sbjct  298  FSEVETILQLVGSAAIVQFASKKLLFAEDRKKTLKQVNEFLNTKVAPKELVDEIKDIGKA  357

Query  649  LLPTPVSSKAL  617
            LLPT  + KAL
Sbjct  358  LLPTSTNDKAL  368


 Score = 30.0 bits (66),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LAFSEVETIL 
Sbjct  289  AATGLGVLAFSEVETILQ  306



>gb|KEH18685.1| thylakoid rhodanese-like protein [Medicago truncatula]
Length=482

 Score =   103 bits (258),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QL+GSAAI+Q  SKKLLFAEDRKKTL+QV+EFLNTKVAPKELVDEIK IGKA
Sbjct  298  FSEVETILQLVGSAAIVQFASKKLLFAEDRKKTLKQVNEFLNTKVAPKELVDEIKDIGKA  357

Query  649  LLPTPVSSKAL  617
            LLPT  + KAL
Sbjct  358  LLPTSTNDKAL  368


 Score = 30.0 bits (66),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LAFSEVETIL 
Sbjct  289  AATGLGVLAFSEVETILQ  306



>ref|XP_008233203.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Prunus mume]
Length=449

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 91/141 (65%), Gaps = 20/141 (14%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVS  629
             Q+LGSAA++Q  SKKLLFAEDRK TL++VD+FL TKVAPKELVD+IKQIG ALLP  V+
Sbjct  308  LQVLGSAALVQFASKKLLFAEDRKATLQEVDKFLTTKVAPKELVDDIKQIGTALLPVSVT  367

Query  628  SKALpapteesppaaaesvsnvSIATPKEEAA-----------PPVINSVAKTEVVQaee  482
            SK LPAP E +P   A + +       K EAA            P INSV K EV    +
Sbjct  368  SKGLPAPAEATPEPTAANDTVQ-----KAEAAVEPKVEAAAEAAPEINSVPKPEV----K  418

Query  481  aptatptPRPLSPYPNYPDFK  419
            A +     +PLSP+P YPDFK
Sbjct  419  AESLPGISKPLSPFPYYPDFK  439



>ref|XP_009134504.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like domain-containing 
protein 4, chloroplastic [Brassica rapa]
Length=527

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 86/141 (61%), Gaps = 4/141 (3%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+   KLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K IGKA
Sbjct  294  FTEIETILQLLGSAALVQLAGNKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKDIGKA  353

Query  649  LLPTPVSSKALpapteesppaaaesvs----nvSIATPKEEAAPPVINSVAKTEVVQaee  482
             LP   SSKALP P  E+              + +AT +  + P +  + A+      + 
Sbjct  354  FLPLSTSSKALPPPAAEAATTTTVDEKEPEPAIKVATAQVNSEPAIEAATAQVITEPTKT  413

Query  481  aptatptPRPLSPYPNYPDFK  419
                 P PRPLSPY +YPD K
Sbjct  414  EAKPKPYPRPLSPYASYPDLK  434



>ref|XP_010095787.1| Uncharacterized protein L484_017594 [Morus notabilis]
 gb|EXB62207.1| Uncharacterized protein L484_017594 [Morus notabilis]
Length=881

 Score =   106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            FQ  +   Q+LGSAA++Q  SKK LFAEDRK+TL+Q DEFL TKVAP+ELVD++KQIG A
Sbjct  733  FQEVETILQVLGSAAVVQFVSKKFLFAEDRKETLKQFDEFLTTKVAPQELVDDVKQIGIA  792

Query  649  LLPTPVSSKAL---papteesppaaaesvsnvSIATPKEEA-APPV--INSVAKTEVVQa  488
            +LPT  +SKAL            A +      +I  PK EA A P   INSV +TE    
Sbjct  793  ILPTTGTSKALPTPTEANPSPATADSTVQKAETIPEPKVEATAEPTQEINSVPQTE----  848

Query  487  eeaptatptPRPLSPYPNYPDFK  419
             +A +     + LSPYP YPDFK
Sbjct  849  NKAESLPTVSQYLSPYPAYPDFK  871



>gb|KDO86422.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=417

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q  SKKLLFAEDRK+TL+QVDEFLNTKVAPKEL D+IKQIGK 
Sbjct  300  FSEIETILQILGSAALVQFASKKLLFAEDRKQTLQQVDEFLNTKVAPKELADDIKQIGKT  359

Query  649  LLPTPVSSKAL  617
            LLP+P + KAL
Sbjct  360  LLPSPANGKAL  370



>gb|KHG13146.1| hypothetical protein F383_04098 [Gossypium arboreum]
Length=509

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 91/150 (61%), Gaps = 30/150 (20%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q+ SKK L+AE+RK+TL+QVDEFLNTKVAP ELVD++KQIG A
Sbjct  303  FSEIETILQLLGSAAIVQLVSKKFLYAENRKQTLKQVDEFLNTKVAPTELVDDVKQIGAA  362

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEA---APPVINSVAKTEVVQaeea  479
            LLPT  +SKALPAPTE  P              PK EA   APP  NSV +T      +A
Sbjct  363  LLPTTTTSKALPAPTEAKPE-------------PKVEAVAEAPPQTNSVPET----VPKA  405

Query  478  ptatptPRPLSPYPN----------YPDFK  419
               T   RPLSPY +          YPD K
Sbjct  406  VGITGFSRPLSPYASVMSLFITPYAYPDLK  435



>gb|KFK30681.1| hypothetical protein AALP_AA6G014200 [Arabis alpina]
Length=465

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q+  KKLLFAEDRKKTL+QVDEFLNTKVAPKELVDE+K+IGKA
Sbjct  295  FSEIETILQVLGSAALVQLAGKKLLFAEDRKKTLKQVDEFLNTKVAPKELVDELKEIGKA  354

Query  649  LLPTPVSSKAL  617
            LLP   SSKAL
Sbjct  355  LLPPSTSSKAL  365



>ref|XP_006396308.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
 gb|ESQ37761.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
Length=454

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 84/153 (55%), Gaps = 21/153 (14%)
 Frame = -1

Query  835  WRFQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIG  656
            + F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K+IG
Sbjct  299  FAFTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIG  358

Query  655  KALLPTPVSSKAL--------------papteesppaaaesvsnvSIATPKEEAAPPVIN  518
            KALLP   SSKAL                  ++ P    +           + A   VI+
Sbjct  359  KALLPPSTSSKALPAPATVTPEAAATTTTVDKQEPEPETKPEPEPEPVPEIKAATAQVIS  418

Query  517  SVAKTEVVQaeeaptatptPRPLSPYPNYPDFK  419
               KTE              RPLSPY +YPD K
Sbjct  419  EPTKTEA-------KPKSYSRPLSPYASYPDLK  444



>ref|XP_006396307.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
 gb|ESQ37760.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
Length=447

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 84/153 (55%), Gaps = 21/153 (14%)
 Frame = -1

Query  835  WRFQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIG  656
            + F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K+IG
Sbjct  292  FAFTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIG  351

Query  655  KALLPTPVSSKAL--------------papteesppaaaesvsnvSIATPKEEAAPPVIN  518
            KALLP   SSKAL                  ++ P    +           + A   VI+
Sbjct  352  KALLPPSTSSKALPAPATVTPEAAATTTTVDKQEPEPETKPEPEPEPVPEIKAATAQVIS  411

Query  517  SVAKTEVVQaeeaptatptPRPLSPYPNYPDFK  419
               KTE              RPLSPY +YPD K
Sbjct  412  EPTKTEA-------KPKSYSRPLSPYASYPDLK  437



>ref|XP_009111413.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Brassica rapa]
Length=458

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 90/158 (57%), Gaps = 21/158 (13%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K IGKA
Sbjct  291  FTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKDIGKA  350

Query  649  LLPTPVSSKALpaptees------------------ppaaaesvsnvSIATPKEEAAPPV  524
            LLP   SSKALPAP   +                   PA   +      + P  EAA   
Sbjct  351  LLPPSTSSKALPAPAAVAAEAATTTTVEKPEPEPEVAPAIKAAAPAQVNSEPVMEAATAQ  410

Query  523  INSVAKTEVVQaeeaptat---ptPRPLSPYPNYPDFK  419
            + S   TE V  E A T        RPLSPY +YPD K
Sbjct  411  VTSEPATEQVITEPAKTEEKPKAYSRPLSPYASYPDLK  448



>gb|KJB24584.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=437

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAAI+Q+ SKK L+AE+RK+TL+QVDEFLNTKVAPKELVD++KQIG A
Sbjct  303  FSEIETILQLLGSAAIVQLVSKKFLYAENRKQTLKQVDEFLNTKVAPKELVDDVKQIGAA  362

Query  649  LLPTPVSSKAL  617
            LLPT  +SKAL
Sbjct  363  LLPTTTTSKAL  373



>ref|NP_567209.1| thylakoid rhodanese-like protein [Arabidopsis thaliana]
 sp|Q9M158.2|STR4_ARATH RecName: Full=Rhodanese-like domain-containing protein 4, chloroplastic; 
AltName: Full=Protein THYLAKOID RHODANESE-LIKE; 
AltName: Full=Sulfurtransferase 4; Short=AtStr4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL09804.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 gb|AAL15331.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 gb|AAM70579.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 dbj|BAE98457.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81973.1| thylakoid rhodanese-like protein [Arabidopsis thaliana]
Length=466

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K+IGKA
Sbjct  294  FTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKA  353

Query  649  LLPTPVSSKAL  617
            LLP   S+KAL
Sbjct  354  LLPQSTSNKAL  364



>emb|CDY48498.1| BnaA09g00250D [Brassica napus]
Length=461

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 89/158 (56%), Gaps = 21/158 (13%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K IGKA
Sbjct  294  FTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKDIGKA  353

Query  649  LLPTPVSSKALpaptees------------------ppaaaesvsnvSIATPKEEAAPPV  524
            LLP   SSKALPAP   +                   PA   +      + P  EAA   
Sbjct  354  LLPPSTSSKALPAPAAVAAEAATTTTVEKPEPEPEVAPAIKAAAPAQVNSEPVMEAATAQ  413

Query  523  INSVAKTEVV---QaeeaptatptPRPLSPYPNYPDFK  419
            + S   TE V    A+         RPLSPY +YPD K
Sbjct  414  VTSEPATEQVITEPAKTEEKPKAYSRPLSPYASYPDLK  451



>gb|EYU38901.1| hypothetical protein MIMGU_mgv1a006323mg [Erythranthe guttata]
Length=448

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 90/148 (61%), Gaps = 14/148 (9%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSAA++Q  SKKLLFAEDRK+T++Q++E LNTKVA KELV +I+QIGKA
Sbjct  294  FTEVETILQVLGSAALVQFVSKKLLFAEDRKQTIQQLEEVLNTKVAAKELVGDIQQIGKA  353

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATP--KEEAAP---------PVINSVAKT  503
            LLPTPV+SKALPAPT    P         +   P   EEA P         P +NSV K 
Sbjct  354  LLPTPVTSKALPAPTPIESPPQKPEPIPEAKIDPLKVEEAVPEVNSVPEAVPEVNSVPKA  413

Query  502  EVVQaeeaptatptPRPLSPYPNYPDFK  419
            E        +    PRP SPY NYPD K
Sbjct  414  E---EPVKESIPAFPRPQSPYTNYPDLK  438



>ref|XP_010534211.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Tarenaya hassleriana]
Length=430

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 89/137 (65%), Gaps = 12/137 (9%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLL  AA++Q  SKK LFAEDRK+TL+QVDEFLNTKVAPKELVDE+KQIGKA
Sbjct  296  FSEVETILQLL--AALVQFASKKFLFAEDRKQTLKQVDEFLNTKVAPKELVDELKQIGKA  353

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP   SSKALPAP  E+   +  + +  +I  P  E +P   NS A+TE          
Sbjct  354  LLPPTTSSKALPAPAAEAAAESPTTTATTTINKP--EPSPAEANS-ARTET-------KP  403

Query  469  tptPRPLSPYPNYPDFK  419
               PRPLSPY +YPD K
Sbjct  404  ESHPRPLSPYASYPDLK  420



>emb|CDY07169.1| BnaCnng01840D [Brassica napus]
Length=498

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 88/156 (56%), Gaps = 19/156 (12%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K IGKA
Sbjct  333  FTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKDIGKA  392

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIA---TPKEEAAPPVINS-----VAKTEVV  494
            LLP   SSKALPAP  E+                 T  + AAP  +NS      A  +V 
Sbjct  393  LLPPSTSSKALPAPAAEAAATTTSVEKPEPEPEVETAIKAAAPAQVNSEPVMEAATAQVT  452

Query  493  Q-----------aeeaptatptPRPLSPYPNYPDFK  419
                        ++         RPLSPY +YPD K
Sbjct  453  SEPAAEQVITEPSKTEEKPKSYSRPLSPYASYPDLK  488



>gb|ABR16588.1| unknown [Picea sitchensis]
Length=463

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++QVF K+LLFAEDRK+TL+Q+ +FL+TKVAPKELVDE+K+IGKA
Sbjct  312  FSEIETVLQLLGSAALLQVFVKRLLFAEDRKRTLQQIQDFLDTKVAPKELVDELKEIGKA  371

Query  649  LLP----TPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSV-AKTEVVQae  485
            LLP       ++ A+   T+++  +     + VS+++  E         V  K+E + + 
Sbjct  372  LLPKTADVATNNGAVVPRTQQANDSVTPDPAPVSVSSGAEIGDNSTPQPVPVKSETIVSN  431

Query  484  eaptatptPRPLSPYPNYPDFK  419
             A T+TP+PR LSPYP+YPDFK
Sbjct  432  VAVTSTPSPRSLSPYPHYPDFK  453



>ref|XP_010669158.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=469

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 94/168 (56%), Gaps = 38/168 (23%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+FSKKLL AEDRK+T +Q+DEF+ TKVAPKELV +IKQIG A
Sbjct  299  FTEMETVLQLLGSAALVQLFSKKLLLAEDRKQTFKQLDEFVTTKVAPKELVSDIKQIGTA  358

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKE--------------------EAAP  530
            LLP  V++KALPAP E +P   A + +  + A P E                    EA P
Sbjct  359  LLPITVNNKALPAPAEAAPTETAPTEAASAEAAPTEVAPAEATPEAAVVENSIQKAEAVP  418

Query  529  -----------PVINSVAKTEVVQaeeaptatptPRPLSPYPNYPDFK  419
                       P INS  + EV        A   PRPLSPY  YPDFK
Sbjct  419  EPQAEVPAEPAPEINSTPQNEV-------KAVSHPRPLSPYAAYPDFK  459



>ref|XP_006286665.1| hypothetical protein CARUB_v10002584mg [Capsella rubella]
 gb|EOA19563.1| hypothetical protein CARUB_v10002584mg [Capsella rubella]
Length=472

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q   KKLLFAEDRK TL+QVDEFLNTKVAPKELVDE+K IGKA
Sbjct  294  FTEIETILQLLGSAALVQFAGKKLLFAEDRKLTLKQVDEFLNTKVAPKELVDELKDIGKA  353

Query  649  LLPTPVSSKAL  617
            LLP   SSKAL
Sbjct  354  LLPPSTSSKAL  364



>emb|CDX91872.1| BnaC03g31740D [Brassica napus]
Length=1004

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 82/149 (55%), Gaps = 12/149 (8%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+   KLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K IGKA
Sbjct  763  FTEIETILQLLGSAALVQLAGNKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKDIGKA  822

Query  649  LLPTPVSSKALpapteesppaaa----------esvsnvSIATPKEEAAPP--VINSVAK  506
             LP   SSKALP P  E                ++      + P  EAA     +    K
Sbjct  823  FLPLSTSSKALPPPAAEGATTTTVDEKEPEPAIKAAIAQVNSEPAIEAATAQVTLEPATK  882

Query  505  TEVVQaeeaptatptPRPLSPYPNYPDFK  419
                Q          PRPLSPY +YPD K
Sbjct  883  AASEQVITEAKLKSYPRPLSPYASYPDLK  911



>emb|CDX74366.1| BnaA03g26810D [Brassica napus]
Length=466

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+   KLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K IGKA
Sbjct  294  FTEIETILQLLGSAALVQLAGNKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKDIGKA  353

Query  649  LLPTPVSSKAL  617
             LP   SSKAL
Sbjct  354  FLPLSTSSKAL  364



>ref|XP_010427922.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=476

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K+IGKA
Sbjct  294  FTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKA  353

Query  649  LLPTPVSSK  623
            LLP   SSK
Sbjct  354  LLPPSTSSK  362



>ref|XP_010456200.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=530

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K+IGKA
Sbjct  348  FTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKA  407

Query  649  LLPTPVSSK  623
            LLP   SSK
Sbjct  408  LLPPSTSSK  416



>ref|XP_008350777.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like domain-containing 
protein 4, chloroplastic [Malus domestica]
Length=420

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 82/133 (62%), Gaps = 25/133 (19%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVS  629
             QLLGSAA+ Q  S KLLFAEDRK+TL+QVD+FL TKVAPK+LVD+IKQIG A LP  V 
Sbjct  300  LQLLGSAALXQFVSXKLLFAEDRKETLQQVDKFLTTKVAPKDLVDDIKQIGTAFLPVTV-  358

Query  628  SKALpapteesppaaaesvsnvSIATPKEEAAP---PVINSVAKTEVVQaeeaptatptP  458
            SK LPAP                 A P  EAA    P  NSV K EV    +A +     
Sbjct  359  SKVLPAP-----------------AEPTVEAAAEATPEPNSVPKPEV----KAESLPRIS  397

Query  457  RPLSPYPNYPDFK  419
            +PLSP+P YPDFK
Sbjct  398  KPLSPFPYYPDFK  410



>ref|XP_010422759.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=603

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSAA++Q+  KKLLFAEDRK+TL+QVDEFLNTKVAPKELVDE+K+IGKA
Sbjct  421  FTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKA  480

Query  649  LLPTPVSSK  623
            LLP   SSK
Sbjct  481  LLPPSTSSK  489



>ref|NP_001131286.1| uncharacterized protein LOC100192599 [Zea mays]
 gb|ACF79627.1| unknown [Zea mays]
Length=476

 Score = 96.3 bits (238),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 80/131 (61%), Gaps = 19/131 (15%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              Q LGSAA++Q+   KLL+AEDR+KTL+Q+DEF N KVAPKEL+DEIK+IG+ALLP P 
Sbjct  284  LLQFLGSAAVVQLVVTKLLYAEDRQKTLKQIDEFFNKKVAPKELIDEIKEIGQALLPLPG  343

Query  631  SSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeaptatptPRP  452
             +K+      +   A A  V+    A P E+A      + A TE        +   TP P
Sbjct  344  DAKS------QPALATATQVAATQTAAPAEDA-----TAEATTE--------SDPATPTP  384

Query  451  LSPYPNYPDFK  419
            LSPY NYPD K
Sbjct  385  LSPYTNYPDLK  395


 Score = 26.6 bits (57),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  269  AATGLGVLAYTEIETLLQ  286



>ref|XP_008681054.1| PREDICTED: uncharacterized protein LOC100192599 isoform X1 [Zea 
mays]
 gb|AFW71053.1| hypothetical protein ZEAMMB73_066102 [Zea mays]
Length=466

 Score = 96.3 bits (238),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 80/131 (61%), Gaps = 19/131 (15%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              Q LGSAA++Q+   KLL+AEDR+KTL+Q+DEF N KVAPKEL+DEIK+IG+ALLP P 
Sbjct  284  LLQFLGSAAVVQLVVTKLLYAEDRQKTLKQIDEFFNKKVAPKELIDEIKEIGQALLPLPG  343

Query  631  SSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeaptatptPRP  452
             +K+      +   A A  V+    A P E+A      + A TE        +   TP P
Sbjct  344  DAKS------QPALATATQVAATQTAAPAEDA-----TAEATTE--------SDPATPTP  384

Query  451  LSPYPNYPDFK  419
            LSPY NYPD K
Sbjct  385  LSPYTNYPDLK  395


 Score = 26.6 bits (57),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  269  AATGLGVLAYTEIETLLQ  286



>ref|XP_006366560.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=479

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 75/137 (55%), Gaps = 29/137 (21%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSA +IQ+   KLLFAEDRK++L+QVDEFL  ++APKELV +IKQIG A
Sbjct  299  FSEAETLLQLLGSAGLIQLVRTKLLFAEDRKQSLQQVDEFLTKEIAPKELVGDIKQIGLA  358

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP PV+ K LP                   +    E+ P V  + +K E          
Sbjct  359  LLPVPVTRKNLPE------------------SAETSESVPEVDAASSKVEA---------  391

Query  469  tptPRPLSPYPNYPDFK  419
              +   LSPYPNYPD K
Sbjct  392  --SVETLSPYPNYPDLK  406



>ref|XP_007051589.1| Thylakoid rhodanese-like, putative isoform 4 [Theobroma cacao]
 gb|EOX95746.1| Thylakoid rhodanese-like, putative isoform 4 [Theobroma cacao]
Length=399

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPT  638
              QLLGSAAI+Q+ SKKLLFAEDRK+TL+QVDEFL TK+AP E VDEIKQIG ALLPT
Sbjct  305  ILQLLGSAAIVQLVSKKLLFAEDRKQTLQQVDEFLTTKIAPNEFVDEIKQIGVALLPT  362



>ref|XP_009336808.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336809.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=441

 Score = 94.7 bits (234),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 83/135 (61%), Gaps = 9/135 (7%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVS  629
             QLLGS A++Q  S K LFAEDRK+TL+QV++FL TKVAPK+LVD+IKQIG A LP  VS
Sbjct  301  LQLLGSVALVQFVSTKFLFAEDRKETLQQVEKFLTTKVAPKDLVDDIKQIGIAFLPVTVS  360

Query  628  S--KALpapteesppaaaesvsnvSIATPKEEAAPPVI---NSVAKTEVVQaeeaptatp  464
                A   PT E   A+       ++  PK EAA       NSV K EV    +A +   
Sbjct  361  KVLPAPAEPTPEPTAASDTVQKAEAVVEPKVEAAAEATQEPNSVPKPEV----KAESLPG  416

Query  463  tPRPLSPYPNYPDFK  419
              +PLSP+P YPDFK
Sbjct  417  ISKPLSPFPYYPDFK  431


 Score = 26.9 bits (58),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++EVETIL 
Sbjct  285  AATGLGFLAYTEVETILQ  302



>gb|EPS66030.1| hypothetical protein M569_08743, partial [Genlisea aurea]
Length=390

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 8/133 (6%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              Q+LGSAA++Q  + KLLFAEDRKKT++Q +E LNTKVAPKELV +I+ IGKALLP+PV
Sbjct  254  LLQILGSAALVQFVTTKLLFAEDRKKTIQQFEEVLNTKVAPKELVGDIQVIGKALLPSPV  313

Query  631  --SSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeaptatptP  458
              +SKALPAP   S  A  E  +    + P   AA  V  +     V +     TA    
Sbjct  314  TATSKALPAPAAFSGDAKYEESN----SAPPSGAAEGVPEASGGNSVHKPGGGSTAAAPV  369

Query  457  RPLSPYPNYPDFK  419
              LSPYPNYPD+K
Sbjct  370  --LSPYPNYPDYK  380



>ref|XP_003572147.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Brachypodium distachyon]
Length=471

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 84/132 (64%), Gaps = 21/132 (16%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVS  629
             Q LGSAA+IQ+ + KLL+A+DRKKTL+Q+D+F N K+APKELVDEIK+IG+ALLP+   
Sbjct  289  LQFLGSAAVIQLVTSKLLYAQDRKKTLQQIDDFFNKKIAPKELVDEIKEIGQALLPSSGD  348

Query  628  SKALpapteesppaaaesvsnvSIATPKE--EAAPPVINSVAKTEVVQaeeaptatptPR  455
             K+ PA TE +P AA  + + V+ ATP E    +PP   S                   R
Sbjct  349  VKSQPAATEAAPAAAIATDAPVAEATPAEAITESPPETPS-------------------R  389

Query  454  PLSPYPNYPDFK  419
            PLSP+ NYPD K
Sbjct  390  PLSPFANYPDLK  401



>ref|XP_004248078.2| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Solanum lycopersicum]
Length=486

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 77/137 (56%), Gaps = 29/137 (21%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   QLLGSA +IQ+ S KLLFA+DRK++L+QVDEFL  ++APKELV +IKQIG A
Sbjct  306  FSEAETLLQLLGSAGLIQLVSTKLLFAKDRKQSLQQVDEFLTKEIAPKELVGDIKQIGLA  365

Query  649  LLPTPVSSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeapta  470
            LLP PV+ K LP P E                    E+ P V  + +K E          
Sbjct  366  LLPVPVTRKNLPEPAET------------------SESVPEVDAASSKVEA---------  398

Query  469  tptPRPLSPYPNYPDFK  419
              +   LSPYPNYPD K
Sbjct  399  --SVETLSPYPNYPDLK  413



>ref|XP_009336810.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X3 [Pyrus x bretschneideri]
Length=421

 Score = 92.8 bits (229),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 80/133 (60%), Gaps = 25/133 (19%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVS  629
             QLLGS A++Q  S K LFAEDRK+TL+QV++FL TKVAPK+LVD+IKQIG A LP  V 
Sbjct  301  LQLLGSVALVQFVSTKFLFAEDRKETLQQVEKFLTTKVAPKDLVDDIKQIGIAFLPVTV-  359

Query  628  SKALpapteesppaaaesvsnvSIATPKEEAAPPVI---NSVAKTEVVQaeeaptatptP  458
            SK LPAP                 A P  EAA       NSV K EV    +A +     
Sbjct  360  SKVLPAP-----------------AEPTVEAAAEATQEPNSVPKPEV----KAESLPGIS  398

Query  457  RPLSPYPNYPDFK  419
            +PLSP+P YPDFK
Sbjct  399  KPLSPFPYYPDFK  411


 Score = 26.9 bits (58),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETIL  807
            AA G+G LA++EVETIL
Sbjct  285  AATGLGFLAYTEVETIL  301



>ref|XP_004951282.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Setaria italica]
Length=450

 Score = 91.3 bits (225),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 70/131 (53%), Gaps = 28/131 (21%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              Q LGSAAI+Q+ + KLL+AEDR+KTL+Q+DEF N KVAPK+LVDEIK+IG+ALLP P 
Sbjct  288  LLQFLGSAAIVQLVATKLLYAEDRQKTLKQIDEFFNKKVAPKDLVDEIKEIGQALLPLP-  346

Query  631  SSKALpapteesppaaaesvsnvSIATPKEEAAPPVINSVAKTEVVQaeeaptatptPRP  452
                                       PK +  P +                +A  TP P
Sbjct  347  -------------------------GEPKSQ--PALETGTPAAAPAAEATTESAPATPTP  379

Query  451  LSPYPNYPDFK  419
            LSPY NYPD K
Sbjct  380  LSPYTNYPDLK  390


 Score = 26.2 bits (56),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  273  AATGLGVLAYTEIETLLQ  290



>emb|CCJ09774.1| rhodanese homology domain protein, partial [Hirudo medicinalis]
Length=246

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -1

Query  829  FQR*KQFFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKA  650
            F   +   Q+LGSA +IQ  S KLLFAEDRK+TL++V+E LNTKV PKELV +IKQIG+A
Sbjct  127  FTEVETILQVLGSAGLIQFISTKLLFAEDRKRTLQEVEEVLNTKVVPKELVGDIKQIGRA  186

Query  649  LLPTPVSS  626
            +LP+ VSS
Sbjct  187  ILPSTVSS  194



>ref|XP_006648515.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Oryza brachyantha]
Length=350

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPT  638
             Q LGSAAI+Q+ + KL++AEDRKKTL+Q+DEF N KVAPKELVDEIK+IG+ALLP+
Sbjct  156  LQFLGSAAIVQLVASKLIYAEDRKKTLKQIDEFFNKKVAPKELVDEIKEIGQALLPS  212



>ref|XP_002451894.1| hypothetical protein SORBIDRAFT_04g009380 [Sorghum bicolor]
 gb|EES04870.1| hypothetical protein SORBIDRAFT_04g009380 [Sorghum bicolor]
Length=443

 Score = 90.1 bits (222),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              Q LGSAA++Q+   KLL+AEDR+KTL+Q+DEF N KVAPKELVDEIK+IG+ALLP P 
Sbjct  285  LLQFLGSAAVVQLVVTKLLYAEDRQKTLKQIDEFFNKKVAPKELVDEIKEIGQALLPLPS  344

Query  631  SSKA  620
             +K+
Sbjct  345  DAKS  348


 Score = 26.6 bits (57),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  270  AATGLGVLAYTEIETLLQ  287



>gb|AFW71054.1| hypothetical protein ZEAMMB73_066102 [Zea mays]
Length=437

 Score = 90.1 bits (222),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPV  632
              Q LGSAA++Q+   KLL+AEDR+KTL+Q+DEF N KVAPKEL+DEIK+IG+ALLP P 
Sbjct  284  LLQFLGSAAVVQLVVTKLLYAEDRQKTLKQIDEFFNKKVAPKELIDEIKEIGQALLPLPG  343

Query  631  SSKA  620
             +K+
Sbjct  344  DAKS  347


 Score = 26.6 bits (57),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  269  AATGLGVLAYTEIETLLQ  286



>ref|NP_001046473.1| Os02g0257300 [Oryza sativa Japonica Group]
 dbj|BAD27963.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAF08387.1| Os02g0257300 [Oryza sativa Japonica Group]
 gb|EAZ22465.1| hypothetical protein OsJ_06134 [Oryza sativa Japonica Group]
Length=478

 Score = 88.2 bits (217),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPT  638
             Q LGSAAI+Q+ + KL++AEDRK+TL+Q+D+F N KVAPKELVDEIK+IG+ALLP+
Sbjct  290  LQFLGSAAIVQLVASKLIYAEDRKRTLKQIDDFFNKKVAPKELVDEIKEIGQALLPS  346


 Score = 26.2 bits (56),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  274  AATGLGILAYTEIETVLQ  291



>gb|EAY85255.1| hypothetical protein OsI_06628 [Oryza sativa Indica Group]
Length=476

 Score = 85.1 bits (209),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPT  638
             Q LGSAAI+Q+ + KL++AEDRK+TL+Q+D+F N KVAPKELVDEIK+I +ALLP+
Sbjct  288  LQFLGSAAIVQLVASKLIYAEDRKRTLKQIDDFFNKKVAPKELVDEIKEISQALLPS  344


 Score = 26.2 bits (56),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  272  AATGLGILAYTEIETVLQ  289



>ref|XP_002991602.1| hypothetical protein SELMODRAFT_448468 [Selaginella moellendorffii]
 gb|EFJ07356.1| hypothetical protein SELMODRAFT_448468 [Selaginella moellendorffii]
Length=438

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLP  641
             QL+G+ A++Q+F+KK LFAEDRKKTL+Q+  FL+TKVAPKELV+EI+ +GKALLP
Sbjct  300  LQLVGTVALLQLFAKKFLFAEDRKKTLQQIKTFLDTKVAPKELVEEIQGVGKALLP  355



>ref|XP_002971531.1| hypothetical protein SELMODRAFT_441569 [Selaginella moellendorffii]
 gb|EFJ27280.1| hypothetical protein SELMODRAFT_441569 [Selaginella moellendorffii]
Length=438

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLP  641
             QL+G+ A++Q+F+KK LFAEDRKKTL+Q+  FL+TKVAPKELV+EI+ +GKALLP
Sbjct  300  LQLVGTVALLQLFAKKFLFAEDRKKTLQQIKTFLDTKVAPKELVEEIQGVGKALLP  355



>ref|XP_007051587.1| Thylakoid rhodanese-like, putative isoform 2 [Theobroma cacao]
 gb|EOX95744.1| Thylakoid rhodanese-like, putative isoform 2 [Theobroma cacao]
Length=379

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQI  659
              QLLGSAAI+Q+ SKKLLFAEDRK+TL+QVDEFL TK+AP E VDEI ++
Sbjct  305  ILQLLGSAAIVQLVSKKLLFAEDRKQTLQQVDEFLTTKIAPNEFVDEISKL  355



>ref|XP_001770053.1| predicted protein [Physcomitrella patens]
 gb|EDQ65229.1| predicted protein [Physcomitrella patens]
Length=567

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLP  641
             QLLG+ A +Q+F+K  LFAEDRKKT++++  FL+TK+APK+LVD++K+IG+ LLP
Sbjct  322  LQLLGTVAALQLFAKNFLFAEDRKKTIQELKTFLDTKIAPKDLVDDVKEIGRVLLP  377



>gb|EMS45759.1| hypothetical protein TRIUR3_22780 [Triticum urartu]
Length=302

 Score = 74.7 bits (182),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIK  665
             Q LGSAAI+Q+ + KL++AEDRKKTL+Q+D+F N K+APKELVDEIK
Sbjct  227  LQFLGSAAIVQLVASKLVYAEDRKKTLQQIDDFFNKKIAPKELVDEIK  274


 Score = 26.6 bits (57),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  211  AATGLGLLAYTEIETVLQ  228



>ref|XP_002875001.1| hypothetical protein ARALYDRAFT_352729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51260.1| hypothetical protein ARALYDRAFT_352729 [Arabidopsis lyrata subsp. 
lyrata]
Length=869

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -1

Query  754  FAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVSSKAL  617
            F EDRK+TL+QVDEFLNTKVAPKELVDE+K+IGKALLP   S+KAL
Sbjct  755  FTEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKALLPQSTSNKAL  800



>gb|AAB61039.1| A_IG002N01.31 gene product [Arabidopsis thaliana]
Length=968

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -1

Query  754  FAEDRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVSSKAL  617
            F EDRK+TL+QVDEFLNTKVAPKELVDE+K+IGKALLP   S+KAL
Sbjct  804  FTEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKALLPQSTSNKAL  849



>gb|EMT20251.1| hypothetical protein F775_01839 [Aegilops tauschii]
Length=291

 Score = 72.8 bits (177),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  808  FQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVDEIKQI  659
             Q LGS A+IQ+ + KL++AEDRKKTL+Q+D+F N K+APKELVDEIK +
Sbjct  221  LQFLGSTAVIQLVASKLVYAEDRKKTLQQIDDFFNKKIAPKELVDEIKVV  270


 Score = 26.6 bits (57),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  857  AAAGIGALAFSEVETILS  804
            AA G+G LA++E+ET+L 
Sbjct  205  AATGLGLLAYTEIETVLQ  222



>ref|XP_007051591.1| Thylakoid rhodanese-like, putative isoform 6 [Theobroma cacao]
 gb|EOX95748.1| Thylakoid rhodanese-like, putative isoform 6 [Theobroma cacao]
Length=353

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -1

Query  811  FFQLLGSAAIIQVFSKKLLFAEDRKKTLEQVDEFLNTKVAPKELVD  674
              QLLGSAAI+Q+ SKKLLFAEDRK+TL+QVDEFL TK+AP E VD
Sbjct  305  ILQLLGSAAIVQLVSKKLLFAEDRKQTLQQVDEFLTTKIAPNEFVD  350



>emb|CAB80914.1| hypothetical protein [Arabidopsis thaliana]
Length=457

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  745  DRKKTLEQVDEFLNTKVAPKELVDEIKQIGKALLPTPVSSKAL  617
            DRK+TL+QVDEFLNTKVAPKELVDE+K+IGKALLP   S+KAL
Sbjct  313  DRKQTLKQVDEFLNTKVAPKELVDELKEIGKALLPQSTSNKAL  355



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554