BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14103

Length=897
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008460421.1|  PREDICTED: probable polyamine transporter At...    318   8e-102   Cucumis melo [Oriental melon]
ref|XP_011651680.1|  PREDICTED: probable polyamine transporter At...    318   1e-101   Cucumis sativus [cucumbers]
gb|KGN58394.1|  hypothetical protein Csa_3G636430                       318   2e-101   Cucumis sativus [cucumbers]
ref|XP_011651678.1|  PREDICTED: probable polyamine transporter At...    319   3e-101   Cucumis sativus [cucumbers]
ref|XP_011651679.1|  PREDICTED: probable polyamine transporter At...    318   3e-101   Cucumis sativus [cucumbers]
ref|XP_011651677.1|  PREDICTED: probable polyamine transporter At...    318   3e-101   Cucumis sativus [cucumbers]
ref|XP_008460420.1|  PREDICTED: probable polyamine transporter At...    318   4e-101   
ref|XP_008460419.1|  PREDICTED: probable polyamine transporter At...    318   4e-101   
ref|XP_004144401.2|  PREDICTED: probable polyamine transporter At...    319   7e-101   Cucumis sativus [cucumbers]
ref|XP_011651676.1|  PREDICTED: probable polyamine transporter At...    319   8e-101   Cucumis sativus [cucumbers]
ref|XP_008460418.1|  PREDICTED: probable polyamine transporter At...    318   1e-100   Cucumis melo [Oriental melon]
ref|XP_008460417.1|  PREDICTED: probable polyamine transporter At...    319   1e-100   Cucumis melo [Oriental melon]
ref|XP_008460416.1|  PREDICTED: probable polyamine transporter At...    318   2e-100   Cucumis melo [Oriental melon]
ref|XP_009796220.1|  PREDICTED: probable polyamine transporter At...    314   2e-100   Nicotiana sylvestris
ref|XP_009796217.1|  PREDICTED: probable polyamine transporter At...    317   3e-100   Nicotiana sylvestris
emb|CDP19063.1|  unnamed protein product                                313   5e-100   Coffea canephora [robusta coffee]
ref|XP_009621514.1|  PREDICTED: probable polyamine transporter At...    313   5e-100   Nicotiana tomentosiformis
ref|XP_009621513.1|  PREDICTED: probable polyamine transporter At...    316   6e-100   Nicotiana tomentosiformis
ref|XP_009796218.1|  PREDICTED: probable polyamine transporter At...    315   9e-100   Nicotiana sylvestris
ref|XP_010518945.1|  PREDICTED: probable polyamine transporter At...    313   1e-99    Tarenaya hassleriana [spider flower]
ref|XP_002304384.2|  hypothetical protein POPTR_0003s10260g             313   2e-99    Populus trichocarpa [western balsam poplar]
ref|XP_009766610.1|  PREDICTED: probable polyamine transporter At...    311   3e-99    Nicotiana sylvestris
ref|XP_009766611.1|  PREDICTED: probable polyamine transporter At...    311   3e-99    Nicotiana sylvestris
ref|XP_009766609.1|  PREDICTED: probable polyamine transporter At...    313   4e-99    Nicotiana sylvestris
ref|XP_009760868.1|  PREDICTED: probable polyamine transporter At...    310   9e-99    Nicotiana sylvestris
ref|XP_007209988.1|  hypothetical protein PRUPE_ppa005222mg             310   2e-98    Prunus persica
ref|XP_002519879.1|  amino acid transporter, putative                   310   2e-98    Ricinus communis
ref|XP_010112986.1|  Solute carrier family 7 member 13                  309   3e-98    Morus notabilis
ref|XP_009615737.1|  PREDICTED: probable polyamine transporter At...    309   4e-98    Nicotiana tomentosiformis
ref|XP_010677491.1|  PREDICTED: probable polyamine transporter At...    309   4e-98    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009615736.1|  PREDICTED: probable polyamine transporter At...    311   4e-98    Nicotiana tomentosiformis
ref|XP_010677492.1|  PREDICTED: probable polyamine transporter At...    308   7e-98    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010324493.1|  PREDICTED: probable polyamine transporter At...    307   1e-97    Solanum lycopersicum
ref|XP_006364454.1|  PREDICTED: probable polyamine transporter At...    307   1e-97    Solanum tuberosum [potatoes]
ref|XP_004244429.1|  PREDICTED: probable polyamine transporter At...    309   1e-97    Solanum lycopersicum
ref|XP_006364453.1|  PREDICTED: probable polyamine transporter At...    308   1e-97    Solanum tuberosum [potatoes]
ref|XP_004245940.1|  PREDICTED: probable polyamine transporter At...    308   1e-97    Solanum lycopersicum
ref|XP_004245941.1|  PREDICTED: probable polyamine transporter At...    307   2e-97    Solanum lycopersicum
ref|XP_010677490.1|  PREDICTED: probable polyamine transporter At...    308   2e-97    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009597699.1|  PREDICTED: probable polyamine transporter At...    306   3e-97    Nicotiana tomentosiformis
ref|XP_004245938.1|  PREDICTED: probable polyamine transporter At...    308   3e-97    Solanum lycopersicum
ref|XP_009597698.1|  PREDICTED: probable polyamine transporter At...    306   4e-97    Nicotiana tomentosiformis
gb|ACD64194.1|  amino acid permease-like protein                        296   6e-97    Helianthus petiolaris
ref|XP_006361235.1|  PREDICTED: probable polyamine transporter At...    305   9e-97    Solanum tuberosum [potatoes]
ref|XP_011028020.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    306   9e-97    Populus euphratica
ref|XP_006432859.1|  hypothetical protein CICLE_v10000961mg             305   2e-96    Citrus clementina
gb|ACD64175.1|  amino acid permease-like protein                        295   2e-96    Helianthus petiolaris
gb|KJB71339.1|  hypothetical protein B456_011G117200                    304   2e-96    Gossypium raimondii
ref|XP_011075143.1|  PREDICTED: probable polyamine transporter At...    306   2e-96    Sesamum indicum [beniseed]
gb|ADE21339.1|  amino acid permease-like protein                        294   3e-96    Helianthus petiolaris
gb|ACD64196.1|  amino acid permease-like protein                        294   3e-96    Helianthus petiolaris
ref|XP_004300133.1|  PREDICTED: probable polyamine transporter At...    304   3e-96    Fragaria vesca subsp. vesca
gb|ACD64133.1|  amino acid permease-like protein                        294   3e-96    Helianthus annuus
ref|XP_003517084.1|  PREDICTED: probable polyamine transporter At...    304   3e-96    Glycine max [soybeans]
gb|ADE21353.1|  amino acid permease-like protein                        294   3e-96    Helianthus petiolaris
gb|KJB71338.1|  hypothetical protein B456_011G117200                    304   3e-96    Gossypium raimondii
gb|ADE21390.1|  amino acid permease-like protein                        294   3e-96    Helianthus neglectus
gb|ACD64167.1|  amino acid permease-like protein                        294   4e-96    Helianthus petiolaris
gb|ACD64195.1|  amino acid permease-like protein                        293   4e-96    Helianthus petiolaris
ref|XP_006573486.1|  PREDICTED: probable polyamine transporter At...    304   5e-96    Glycine max [soybeans]
gb|ADE21366.1|  amino acid permease-like protein                        293   5e-96    Helianthus petiolaris
gb|ACD64199.1|  amino acid permease-like protein                        293   5e-96    Bahiopsis lanata
gb|ACD64118.1|  amino acid permease-like protein                        293   5e-96    Helianthus annuus
gb|ACD64123.1|  amino acid permease-like protein                        293   6e-96    Helianthus annuus
gb|ACD64122.1|  amino acid permease-like protein                        293   6e-96    Helianthus annuus
gb|ADE21331.1|  amino acid permease-like protein                        293   7e-96    Helianthus petiolaris
gb|ACD64156.1|  amino acid permease-like protein                        293   8e-96    Helianthus annuus
gb|ACD64134.1|  amino acid permease-like protein                        293   9e-96    Helianthus annuus
gb|ACD64125.1|  amino acid permease-like protein                        293   9e-96    Helianthus annuus
gb|ADE21389.1|  amino acid permease-like protein                        293   1e-95    Helianthus neglectus
gb|ADE21346.1|  amino acid permease-like protein                        292   1e-95    Helianthus petiolaris
gb|ADE21360.1|  amino acid permease-like protein                        292   1e-95    Helianthus petiolaris
gb|ACD64189.1|  amino acid permease-like protein                        292   1e-95    Helianthus petiolaris
gb|ADE21352.1|  amino acid permease-like protein                        292   1e-95    Helianthus petiolaris
gb|ACD64147.1|  amino acid permease-like protein                        292   2e-95    Helianthus annuus
gb|ACD64117.1|  amino acid permease-like protein                        292   2e-95    Helianthus annuus
gb|ADE21345.1|  amino acid permease-like protein                        292   2e-95    Helianthus petiolaris
gb|KDP39761.1|  hypothetical protein JCGZ_02781                         301   2e-95    Jatropha curcas
gb|ADE21330.1|  amino acid permease-like protein                        291   2e-95    Helianthus petiolaris
ref|XP_012070512.1|  PREDICTED: probable polyamine transporter At...    302   2e-95    Jatropha curcas
gb|ACD64121.1|  amino acid permease-like protein                        291   2e-95    Helianthus annuus
ref|XP_011092634.1|  PREDICTED: probable polyamine transporter At...    304   2e-95    Sesamum indicum [beniseed]
ref|XP_009365754.1|  PREDICTED: probable polyamine transporter At...    304   3e-95    Pyrus x bretschneideri [bai li]
gb|ADE21329.1|  amino acid permease-like protein                        291   3e-95    Helianthus petiolaris
ref|XP_011092635.1|  PREDICTED: probable polyamine transporter At...    303   3e-95    Sesamum indicum [beniseed]
gb|ACD64130.1|  amino acid permease-like protein                        291   5e-95    Helianthus annuus
gb|ADE21347.1|  amino acid permease-like protein                        291   5e-95    Helianthus petiolaris
ref|XP_010538333.1|  PREDICTED: probable polyamine transporter At...    300   7e-95    Tarenaya hassleriana [spider flower]
gb|EYU29097.1|  hypothetical protein MIMGU_mgv1a003994mg                302   8e-95    Erythranthe guttata [common monkey flower]
ref|XP_010538332.1|  PREDICTED: probable polyamine transporter At...    300   1e-94    Tarenaya hassleriana [spider flower]
gb|KHN11826.1|  Putative transporter                                    300   1e-94    Glycine soja [wild soybean]
ref|XP_003534323.1|  PREDICTED: probable polyamine transporter At...    300   1e-94    Glycine max [soybeans]
ref|XP_008238050.1|  PREDICTED: probable polyamine transporter At...    300   1e-94    Prunus mume [ume]
gb|ADE21348.1|  amino acid permease-like protein                        290   1e-94    Helianthus petiolaris
ref|XP_008238049.1|  PREDICTED: probable polyamine transporter At...    300   1e-94    
gb|ADE21349.1|  amino acid permease-like protein                        290   1e-94    Helianthus petiolaris
ref|XP_006587639.1|  PREDICTED: probable polyamine transporter At...    301   1e-94    Glycine max [soybeans]
gb|AFK37373.1|  unknown                                                 299   2e-94    Lotus japonicus
gb|ADE21332.1|  amino acid permease-like protein                        289   2e-94    Helianthus petiolaris
ref|XP_008373488.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    299   2e-94    Malus domestica [apple tree]
ref|XP_010278806.1|  PREDICTED: probable polyamine transporter At...    299   2e-94    Nelumbo nucifera [Indian lotus]
gb|ADE21350.1|  amino acid permease-like protein                        288   3e-94    Helianthus petiolaris
gb|ADE21344.1|  amino acid permease-like protein                        289   4e-94    Helianthus petiolaris
ref|XP_006432851.1|  hypothetical protein CICLE_v10001087mg             298   4e-94    Citrus clementina
gb|ADE21340.1|  amino acid permease-like protein                        288   5e-94    Helianthus petiolaris
gb|ADE21337.1|  amino acid permease-like protein                        288   5e-94    Helianthus petiolaris
ref|XP_010918090.1|  PREDICTED: probable polyamine transporter At...    302   6e-94    Elaeis guineensis
gb|ADE21373.1|  amino acid permease-like protein                        288   8e-94    Helianthus petiolaris
ref|XP_006489916.1|  PREDICTED: probable polyamine transporter At...    290   2e-93    
ref|XP_006359232.1|  PREDICTED: probable polyamine transporter At...    296   2e-93    Solanum tuberosum [potatoes]
gb|ADE21357.1|  amino acid permease-like protein                        286   3e-93    Helianthus petiolaris
emb|CBI37465.3|  unnamed protein product                                293   3e-93    Vitis vinifera
ref|XP_004245811.1|  PREDICTED: probable polyamine transporter At...    295   4e-93    Solanum lycopersicum
gb|ADE21354.1|  amino acid permease-like protein                        285   8e-93    Helianthus petiolaris
ref|XP_008364484.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    293   9e-93    Malus domestica [apple tree]
ref|XP_009365777.1|  PREDICTED: probable polyamine transporter At...    288   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_008800007.1|  PREDICTED: probable polyamine transporter At...    296   2e-92    Phoenix dactylifera
ref|XP_007048590.1|  Amino acid permease family protein                 296   2e-92    Theobroma cacao [chocolate]
gb|KCW78428.1|  hypothetical protein EUGRSUZ_D02589                     294   2e-92    Eucalyptus grandis [rose gum]
gb|AES95554.2|  neutral amino acid transporter                          294   2e-92    Medicago truncatula
ref|XP_003612596.1|  Amino acid permease-like protein                   294   2e-92    
ref|XP_010054044.1|  PREDICTED: probable polyamine transporter At...    294   4e-92    Eucalyptus grandis [rose gum]
ref|XP_010665389.1|  PREDICTED: probable polyamine transporter At...    293   4e-92    Vitis vinifera
ref|XP_006307388.1|  hypothetical protein CARUB_v10009014mg             293   6e-92    Capsella rubella
ref|XP_002893692.1|  amino acid permease family protein                 293   1e-91    Arabidopsis lyrata subsp. lyrata
gb|ADE21401.1|  amino acid permease-like protein                        282   1e-91    Helianthus neglectus
ref|XP_010499733.1|  PREDICTED: probable polyamine transporter At...    293   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010054043.1|  PREDICTED: probable polyamine transporter At...    294   1e-91    Eucalyptus grandis [rose gum]
ref|XP_010499735.1|  PREDICTED: probable polyamine transporter At...    292   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_006415290.1|  hypothetical protein EUTSA_v10007456mg             292   1e-91    Eutrema salsugineum
ref|XP_006415289.1|  hypothetical protein EUTSA_v10007456mg             292   2e-91    Eutrema salsugineum
ref|XP_002263817.2|  PREDICTED: probable polyamine transporter At...    293   2e-91    Vitis vinifera
ref|XP_010478602.1|  PREDICTED: probable polyamine transporter At...    292   2e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010478600.1|  PREDICTED: probable polyamine transporter At...    292   2e-91    Camelina sativa [gold-of-pleasure]
ref|XP_009396111.1|  PREDICTED: probable polyamine transporter At...    291   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003572852.1|  PREDICTED: polyamine transporter PUT1-like         292   6e-91    Brachypodium distachyon [annual false brome]
ref|XP_010255748.1|  PREDICTED: probable polyamine transporter At...    290   7e-91    Nelumbo nucifera [Indian lotus]
ref|XP_004513415.1|  PREDICTED: probable polyamine transporter At...    290   7e-91    Cicer arietinum [garbanzo]
ref|XP_003548709.1|  PREDICTED: probable polyamine transporter At...    290   9e-91    Glycine max [soybeans]
gb|ADE21399.1|  amino acid permease-like protein                        279   2e-90    Helianthus neglectus
gb|ADE21391.1|  amino acid permease-like protein                        279   2e-90    Helianthus neglectus
ref|XP_010255749.1|  PREDICTED: probable polyamine transporter At...    291   2e-90    Nelumbo nucifera [Indian lotus]
ref|XP_009418587.1|  PREDICTED: probable polyamine transporter At...    289   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003631566.1|  PREDICTED: probable polyamine transporter At...    289   2e-90    Vitis vinifera
ref|XP_010646560.1|  PREDICTED: probable polyamine transporter At...    289   2e-90    Vitis vinifera
ref|XP_002280603.1|  PREDICTED: probable polyamine transporter At...    288   2e-90    Vitis vinifera
ref|NP_973947.1|  polyamine transporter 2                               289   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174466.1|  polyamine transporter 2                               289   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943633.1|  PREDICTED: probable polyamine transporter At...    288   3e-90    Elaeis guineensis
ref|XP_010943632.1|  PREDICTED: probable polyamine transporter At...    288   5e-90    Elaeis guineensis
ref|XP_007158143.1|  hypothetical protein PHAVU_002G128000g             288   5e-90    Phaseolus vulgaris [French bean]
emb|CBI37466.3|  unnamed protein product                                286   8e-90    Vitis vinifera
gb|KEH17211.1|  amino acid permease                                     293   8e-90    Medicago truncatula
ref|XP_009114955.1|  PREDICTED: probable polyamine transporter At...    287   9e-90    Brassica rapa
emb|CDY12285.1|  BnaA09g24850D                                          288   9e-90    Brassica napus [oilseed rape]
ref|XP_010461005.1|  PREDICTED: probable polyamine transporter At...    287   1e-89    Camelina sativa [gold-of-pleasure]
gb|ADE21397.1|  amino acid permease-like protein                        277   1e-89    Helianthus neglectus
ref|XP_009114953.1|  PREDICTED: probable polyamine transporter At...    288   1e-89    Brassica rapa
ref|XP_010461004.1|  PREDICTED: probable polyamine transporter At...    288   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_007156318.1|  hypothetical protein PHAVU_003G276300g             287   1e-89    Phaseolus vulgaris [French bean]
ref|XP_008775610.1|  PREDICTED: probable polyamine transporter At...    287   1e-89    Phoenix dactylifera
ref|XP_010665391.1|  PREDICTED: probable polyamine transporter At...    287   2e-89    Vitis vinifera
ref|XP_008775609.1|  PREDICTED: probable polyamine transporter At...    287   2e-89    Phoenix dactylifera
ref|XP_010423447.1|  PREDICTED: polyamine transporter RMV1              286   5e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006287622.1|  hypothetical protein CARUB_v10000834mg             286   5e-89    Capsella rubella
ref|XP_010112984.1|  Y+L amino acid transporter 2                       285   7e-89    Morus notabilis
ref|XP_004512388.1|  PREDICTED: probable polyamine transporter At...    284   7e-89    
gb|ADE21386.1|  amino acid permease-like protein                        274   1e-88    Helianthus neglectus
ref|XP_004512382.1|  PREDICTED: probable polyamine transporter At...    285   1e-88    
ref|XP_004512384.1|  PREDICTED: probable polyamine transporter At...    284   2e-88    Cicer arietinum [garbanzo]
ref|XP_010452471.1|  PREDICTED: polyamine transporter RMV1-like         284   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_004953578.1|  PREDICTED: polyamine transporter PUT1-like i...    282   9e-88    
ref|XP_004295555.2|  PREDICTED: probable polyamine transporter At...    285   1e-87    Fragaria vesca subsp. vesca
ref|XP_010491097.1|  PREDICTED: polyamine transporter RMV1-like         282   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_004953577.1|  PREDICTED: polyamine transporter PUT1-like i...    283   2e-87    Setaria italica
gb|EMT01924.1|  Putative transporter                                    281   4e-87    Aegilops tauschii
gb|KEH44393.1|  neutral amino acid transporter                          280   5e-87    Medicago truncatula
ref|XP_002871174.1|  amino acid permease family protein                 280   7e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_009420373.1|  PREDICTED: polyamine transporter PUT1-like         280   8e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647741.1|  PREDICTED: polyamine transporter PUT1-like         281   1e-86    Oryza brachyantha
dbj|BAK02239.1|  predicted protein                                      280   1e-86    Hordeum vulgare subsp. vulgare [barley]
emb|CBI37826.3|  unnamed protein product                                290   2e-86    Vitis vinifera
ref|XP_011463407.1|  PREDICTED: polyamine transporter RMV1-like i...    279   2e-86    Fragaria vesca subsp. vesca
ref|XP_008236066.1|  PREDICTED: probable polyamine transporter At...    279   2e-86    Prunus mume [ume]
ref|XP_008236067.1|  PREDICTED: probable polyamine transporter At...    278   2e-86    Prunus mume [ume]
ref|XP_011463405.1|  PREDICTED: polyamine transporter RMV1-like i...    279   3e-86    Fragaria vesca subsp. vesca
ref|NP_196182.1|  polyamine uptake transporter 3                        278   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001047840.1|  Os02g0700500                                       280   4e-86    
ref|XP_007199817.1|  hypothetical protein PRUPE_ppa005214mg             277   8e-86    Prunus persica
ref|XP_010540726.1|  PREDICTED: probable polyamine transporter At...    276   2e-85    Tarenaya hassleriana [spider flower]
gb|ERN15644.1|  hypothetical protein AMTR_s00048p00199050               276   2e-85    Amborella trichopoda
ref|XP_006854177.2|  PREDICTED: probable polyamine transporter At...    276   2e-85    Amborella trichopoda
ref|XP_010540724.1|  PREDICTED: probable polyamine transporter At...    277   3e-85    Tarenaya hassleriana [spider flower]
emb|CDX70141.1|  BnaA10g24900D                                          276   3e-85    Brassica napus [oilseed rape]
ref|XP_010918087.1|  PREDICTED: polyamine transporter PUT1-like i...    274   8e-85    Elaeis guineensis
ref|XP_006399022.1|  hypothetical protein EUTSA_v10013376mg             275   9e-85    Eutrema salsugineum
gb|ABF97257.1|  amino acid permease family protein, putative, exp...    274   1e-84    Oryza sativa Japonica Group [Japonica rice]
gb|AAR10855.1|  putative amino acid permease                            274   1e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452695.1|  hypothetical protein SORBIDRAFT_04g030810          275   2e-84    Sorghum bicolor [broomcorn]
ref|XP_003555208.2|  PREDICTED: probable polyamine transporter At...    273   2e-84    Glycine max [soybeans]
ref|XP_006659161.1|  PREDICTED: probable polyamine transporter At...    273   2e-84    Oryza brachyantha
ref|XP_004972759.1|  PREDICTED: probable polyamine transporter At...    274   2e-84    Setaria italica
ref|XP_010918086.1|  PREDICTED: probable polyamine transporter At...    274   4e-84    Elaeis guineensis
emb|CDX98852.1|  BnaC09g49830D                                          273   5e-84    Brassica napus [oilseed rape]
gb|EAZ27574.1|  hypothetical protein OsJ_11523                          274   5e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008358365.1|  PREDICTED: probable polyamine transporter At...    272   6e-84    Malus domestica [apple tree]
gb|KHN11505.1|  Putative transporter                                    271   6e-84    Glycine soja [wild soybean]
gb|EAY90746.1|  hypothetical protein OsI_12346                          273   6e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_009122163.1|  PREDICTED: polyamine transporter RMV1              272   9e-84    Brassica rapa
ref|XP_008358364.1|  PREDICTED: probable polyamine transporter At...    272   1e-83    Malus domestica [apple tree]
ref|XP_002443914.1|  hypothetical protein SORBIDRAFT_07g004285          271   2e-83    Sorghum bicolor [broomcorn]
ref|NP_001050538.1|  Os03g0576900                                       273   2e-83    
ref|XP_004290749.1|  PREDICTED: probable polyamine transporter At...    270   2e-83    Fragaria vesca subsp. vesca
ref|XP_009340496.1|  PREDICTED: probable polyamine transporter At...    270   2e-83    Pyrus x bretschneideri [bai li]
ref|XP_009340495.1|  PREDICTED: probable polyamine transporter At...    271   3e-83    Pyrus x bretschneideri [bai li]
ref|XP_004290748.1|  PREDICTED: probable polyamine transporter At...    270   3e-83    Fragaria vesca subsp. vesca
ref|XP_011088641.1|  PREDICTED: probable polyamine transporter At...    270   4e-83    Sesamum indicum [beniseed]
ref|XP_010906713.1|  PREDICTED: polyamine transporter RMV1              272   4e-83    Elaeis guineensis
ref|XP_011088640.1|  PREDICTED: probable polyamine transporter At...    270   4e-83    Sesamum indicum [beniseed]
gb|EYU37507.1|  hypothetical protein MIMGU_mgv1a019424mg                271   4e-83    Erythranthe guttata [common monkey flower]
ref|XP_007041749.1|  Amino acid permease family protein                 270   8e-83    Theobroma cacao [chocolate]
ref|XP_010086840.1|  putative transporter                               269   1e-82    Morus notabilis
ref|XP_009355626.1|  PREDICTED: probable polyamine transporter At...    268   1e-82    Pyrus x bretschneideri [bai li]
ref|XP_006432849.1|  hypothetical protein CICLE_v10003646mg             268   1e-82    Citrus clementina
ref|XP_009355624.1|  PREDICTED: probable polyamine transporter At...    268   2e-82    Pyrus x bretschneideri [bai li]
ref|XP_006432847.1|  hypothetical protein CICLE_v10000996mg             268   2e-82    Citrus clementina
ref|XP_003573441.1|  PREDICTED: probable polyamine transporter At...    268   2e-82    Brachypodium distachyon [annual false brome]
gb|AGT16029.1|  permease                                                267   6e-82    Saccharum hybrid cultivar R570
gb|KJB77779.1|  hypothetical protein B456_012G156700                    267   6e-82    Gossypium raimondii
gb|KJB77778.1|  hypothetical protein B456_012G156700                    267   6e-82    Gossypium raimondii
gb|KCW55585.1|  hypothetical protein EUGRSUZ_I01455                     266   8e-82    Eucalyptus grandis [rose gum]
gb|AGT16601.1|  amino acid permease-like protein                        266   9e-82    Saccharum hybrid cultivar R570
ref|XP_008347507.1|  PREDICTED: probable polyamine transporter At...    266   1e-81    Malus domestica [apple tree]
ref|XP_009588090.1|  PREDICTED: probable polyamine transporter At...    266   1e-81    Nicotiana tomentosiformis
ref|XP_008347506.1|  PREDICTED: probable polyamine transporter At...    266   2e-81    Malus domestica [apple tree]
gb|AGT16594.1|  amino acid permease-like protein                        263   2e-81    Saccharum hybrid cultivar R570
ref|XP_010028769.1|  PREDICTED: probable polyamine transporter At...    266   2e-81    Eucalyptus grandis [rose gum]
ref|XP_010028770.1|  PREDICTED: probable polyamine transporter At...    265   3e-81    Eucalyptus grandis [rose gum]
ref|XP_008661395.1|  PREDICTED: uncharacterized protein LOC100193...    265   4e-81    Zea mays [maize]
ref|XP_008661396.1|  PREDICTED: uncharacterized protein LOC100193...    265   5e-81    Zea mays [maize]
ref|XP_009792834.1|  PREDICTED: probable polyamine transporter At...    264   5e-81    Nicotiana sylvestris
ref|XP_012077719.1|  PREDICTED: probable polyamine transporter At...    262   7e-81    Jatropha curcas
ref|XP_008800055.1|  PREDICTED: polyamine transporter RMV1-like         265   1e-80    
dbj|BAK08341.1|  predicted protein                                      264   1e-80    Hordeum vulgare subsp. vulgare [barley]
ref|XP_010315394.1|  PREDICTED: probable polyamine transporter At...    263   2e-80    Solanum lycopersicum
ref|XP_012077717.1|  PREDICTED: probable polyamine transporter At...    263   2e-80    Jatropha curcas
dbj|BAJ89860.1|  predicted protein                                      264   2e-80    Hordeum vulgare subsp. vulgare [barley]
ref|XP_002510495.1|  amino acid transporter, putative                   260   1e-79    Ricinus communis
ref|XP_011046633.1|  PREDICTED: probable polyamine transporter At...    260   2e-79    Populus euphratica
ref|XP_002306199.1|  hypothetical protein POPTR_0004s18450g             259   3e-79    Populus trichocarpa [western balsam poplar]
ref|XP_006364505.1|  PREDICTED: probable polyamine transporter At...    259   4e-79    Solanum tuberosum [potatoes]
gb|AGT16030.1|  permease                                                260   5e-79    Saccharum hybrid cultivar R570
gb|EMT25821.1|  Putative transporter                                    259   8e-79    Aegilops tauschii
gb|KHG19896.1|  Transporter protein                                     257   5e-78    Gossypium arboreum [tree cotton]
gb|KDO68126.1|  hypothetical protein CISIN_1g012131mg                   255   2e-77    Citrus sinensis [Valencia orange]
ref|XP_006486704.1|  PREDICTED: probable polyamine transporter At...    255   2e-77    Citrus sinensis [Valencia orange]
ref|XP_002893691.1|  amino acid permease family protein                 255   3e-77    Arabidopsis lyrata subsp. lyrata
ref|XP_010665400.1|  PREDICTED: probable polyamine transporter At...    255   3e-77    Vitis vinifera
gb|EPS62042.1|  hypothetical protein M569_12750                         256   4e-77    Genlisea aurea
ref|XP_009114951.1|  PREDICTED: probable polyamine transporter At...    252   3e-76    Brassica rapa
emb|CAN68297.1|  hypothetical protein VITISV_033563                     241   6e-76    Vitis vinifera
ref|XP_010541175.1|  PREDICTED: probable polyamine transporter At...    252   7e-76    Tarenaya hassleriana [spider flower]
gb|EYU37980.1|  hypothetical protein MIMGU_mgv1a005577mg                251   1e-75    Erythranthe guttata [common monkey flower]
ref|XP_009588115.1|  PREDICTED: probable polyamine transporter At...    244   1e-75    Nicotiana tomentosiformis
ref|NP_174465.1|  polyamine transporter 1                               249   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422553.1|  hypothetical protein CICLE_v10029887mg             257   9e-75    Citrus clementina
ref|XP_006415291.1|  hypothetical protein EUTSA_v10007550mg             248   9e-75    Eutrema salsugineum
ref|XP_006307381.1|  hypothetical protein CARUB_v10009007mg             247   2e-74    Capsella rubella
ref|XP_009114952.1|  PREDICTED: probable polyamine transporter At...    244   2e-73    Brassica rapa
ref|XP_010918085.1|  PREDICTED: polyamine transporter RMV1-like         244   7e-73    Elaeis guineensis
ref|XP_006854176.1|  PREDICTED: probable polyamine transporter At...    239   3e-71    Amborella trichopoda
ref|XP_006432839.1|  hypothetical protein CICLE_v10001693mg             235   4e-71    Citrus clementina
ref|XP_006489917.1|  PREDICTED: probable polyamine transporter At...    235   5e-71    
ref|XP_006432858.1|  hypothetical protein CICLE_v10001183mg             237   7e-71    Citrus clementina
ref|XP_010256195.1|  PREDICTED: probable polyamine transporter At...    232   1e-68    Nelumbo nucifera [Indian lotus]
gb|EPS73063.1|  hypothetical protein M569_01691                         227   9e-67    Genlisea aurea
emb|CBI37467.3|  unnamed protein product                                221   2e-65    Vitis vinifera
ref|XP_002977818.1|  hypothetical protein SELMODRAFT_107507             223   6e-65    Selaginella moellendorffii
ref|XP_008780916.1|  PREDICTED: probable polyamine transporter At...    220   1e-63    Phoenix dactylifera
ref|XP_009397725.1|  PREDICTED: probable polyamine transporter At...    219   2e-63    
ref|XP_009388921.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    218   8e-63    
ref|XP_002979502.1|  hypothetical protein SELMODRAFT_233380             216   1e-62    
ref|XP_010939690.1|  PREDICTED: probable polyamine transporter At...    217   2e-62    
gb|ABR17588.1|  unknown                                                 212   1e-60    
gb|AFG48770.1|  hypothetical protein 0_2381_01                          200   3e-60    
gb|KDP44475.1|  hypothetical protein JCGZ_16308                         211   4e-60    
ref|XP_012093098.1|  PREDICTED: probable polyamine transporter At...    210   5e-60    
ref|XP_006369738.1|  hypothetical protein POPTR_0001s30330g             204   2e-59    
ref|XP_010272225.1|  PREDICTED: probable polyamine transporter At...    209   2e-59    
ref|XP_009776137.1|  PREDICTED: probable polyamine transporter At...    207   5e-59    
ref|XP_009616897.1|  PREDICTED: probable polyamine transporter At...    206   2e-58    
ref|XP_002994449.1|  hypothetical protein SELMODRAFT_138613             204   5e-58    
ref|XP_004136943.1|  PREDICTED: probable polyamine transporter At...    205   5e-58    
ref|XP_002972101.1|  hypothetical protein SELMODRAFT_96930              204   5e-58    
emb|CDY42190.1|  BnaA01g26050D                                          204   6e-58    
ref|XP_011030361.1|  PREDICTED: probable polyamine transporter At...    205   7e-58    
ref|NP_001131678.1|  uncharacterized protein LOC100193038               200   7e-58    
ref|XP_001778490.1|  predicted protein                                  204   7e-58    
ref|XP_002527494.1|  amino acid transporter, putative                   204   8e-58    
ref|XP_010065932.1|  PREDICTED: probable polyamine transporter At...    203   1e-57    
ref|XP_009111708.1|  PREDICTED: probable polyamine transporter At...    205   1e-57    
emb|CDY69762.1|  BnaCnng65210D                                          203   2e-57    
gb|ERN03649.1|  hypothetical protein AMTR_s00144p00042270               202   4e-57    
ref|XP_006841974.2|  PREDICTED: probable polyamine transporter At...    202   4e-57    
ref|XP_004289790.1|  PREDICTED: probable polyamine transporter At...    202   5e-57    
ref|XP_010507799.1|  PREDICTED: probable polyamine transporter At...    201   9e-57    
ref|XP_001781187.1|  predicted protein                                  201   1e-56    
gb|EMT06262.1|  Putative transporter                                    201   2e-56    
ref|NP_188589.1|  polyamine uptake transporter 5                        200   2e-56    
ref|XP_010487901.1|  PREDICTED: probable polyamine transporter At...    200   3e-56    
ref|XP_008455023.1|  PREDICTED: probable polyamine transporter At...    200   4e-56    
ref|XP_006406487.1|  hypothetical protein EUTSA_v10020631mg             199   6e-56    
ref|XP_010519287.1|  PREDICTED: probable polyamine transporter At...    199   6e-56    
ref|XP_002885315.1|  amino acid permease family protein                 198   1e-55    
ref|XP_010105647.1|  putative transporter                               198   2e-55    
ref|XP_010466107.1|  PREDICTED: probable polyamine transporter At...    197   3e-55    
dbj|BAJ96274.1|  predicted protein                                      196   3e-55    
ref|XP_006379295.1|  hypothetical protein POPTR_0009s14050g             192   6e-55    
ref|XP_010099086.1|  putative transporter                               196   7e-55    
ref|XP_002300260.2|  hypothetical protein POPTR_0001s30330g             196   9e-55    
dbj|BAJ93128.1|  predicted protein                                      196   9e-55    
ref|XP_011088055.1|  PREDICTED: probable polyamine transporter At...    196   1e-54    
gb|EPS65620.1|  hypothetical protein M569_09154                         194   3e-54    
ref|XP_001781817.1|  predicted protein                                  194   4e-54    
ref|XP_002978981.1|  hypothetical protein SELMODRAFT_418809             193   7e-54    
ref|XP_006353964.1|  PREDICTED: probable polyamine transporter At...    193   1e-53    
ref|XP_004962993.1|  PREDICTED: probable polyamine transporter At...    192   2e-53    
ref|XP_002986451.1|  hypothetical protein SELMODRAFT_44111              190   6e-53    
ref|XP_004511306.1|  PREDICTED: probable polyamine transporter At...    190   2e-52    
ref|XP_004248916.1|  PREDICTED: probable polyamine transporter At...    189   3e-52    
emb|CDO97262.1|  unnamed protein product                                187   4e-52    
gb|EAY83657.1|  hypothetical protein OsI_38883                          189   4e-52    
ref|XP_006486939.1|  PREDICTED: probable polyamine transporter At...    189   4e-52    
ref|XP_002442391.1|  hypothetical protein SORBIDRAFT_08g019330          189   4e-52    
gb|AGT16597.1|  amino acid permease-like protein                        177   2e-51    
gb|KDO57858.1|  hypothetical protein CISIN_1g010647mg                   188   2e-51    
ref|XP_006422852.1|  hypothetical protein CICLE_v10028240mg             187   2e-51    
ref|XP_003610625.1|  Neutral amino acid transport protein               187   3e-51    
ref|XP_003516771.1|  PREDICTED: probable polyamine transporter At...    186   5e-51    
ref|XP_010326897.1|  PREDICTED: probable polyamine transporter At...    181   9e-51    
ref|XP_007157217.1|  hypothetical protein PHAVU_002G052400g             185   1e-50    
gb|ACL52765.1|  unknown                                                 185   2e-50    
emb|CBI22474.3|  unnamed protein product                                185   2e-50    
gb|EYU37587.1|  hypothetical protein MIMGU_mgv1a005195mg                185   2e-50    
gb|ACN28877.1|  unknown                                                 185   2e-50    
ref|XP_002263556.1|  PREDICTED: probable polyamine transporter At...    185   2e-50    
ref|XP_003578549.1|  PREDICTED: probable polyamine transporter At...    184   2e-50    
emb|CDY46166.1|  BnaA05g20530D                                          184   3e-50    
ref|XP_009145774.1|  PREDICTED: probable polyamine transporter At...    184   3e-50    
ref|XP_007042603.1|  Amino acid permease family protein isoform 1       184   4e-50    
ref|XP_006664676.1|  PREDICTED: probable polyamine transporter At...    187   4e-50    
ref|XP_008236431.1|  PREDICTED: probable polyamine transporter At...    184   5e-50    
ref|NP_001144770.1|  uncharacterized protein LOC100277833               183   6e-50    
ref|XP_007201783.1|  hypothetical protein PRUPE_ppa004526mg             183   9e-50    
ref|XP_008356440.1|  PREDICTED: probable polyamine transporter At...    171   1e-49    
ref|XP_006297570.1|  hypothetical protein CARUB_v10013593mg             182   1e-49    
ref|XP_002313902.2|  amino acid permease family protein                 182   1e-49    
ref|XP_009335393.1|  PREDICTED: probable polyamine transporter At...    182   2e-49    
ref|XP_006353965.1|  PREDICTED: probable polyamine transporter At...    177   3e-49    
ref|XP_011001745.1|  PREDICTED: probable polyamine transporter At...    181   7e-49    
ref|XP_010113153.1|  Solute carrier family 7 member 13                  172   2e-48    
ref|XP_008346359.1|  PREDICTED: probable polyamine transporter At...    180   2e-48    
gb|EMS56806.1|  hypothetical protein TRIUR3_08188                       174   3e-48    
emb|CDY63076.1|  BnaCnng41370D                                          169   9e-46    
emb|CDY12286.1|  BnaA09g24860D                                          170   1e-45    
emb|CDX99215.1|  BnaC05g33300D                                          171   2e-45    
ref|XP_010501724.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    172   5e-45    
gb|KJB77644.1|  hypothetical protein B456_012G148400                    170   7e-45    
gb|KHG13061.1|  Transporter protein                                     169   2e-44    
gb|AGT16592.1|  amino acid permease-like protein                        157   1e-43    
gb|KHN37384.1|  hypothetical protein glysoja_013599                     152   4e-40    
emb|CBJ26061.1|  conserved unknown protein                              149   1e-37    
ref|XP_002953866.1|  amino acid carrier 4                               148   2e-37    
ref|XP_002465208.1|  hypothetical protein SORBIDRAFT_01g034150          145   3e-36    
tpg|DAA45545.1|  TPA: hypothetical protein ZEAMMB73_323452              138   1e-35    
ref|XP_002296569.1|  amino acid/polyamine transporter                   143   2e-35    
gb|ABK24764.1|  unknown                                                 142   6e-35    
ref|XP_002465211.1|  hypothetical protein SORBIDRAFT_01g034170          142   7e-35    
gb|ABK24579.1|  unknown                                                 141   1e-34    
gb|ACO58931.1|  amino acid permease family-like protein                 132   2e-34    
gb|ACO58934.1|  amino acid permease family-like protein                 131   2e-34    
ref|XP_011010674.1|  PREDICTED: probable polyamine transporter At...    140   2e-34    
gb|ACO58920.1|  amino acid permease family-like protein                 131   3e-34    
ref|XP_011048235.1|  PREDICTED: probable polyamine transporter At...    140   3e-34    
gb|ACO58929.1|  amino acid permease family-like protein                 131   3e-34    
ref|XP_009146468.1|  PREDICTED: probable polyamine transporter At...    140   3e-34    
gb|ACO58948.1|  amino acid permease family-like protein                 130   4e-34    
ref|NP_001151329.1|  cationic amino acid transporter                    140   4e-34    
ref|XP_004986959.1|  PREDICTED: probable polyamine transporter At...    140   4e-34    
ref|XP_010468155.1|  PREDICTED: probable polyamine transporter At...    139   5e-34    
gb|ACO58927.1|  amino acid permease family-like protein                 130   5e-34    
emb|CDY23626.1|  BnaC05g39680D                                          139   7e-34    
gb|ACO58938.1|  amino acid permease family-like protein                 130   7e-34    
ref|XP_002299117.1|  amino acid permease family protein                 139   8e-34    
ref|XP_006407192.1|  hypothetical protein EUTSA_v10020694mg             138   9e-34    
ref|XP_008236794.1|  PREDICTED: probable polyamine transporter At...    139   9e-34    
gb|EMT07071.1|  Putative transporter                                    139   1e-33    
gb|EMS65266.1|  Solute carrier family 7 member 13                       139   1e-33    
gb|KFK38707.1|  hypothetical protein AALP_AA3G149400                    138   1e-33    
ref|XP_002527074.1|  amino acid transporter, putative                   137   1e-33    
ref|XP_005644416.1|  amino acid transporter                             138   2e-33    
emb|CDX97502.1|  BnaA05g25770D                                          138   2e-33    
ref|XP_011089703.1|  PREDICTED: probable polyamine transporter At...    137   2e-33    
ref|XP_007205142.1|  hypothetical protein PRUPE_ppa005207mg             137   4e-33    
ref|XP_010500780.1|  PREDICTED: probable polyamine transporter At...    137   4e-33    
ref|XP_011089741.1|  PREDICTED: probable polyamine transporter At...    137   4e-33    
ref|NP_001152250.1|  cationic amino acid transporter                    137   4e-33    
ref|XP_010276325.1|  PREDICTED: probable polyamine transporter At...    137   5e-33    
ref|XP_010673501.1|  PREDICTED: probable polyamine transporter At...    136   5e-33    
gb|EWM24218.1|  amino acid permease family protein                      137   6e-33    
ref|XP_006297574.1|  hypothetical protein CARUB_v10013597mg             136   7e-33    
ref|XP_003561594.1|  PREDICTED: probable polyamine transporter At...    136   9e-33    
ref|XP_006364155.1|  PREDICTED: probable polyamine transporter At...    135   1e-32    
ref|XP_008789352.1|  PREDICTED: probable polyamine transporter At...    135   1e-32    
gb|ERN00793.1|  hypothetical protein AMTR_s00217p00020070               135   1e-32    
ref|XP_010932955.1|  PREDICTED: probable polyamine transporter At...    135   1e-32    
ref|XP_010044954.1|  PREDICTED: probable polyamine transporter At...    135   1e-32    
ref|XP_006838224.2|  PREDICTED: probable polyamine transporter At...    135   2e-32    
ref|XP_011461674.1|  PREDICTED: probable polyamine transporter At...    135   2e-32    
ref|XP_002527073.1|  amino acid transporter, putative                   135   2e-32    
gb|AFK39326.1|  unknown                                                 130   2e-32    
ref|XP_002884975.1|  amino acid permease family protein                 134   2e-32    
gb|EMT21767.1|  hypothetical protein F775_02768                         130   3e-32    
ref|XP_003561595.2|  PREDICTED: probable polyamine transporter At...    134   3e-32    
emb|CDX82530.1|  BnaA03g32910D                                          134   4e-32    
ref|XP_008358842.1|  PREDICTED: probable polyamine transporter At...    134   4e-32    
ref|XP_009135313.1|  PREDICTED: probable polyamine transporter At...    134   4e-32    
ref|XP_009612070.1|  PREDICTED: probable polyamine transporter At...    134   4e-32    
ref|XP_010489808.1|  PREDICTED: probable polyamine transporter At...    136   4e-32    
ref|XP_009804521.1|  PREDICTED: probable polyamine transporter At...    134   5e-32    
ref|XP_010098572.1|  Arginine/agmatine antiporter                       134   6e-32    
ref|XP_002527070.1|  amino acid transporter, putative                   133   6e-32    
ref|XP_012067119.1|  PREDICTED: probable polyamine transporter At...    133   7e-32    
emb|CDX75721.1|  BnaC03g38040D                                          133   7e-32    
ref|XP_009364121.1|  PREDICTED: probable polyamine transporter At...    132   1e-31    
ref|NP_566460.1|  POLYAMINE UPTAKE TRANSPORTER 4                        132   1e-31    
ref|NP_001050218.1|  Os03g0375900                                       127   1e-31    
gb|EYU31689.1|  hypothetical protein MIMGU_mgv1a018405mg                132   2e-31    
ref|XP_002465212.1|  hypothetical protein SORBIDRAFT_01g034180          132   2e-31    
ref|XP_004228957.1|  PREDICTED: probable polyamine transporter At...    132   2e-31    
gb|KHN35487.1|  Cystine/glutamate transporter                           129   3e-31    
ref|XP_007159405.1|  hypothetical protein PHAVU_002G235600g             131   4e-31    
ref|XP_004984250.1|  PREDICTED: probable polyamine transporter At...    131   5e-31    
ref|XP_009375596.1|  PREDICTED: probable polyamine transporter At...    130   5e-31    
gb|KHN26100.1|  Cystine/glutamate transporter                           129   5e-31    
ref|XP_009364119.1|  PREDICTED: probable polyamine transporter At...    130   6e-31    
ref|XP_003629706.1|  Neutral amino acid transport protein               130   7e-31    
ref|XP_008235770.1|  PREDICTED: probable polyamine transporter At...    130   7e-31    
ref|XP_008656300.1|  PREDICTED: probable polyamine transporter At...    130   1e-30    
dbj|BAJ96201.1|  predicted protein                                      130   1e-30    
ref|XP_006492719.1|  PREDICTED: probable polyamine transporter At...    130   1e-30    
gb|KDO63022.1|  hypothetical protein CISIN_1g038994mg                   130   1e-30    
ref|XP_006445660.1|  hypothetical protein CICLE_v10015109mg             129   1e-30    
ref|XP_007014702.1|  Amino acid permease family protein isoform 1       129   1e-30    
gb|EMT24829.1|  Putative transporter                                    131   2e-30    
ref|XP_011048233.1|  PREDICTED: probable polyamine transporter At...    129   2e-30    
ref|XP_010111420.1|  Serine/threonine exchanger SteT                    129   2e-30    
ref|XP_003519181.1|  PREDICTED: probable polyamine transporter At...    129   2e-30    
ref|XP_003544223.1|  PREDICTED: probable polyamine transporter At...    129   2e-30    
ref|XP_008358841.1|  PREDICTED: probable polyamine transporter At...    129   3e-30    
ref|XP_003615175.1|  Neutral amino acid transport protein               129   3e-30    
ref|XP_002299116.1|  hypothetical protein POPTR_0001s04440g             129   3e-30    
ref|XP_008384401.1|  PREDICTED: probable polyamine transporter At...    129   3e-30    
ref|XP_004504331.1|  PREDICTED: probable polyamine transporter At...    128   3e-30    
gb|EMS66142.1|  hypothetical protein TRIUR3_02859                       127   3e-30    
ref|XP_004139136.2|  PREDICTED: probable polyamine transporter At...    128   3e-30    
emb|CDP17348.1|  unnamed protein product                                128   4e-30    
ref|XP_003524194.1|  PREDICTED: probable polyamine transporter At...    128   4e-30    
ref|XP_010552261.1|  PREDICTED: probable polyamine transporter At...    128   5e-30    
ref|XP_010101128.1|  putative amino acid permease YfnA                  128   5e-30    
ref|XP_008384433.1|  PREDICTED: probable polyamine transporter At...    127   5e-30    
ref|XP_009758806.1|  PREDICTED: probable polyamine transporter At...    128   5e-30    
gb|KHN47967.1|  Serine/threonine exchanger SteT                         127   6e-30    
ref|XP_006585159.1|  PREDICTED: probable polyamine transporter At...    127   6e-30    
emb|CDP17350.1|  unnamed protein product                                127   9e-30    
ref|XP_004294992.1|  PREDICTED: probable polyamine transporter At...    127   9e-30    
ref|XP_006838223.1|  PREDICTED: probable polyamine transporter At...    127   9e-30    
ref|XP_008344680.1|  PREDICTED: probable polyamine transporter At...    127   1e-29    
ref|XP_010673499.1|  PREDICTED: probable polyamine transporter At...    127   1e-29    
ref|XP_008354992.1|  PREDICTED: probable polyamine transporter At...    127   1e-29    
emb|CDM80402.1|  unnamed protein product                                127   1e-29    
ref|XP_006354149.1|  PREDICTED: probable polyamine transporter At...    127   1e-29    
gb|EEE59136.1|  hypothetical protein OsJ_11029                          126   1e-29    
gb|EMT03109.1|  hypothetical protein F775_15650                         125   1e-29    
gb|AAL82517.1|AC084766_3  putative amino acid transporter               127   1e-29    
dbj|BAJ85124.1|  predicted protein                                      127   1e-29    
ref|XP_002283531.1|  PREDICTED: probable polyamine transporter At...    126   2e-29    
ref|XP_009386129.1|  PREDICTED: probable polyamine transporter At...    126   3e-29    
ref|XP_005842903.1|  hypothetical protein CHLNCDRAFT_37683              125   3e-29    
ref|XP_008450300.1|  PREDICTED: probable polyamine transporter At...    125   3e-29    
ref|XP_009040829.1|  hypothetical protein AURANDRAFT_32482              125   4e-29    
ref|XP_006586502.1|  PREDICTED: probable polyamine transporter At...    125   4e-29    
ref|XP_002283522.2|  PREDICTED: probable polyamine transporter At...    125   4e-29    
ref|XP_009601488.1|  PREDICTED: probable polyamine transporter At...    125   6e-29    
gb|EEC75350.1|  hypothetical protein OsI_11776                          120   7e-29    
ref|XP_004228697.1|  PREDICTED: probable polyamine transporter At...    124   1e-28    
ref|XP_002784683.1|  amino acid transporter, putative                   126   1e-28    
ref|XP_004490387.1|  PREDICTED: probable polyamine transporter At...    124   1e-28    
ref|XP_011397159.1|  putative glutamate/gamma-aminobutyrate antip...    123   2e-28    
ref|XP_009588069.1|  PREDICTED: probable polyamine transporter At...    123   2e-28    



>ref|XP_008460421.1| PREDICTED: probable polyamine transporter At1g31830 isoform X6 
[Cucumis melo]
 ref|XP_008460422.1| PREDICTED: probable polyamine transporter At1g31830 isoform X7 
[Cucumis melo]
Length=487

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  291  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  349

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  350  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  409

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  410  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  469

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  470  DLPDLHFANRDRPDTLV  486



>ref|XP_011651680.1| PREDICTED: probable polyamine transporter At1g31830 isoform X6 
[Cucumis sativus]
 ref|XP_011651681.1| PREDICTED: probable polyamine transporter At1g31830 isoform X7 
[Cucumis sativus]
 ref|XP_011651682.1| PREDICTED: probable polyamine transporter At1g31830 isoform X6 
[Cucumis sativus]
Length=487

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  291  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  349

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  350  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  409

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  410  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  469

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  470  DLPDLHFANRDRPDTLV  486



>gb|KGN58394.1| hypothetical protein Csa_3G636430 [Cucumis sativus]
Length=506

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  310  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  368

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  369  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  428

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  429  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  488

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  489  DLPDLHFANRDRPDTLV  505



>ref|XP_011651678.1| PREDICTED: probable polyamine transporter At1g31830 isoform X4 
[Cucumis sativus]
Length=536

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  340  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  398

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  399  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  458

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  459  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  518

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  519  DLPDLHFANRDRPDTLV  535



>ref|XP_011651679.1| PREDICTED: probable polyamine transporter At1g31830 isoform X5 
[Cucumis sativus]
Length=533

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  337  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  395

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  396  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  455

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  456  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  515

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  516  DLPDLHFANRDRPDTLV  532



>ref|XP_011651677.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Cucumis sativus]
Length=537

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  341  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  399

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  400  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  459

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  460  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  519

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  520  DLPDLHFANRDRPDTLV  536



>ref|XP_008460420.1| PREDICTED: probable polyamine transporter At1g31830 isoform X5 
[Cucumis melo]
Length=540

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  344  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  402

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  403  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  462

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  463  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  522

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  523  DLPDLHFANRDRPDTLV  539



>ref|XP_008460419.1| PREDICTED: probable polyamine transporter At1g31830 isoform X4 
[Cucumis melo]
Length=543

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  347  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  405

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  406  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  465

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  466  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  525

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  526  DLPDLHFANRDRPDTLV  542



>ref|XP_004144401.2| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Cucumis sativus]
Length=582

 Score =   319 bits (817),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  386  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  444

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  445  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  504

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  505  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  564

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  565  DLPDLHFANRDRPDTLV  581



>ref|XP_011651676.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Cucumis sativus]
Length=586

 Score =   319 bits (817),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  390  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  448

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  449  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  508

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  509  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  568

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  569  DLPDLHFANRDRPDTLV  585



>ref|XP_008460418.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Cucumis melo]
Length=588

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  392  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  450

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  451  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  510

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  511  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  570

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  571  DLPDLHFANRDRPDTLV  587



>ref|XP_008460417.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Cucumis melo]
Length=596

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  400  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  458

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  459  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  518

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  519  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  578

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  579  DLPDLHFANRDRPDTLV  595



>ref|XP_008460416.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Cucumis melo]
Length=600

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   GAWL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSRHGT
Sbjct  404  DVAKIIG-GAWLGWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRHGT  462

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRIK P A RPYKIPV
Sbjct  463  PLIGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFLAFIKLRIKHPAASRPYKIPV  522

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI +VLA S++KV+++SL A+AIGL++QPG+++VEKKRWLKFSVS+
Sbjct  523  GTAGSILMCIPPTILICIVLALSTVKVMIVSLAAVAIGLLLQPGLKYVEKKRWLKFSVSA  582

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    R+   +L+
Sbjct  583  DLPDLHFANRDRPDTLV  599



>ref|XP_009796220.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Nicotiana sylvestris]
Length=468

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  276  DIAKILG-GVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSW+SFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  335  PLVGILFSASGVILLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRIKLPNASRPFKIPG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILIGVVLAFSS+KV++ISL A+AIGLVMQP ++ +EK RWLKFS+SS
Sbjct  395  GTVGAILLCIPPTILIGVVLAFSSVKVMIISLAAVAIGLVMQPCLKRIEKNRWLKFSISS  454

Query  357  DLPDIDHTT  331
            DLPDI H T
Sbjct  455  DLPDIHHDT  463



>ref|XP_009796217.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Nicotiana sylvestris]
Length=549

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  357  DIAKI-LGGVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  415

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSW+SFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  416  PLVGILFSASGVILLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRIKLPNASRPFKIPG  475

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILIGVVLAFSS+KV++ISL A+AIGLVMQP ++ +EK RWLKFS+SS
Sbjct  476  GTVGAILLCIPPTILIGVVLAFSSVKVMIISLAAVAIGLVMQPCLKRIEKNRWLKFSISS  535

Query  357  DLPDIDHTT  331
            DLPDI H T
Sbjct  536  DLPDIHHDT  544



>emb|CDP19063.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   GAWL WW+Q AAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  277  DIAKM-LGGAWLRWWIQAAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV LLSW+SFQEIVAAENFLYCFGMILEFIAFV LR K P+A RPYKIPV
Sbjct  336  PLIGILFSASGVFLLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRYKYPNASRPYKIPV  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IG++L+C PPTILI  VLAFSSLKV+++SL A+ IGLVM P ++H EKKRW+KFS+SS
Sbjct  396  GNIGSILICTPPTILICAVLAFSSLKVMIVSLIAVVIGLVMHPCLKHFEKKRWMKFSISS  455

Query  357  DLPDIDHTTRESAASLI  307
            DLPDI  T RES  + I
Sbjct  456  DLPDIQATARESTETFI  472



>ref|XP_009621514.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Nicotiana tomentosiformis]
Length=468

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  276  DIAKILG-GVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSA GVILLSW+SFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  335  PLVGILFSAFGVILLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRIKFPNASRPFKIPG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILIGVVLAFSS+KV++ISL A+AIGLVMQP ++ +EKKRWLKFS+SS
Sbjct  395  GTVGAILLCIPPTILIGVVLAFSSVKVMIISLAAVAIGLVMQPCLKRIEKKRWLKFSISS  454

Query  357  DLPDIDHTT  331
            DLPDI H T
Sbjct  455  DLPDIHHDT  463



>ref|XP_009621513.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Nicotiana tomentosiformis]
Length=552

 Score =   316 bits (809),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  360  DIAKI-LGGVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  418

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSA GVILLSW+SFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  419  PLVGILFSAFGVILLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRIKFPNASRPFKIPG  478

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILIGVVLAFSS+KV++ISL A+AIGLVMQP ++ +EKKRWLKFS+SS
Sbjct  479  GTVGAILLCIPPTILIGVVLAFSSVKVMIISLAAVAIGLVMQPCLKRIEKKRWLKFSISS  538

Query  357  DLPDIDHTT  331
            DLPDI H T
Sbjct  539  DLPDIHHDT  547



>ref|XP_009796218.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Nicotiana sylvestris]
Length=531

 Score =   315 bits (806),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  339  DIAKILG-GVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  397

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSW+SFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  398  PLVGILFSASGVILLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRIKLPNASRPFKIPG  457

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILIGVVLAFSS+KV++ISL A+AIGLVMQP ++ +EK RWLKFS+SS
Sbjct  458  GTVGAILLCIPPTILIGVVLAFSSVKVMIISLAAVAIGLVMQPCLKRIEKNRWLKFSISS  517

Query  357  DLPDIDHTT  331
            DLPDI H T
Sbjct  518  DLPDIHHDT  526



>ref|XP_010518945.1| PREDICTED: probable polyamine transporter At1g31830 [Tarenaya 
hassleriana]
Length=482

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGM+PEFFAKRSRHGT
Sbjct  289  DIAKI-LGGAWLGWWVQVAAATSNMGMFLAEMSSDSFQLLGMAERGMIPEFFAKRSRHGT  347

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAEN LYC GMILEFIAFV LR+K P A RPYKIPV
Sbjct  348  PLIGILFSASGVILLSWLSFQEIVAAENLLYCVGMILEFIAFVRLRMKYPAASRPYKIPV  407

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G+VLMC+PPTILI VV+AFS+LKV  +SLG + IGLVMQP ++HVEKKRWLKFSVSS
Sbjct  408  GTVGSVLMCIPPTILIFVVMAFSTLKVAGLSLGIVVIGLVMQPCLKHVEKKRWLKFSVSS  467

Query  357  DLPDIDHTTRES  322
            DLPD+ H T ES
Sbjct  468  DLPDLHHETAES  479



>ref|XP_002304384.2| hypothetical protein POPTR_0003s10260g [Populus trichocarpa]
 gb|EEE79363.2| hypothetical protein POPTR_0003s10260g [Populus trichocarpa]
Length=489

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  293  DIAKILG-GVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  351

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEI+AAENFLYCFGMILEFIAFV LRIK P A RPYKIPV
Sbjct  352  PLIGILFSASGVILLSWLSFQEIIAAENFLYCFGMILEFIAFVLLRIKCPVASRPYKIPV  411

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPTILI VVLA S++KV+++SL A+AIGLVMQP +++ EKKRW+KFSVS 
Sbjct  412  GTVGAILMCIPPTILICVVLALSTVKVMIVSLFAVAIGLVMQPCLKYAEKKRWMKFSVSG  471

Query  357  DLPDIDHTTRE  325
            +LPD+    +E
Sbjct  472  ELPDLHEGNQE  482



>ref|XP_009766610.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Nicotiana sylvestris]
Length=478

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQGAAA+SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  287  DIAKI-LGGVWLRCWVQGAAAVSNMGMFMAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  345

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+A RP+KIP 
Sbjct  346  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNATRPFKIPG  405

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVL+C+PP ILIGVVLAFSS+KV+V+SL A+AIGLV+QP ++ +EKKRWLKFS+SS
Sbjct  406  GTIGAVLLCIPPAILIGVVLAFSSIKVMVVSLVAVAIGLVLQPCLKFIEKKRWLKFSISS  465

Query  357  DLPDIDHT  334
            DLPDI   
Sbjct  466  DLPDITSN  473



>ref|XP_009766611.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Nicotiana sylvestris]
Length=464

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQGAAA+SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  273  DIAKI-LGGVWLRCWVQGAAAVSNMGMFMAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  331

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+A RP+KIP 
Sbjct  332  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNATRPFKIPG  391

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVL+C+PP ILIGVVLAFSS+KV+V+SL A+AIGLV+QP ++ +EKKRWLKFS+SS
Sbjct  392  GTIGAVLLCIPPAILIGVVLAFSSIKVMVVSLVAVAIGLVLQPCLKFIEKKRWLKFSISS  451

Query  357  DLPDIDHT  334
            DLPDI   
Sbjct  452  DLPDITSN  459



>ref|XP_009766609.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Nicotiana sylvestris]
Length=538

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQGAAA+SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  347  DIAKI-LGGVWLRCWVQGAAAVSNMGMFMAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  405

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+A RP+KIP 
Sbjct  406  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNATRPFKIPG  465

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVL+C+PP ILIGVVLAFSS+KV+V+SL A+AIGLV+QP ++ +EKKRWLKFS+SS
Sbjct  466  GTIGAVLLCIPPAILIGVVLAFSSIKVMVVSLVAVAIGLVLQPCLKFIEKKRWLKFSISS  525

Query  357  DLPDIDHT  334
            DLPDI   
Sbjct  526  DLPDITSN  533



>ref|XP_009760868.1| PREDICTED: probable polyamine transporter At1g31830 [Nicotiana 
sylvestris]
Length=481

 Score =   310 bits (795),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 175/192 (91%), Gaps = 3/192 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  W+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  290  DIAKM-LGGVWLRVWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  349  PLLGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKCPNAPRPFKIPG  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PP ILI VVLAFSS+KV+V+SL A+AIGLVMQP ++ +EKKRWLKFSVSS
Sbjct  409  GTVGAILLCIPPAILICVVLAFSSIKVMVVSLVAVAIGLVMQPCLKFIEKKRWLKFSVSS  468

Query  357  DLPDIDHTTRES  322
            DLPDI  TT  S
Sbjct  469  DLPDI--TTHGS  478



>ref|XP_007209988.1| hypothetical protein PRUPE_ppa005222mg [Prunus persica]
 gb|EMJ11187.1| hypothetical protein PRUPE_ppa005222mg [Prunus persica]
Length=472

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  276  DIAKIIG-GVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+ LSWLSFQEIVAAENFLYCFGMILEF++F+ LR+K P A RPYKIPV
Sbjct  335  PVIGILFSASGVLFLSWLSFQEIVAAENFLYCFGMILEFLSFIRLRVKYPAASRPYKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILI  VLAFS+LKV+V+S+GAI IGLVMQP + +VEKK+W+KFS S+
Sbjct  395  GTVGAILLCIPPTILICTVLAFSTLKVVVVSVGAIMIGLVMQPCLMYVEKKKWIKFSTST  454

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+    + S  SLI
Sbjct  455  DLPDLHGANQGSVNSLI  471



>ref|XP_002519879.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42483.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 175/197 (89%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFA+RSR+GT
Sbjct  290  DIAKM-LGGVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFARRSRYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LRI+ P A RPYKIPV
Sbjct  349  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVQLRIRQPAASRPYKIPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPTILI VVLA S++KV+V+SL A+AIGLV+QP +++ EKKRW+KFS   
Sbjct  409  GTVGAILMCIPPTILICVVLALSTIKVMVVSLIAVAIGLVLQPCLKYAEKKRWMKFSARE  468

Query  357  DLPDIDHTTRESAASLI  307
            +LPD+ +  +E+  SL+
Sbjct  469  ELPDLPNANQETIYSLV  485



>ref|XP_010112986.1| Solute carrier family 7 member 13 [Morus notabilis]
 gb|EXC35157.1| Solute carrier family 7 member 13 [Morus notabilis]
Length=478

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFA RSRHGT
Sbjct  277  DIAKILG-GVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAWRSRHGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLR+K P+A RPYKIPV
Sbjct  336  PLVGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRVKHPNAARPYKIPV  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPTILI VVLA SSLKV VIS+ AI IG ++ P ++HVEKK W+KFS S+
Sbjct  396  GTVGALLMCIPPTILICVVLALSSLKVFVISIAAITIGFMINPLLKHVEKKGWMKFSTST  455

Query  357  DLPDIDHTTRE  325
            DLPD++   ++
Sbjct  456  DLPDLNAAPQD  466



>ref|XP_009615737.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Nicotiana tomentosiformis]
Length=481

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 171/185 (92%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRS HGT
Sbjct  290  DIAKI-LGGVWLRCWVQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSPHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  349  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNAPRPFKIPG  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVL+C+PP ILIGVVLAFSS+KV+V+SL A+AIGLV+QP ++ +EKKRWLKFS+SS
Sbjct  409  GTIGAVLLCIPPAILIGVVLAFSSIKVMVVSLVAVAIGLVLQPCLKFMEKKRWLKFSISS  468

Query  357  DLPDI  343
             LPDI
Sbjct  469  HLPDI  473



>ref|XP_010677491.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=473

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPE FAKRSRHGT
Sbjct  277  DVAKIIG-GTWLCWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPELFAKRSRHGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSF+EI+AAENFLYCFGMILEFIAFV LRIK P   RPYKIP+
Sbjct  336  PLIGILFSASGVILLSWLSFEEIIAAENFLYCFGMILEFIAFVVLRIKQPAVSRPYKIPL  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+L+C+PPT+LI VVLA +S+KV+VISL A+AIGLVM P +++ EKKRWLKFSVSS
Sbjct  396  GTIGAILICIPPTLLICVVLALASVKVMVISLIAVAIGLVMHPALKYCEKKRWLKFSVSS  455

Query  357  DLPDIDHTTRESAASLI  307
             LPD+     E+  SL+
Sbjct  456  TLPDLQADVHENTRSLV  472



>ref|XP_009615736.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Nicotiana tomentosiformis]
Length=547

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 171/185 (92%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRS HGT
Sbjct  356  DIAKI-LGGVWLRCWVQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSPHGT  414

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  415  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNAPRPFKIPG  474

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVL+C+PP ILIGVVLAFSS+KV+V+SL A+AIGLV+QP ++ +EKKRWLKFS+SS
Sbjct  475  GTIGAVLLCIPPAILIGVVLAFSSIKVMVVSLVAVAIGLVLQPCLKFMEKKRWLKFSISS  534

Query  357  DLPDI  343
             LPDI
Sbjct  535  HLPDI  539



>ref|XP_010677492.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=488

 Score =   308 bits (790),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPE FAKRSRHGT
Sbjct  292  DVAKIIG-GTWLCWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPELFAKRSRHGT  350

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSF+EI+AAENFLYCFGMILEFIAFV LRIK P   RPYKIP+
Sbjct  351  PLIGILFSASGVILLSWLSFEEIIAAENFLYCFGMILEFIAFVVLRIKQPAVSRPYKIPL  410

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+L+C+PPT+LI VVLA +S+KV+VISL A+AIGLVM P +++ EKKRWLKFSVSS
Sbjct  411  GTIGAILICIPPTLLICVVLALASVKVMVISLIAVAIGLVMHPALKYCEKKRWLKFSVSS  470

Query  357  DLPDIDHTTRESAASLI  307
             LPD+     E+  SL+
Sbjct  471  TLPDLQADVHENTRSLV  487



>ref|XP_010324493.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Solanum lycopersicum]
Length=469

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  277  DIAKILG-GVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GIL SASGV+LLSW+SFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  336  PLVGILLSASGVLLLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRIKFPNASRPFKIPG  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+++C+PPTIL+G+VLAFS++KV++ISL AIAIGLVMQP ++H+EKK+WLKFS+S 
Sbjct  396  GTVGAIVLCIPPTILVGIVLAFSTVKVMIISLAAIAIGLVMQPCLKHIEKKKWLKFSISP  455

Query  357  DLPDIDHTT  331
            DLPDI    
Sbjct  456  DLPDIHRDN  464



>ref|XP_006364454.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006364455.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X3 [Solanum tuberosum]
Length=467

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL  WVQGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  276  DVAKI-LGGVWLRCWVQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+ GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  335  PVFGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNAPRPFKIPG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGAVL+C+PP ILIGVVLAFS++K++++SL A+AIGLV+QP I+ +E+KRWLKFS SS
Sbjct  395  GIIGAVLLCIPPAILIGVVLAFSTIKIMIVSLAAVAIGLVLQPCIKLIERKRWLKFSTSS  454

Query  357  DLPDI  343
            DLPDI
Sbjct  455  DLPDI  459



>ref|XP_004244429.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Solanum lycopersicum]
Length=530

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  338  DIAKI-LGGVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  396

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GIL SASGV+LLSW+SFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  397  PLVGILLSASGVLLLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRIKFPNASRPFKIPG  456

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+++C+PPTIL+G+VLAFS++KV++ISL AIAIGLVMQP ++H+EKK+WLKFS+S 
Sbjct  457  GTVGAIVLCIPPTILVGIVLAFSTVKVMIISLAAIAIGLVMQPCLKHIEKKKWLKFSISP  516

Query  357  DLPDIDHTT  331
            DLPDI    
Sbjct  517  DLPDIHRDN  525



>ref|XP_006364453.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X1 [Solanum tuberosum]
Length=481

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL  WVQGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  290  DVAKI-LGGVWLRCWVQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+ GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  349  PVFGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNAPRPFKIPG  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGAVL+C+PP ILIGVVLAFS++K++++SL A+AIGLV+QP I+ +E+KRWLKFS SS
Sbjct  409  GIIGAVLLCIPPAILIGVVLAFSTIKIMIVSLAAVAIGLVLQPCIKLIERKRWLKFSTSS  468

Query  357  DLPDI  343
            DLPDI
Sbjct  469  DLPDI  473



>ref|XP_004245940.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Solanum lycopersicum]
Length=481

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL +W+QGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  290  DIAKI-LGGVWLRFWLQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P++GI+FSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  349  PILGIIFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNAPRPFKIPG  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGA+L+CVPP ILIGVVLAFS++K++++SL A+AIG+V+QP I+ +E+KRWLKFS SS
Sbjct  409  GIIGAILLCVPPAILIGVVLAFSTIKIMIVSLAAVAIGMVLQPCIKLIERKRWLKFSTSS  468

Query  357  DLPDI  343
            DLPDI
Sbjct  469  DLPDI  473



>ref|XP_004245941.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Solanum lycopersicum]
Length=467

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL +W+QGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  276  DIAKI-LGGVWLRFWLQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P++GI+FSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  335  PILGIIFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNAPRPFKIPG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGA+L+CVPP ILIGVVLAFS++K++++SL A+AIG+V+QP I+ +E+KRWLKFS SS
Sbjct  395  GIIGAILLCVPPAILIGVVLAFSTIKIMIVSLAAVAIGMVLQPCIKLIERKRWLKFSTSS  454

Query  357  DLPDI  343
            DLPDI
Sbjct  455  DLPDI  459



>ref|XP_010677490.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=538

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPE FAKRSRHGT
Sbjct  342  DVAKIIG-GTWLCWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPELFAKRSRHGT  400

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSF+EI+AAENFLYCFGMILEFIAFV LRIK P   RPYKIP+
Sbjct  401  PLIGILFSASGVILLSWLSFEEIIAAENFLYCFGMILEFIAFVVLRIKQPAVSRPYKIPL  460

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+L+C+PPT+LI VVLA +S+KV+VISL A+AIGLVM P +++ EKKRWLKFSVSS
Sbjct  461  GTIGAILICIPPTLLICVVLALASVKVMVISLIAVAIGLVMHPALKYCEKKRWLKFSVSS  520

Query  357  DLPDIDHTTRESAASLI  307
             LPD+     E+  SL+
Sbjct  521  TLPDLQADVHENTRSLV  537



>ref|XP_009597699.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Nicotiana tomentosiformis]
Length=467

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 173/192 (90%), Gaps = 3/192 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  W+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  276  DIAKMLG-GVWLRVWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+A RP+KIP 
Sbjct  335  PLFGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKCPNAQRPFKIPG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PP ILI VVLAFSS+KV+V+SL A+AIGLVMQP ++ +EKKRWLKFSVSS
Sbjct  395  GTVGAILLCIPPAILICVVLAFSSIKVMVVSLIAVAIGLVMQPCLKFIEKKRWLKFSVSS  454

Query  357  DLPDIDHTTRES  322
            DLPDI  TT  S
Sbjct  455  DLPDI--TTHGS  464



>ref|XP_004245938.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Solanum lycopersicum]
Length=516

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL +W+QGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  325  DIAKI-LGGVWLRFWLQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  383

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P++GI+FSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+APRP+KIP 
Sbjct  384  PILGIIFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKYPNAPRPFKIPG  443

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGA+L+CVPP ILIGVVLAFS++K++++SL A+AIG+V+QP I+ +E+KRWLKFS SS
Sbjct  444  GIIGAILLCVPPAILIGVVLAFSTIKIMIVSLAAVAIGMVLQPCIKLIERKRWLKFSTSS  503

Query  357  DLPDI  343
            DLPDI
Sbjct  504  DLPDI  508



>ref|XP_009597698.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Nicotiana tomentosiformis]
Length=481

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 173/192 (90%), Gaps = 3/192 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  W+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  290  DIAKM-LGGVWLRVWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIK P+A RP+KIP 
Sbjct  349  PLFGILFSASGVVLLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKCPNAQRPFKIPG  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PP ILI VVLAFSS+KV+V+SL A+AIGLVMQP ++ +EKKRWLKFSVSS
Sbjct  409  GTVGAILLCIPPAILICVVLAFSSIKVMVVSLIAVAIGLVMQPCLKFIEKKRWLKFSVSS  468

Query  357  DLPDIDHTTRES  322
            DLPDI  TT  S
Sbjct  469  DLPDI--TTHGS  478



>gb|ACD64194.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   296 bits (757),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTVGSVLL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G V+QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFVLQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>ref|XP_006361235.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361236.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X2 [Solanum tuberosum]
Length=469

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMG FVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  277  DIAKILG-GVWLRWWIQGAAALSNMGTFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GIL SASGV+LLSW+SFQEI+AAENFLYCFGMILEFIAFV LRIK P+A RP+KIP 
Sbjct  336  PLVGILLSASGVLLLSWMSFQEIIAAENFLYCFGMILEFIAFVRLRIKFPNASRPFKIPG  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+L+C+PPTIL+ VVLAFS++KV++ISL A+AIGLVMQP ++H+EKK+WLKFS+S 
Sbjct  396  GTIGAILLCMPPTILVCVVLAFSTVKVMIISLAAVAIGLVMQPCLKHIEKKKWLKFSISP  455

Query  357  DLPDIDHTT  331
            DLPDI    
Sbjct  456  DLPDIHRDN  464



>ref|XP_011028020.1| PREDICTED: LOW QUALITY PROTEIN: probable polyamine transporter 
At1g31830 [Populus euphratica]
Length=489

 Score =   306 bits (783),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT
Sbjct  293  DIAKI-LGGVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  351

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLS LSFQEI+AAENFLYCFGMILEFIAFV LRIK P A RPYKIPV
Sbjct  352  PLIGILFSASGVILLSXLSFQEIIAAENFLYCFGMILEFIAFVLLRIKCPVASRPYKIPV  411

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPTILI VVLA S++KV+++SL A+AIGLVMQP +++ EKKRW+KFSVS 
Sbjct  412  GTVGAILMCIPPTILICVVLALSTVKVMIVSLFAVAIGLVMQPCLKYAEKKRWMKFSVSG  471

Query  357  DLPDIDHTTRE  325
            +LPD     +E
Sbjct  472  ELPDPHEGNQE  482



>ref|XP_006432859.1| hypothetical protein CICLE_v10000961mg [Citrus clementina]
 gb|ESR46099.1| hypothetical protein CICLE_v10000961mg [Citrus clementina]
Length=487

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 172/196 (88%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  291  DIAKV-LGGVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  349

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSASGV+LLSWLSFQ+IVAAENFLYCFGMI+EFIAFVWLRI+ P A RPYKIP 
Sbjct  350  PLIGIIFSASGVVLLSWLSFQDIVAAENFLYCFGMIMEFIAFVWLRIQYPAASRPYKIPT  409

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA++MC+PPTILI VVLA S+LKV  +S+GA+ IGLVMQP +++ EKKR +KFS S+
Sbjct  410  GTVGAIIMCIPPTILICVVLALSTLKVAALSVGAVVIGLVMQPCLKYAEKKRLMKFSTSA  469

Query  357  DLPDIDHTTRESAASL  310
            +LPD+    +ES  SL
Sbjct  470  ELPDLHGPEQESVDSL  485



>gb|ACD64175.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64179.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64184.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTVGSVLL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFTEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|KJB71339.1| hypothetical protein B456_011G117200 [Gossypium raimondii]
 gb|KJB71340.1| hypothetical protein B456_011G117200 [Gossypium raimondii]
 gb|KJB71341.1| hypothetical protein B456_011G117200 [Gossypium raimondii]
Length=466

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+Q AAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSR+GT
Sbjct  276  DIAKL-LGGVWLRWWIQAAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAF+ LR+K P A RPYKIPV
Sbjct  335  PLIGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFIRLRMKYPAASRPYKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMC+PPTILI VVLA SSLKV VISL A+ IGLVMQPG+++VEK+RWLKFS S+
Sbjct  395  GTVGSILMCIPPTILICVVLAISSLKVAVISLVAVVIGLVMQPGLKYVEKRRWLKFSTSA  454

Query  357  DLPDIDHTT  331
            +LPD+ + +
Sbjct  455  NLPDLHNDS  463



>ref|XP_011075143.1| PREDICTED: probable polyamine transporter At1g31830 [Sesamum 
indicum]
Length=541

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 172/190 (91%), Gaps = 2/190 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFA+RSR+GT
Sbjct  347  DVAKL-LGGVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFARRSRYGT  405

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAENFLYCFGM+LEFIAFV LRI SP APRPYKIPV
Sbjct  406  PLVGILFSASGVLLLSWLSFQEIVAAENFLYCFGMMLEFIAFVRLRIISPAAPRPYKIPV  465

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMCVPPT+LI VVLAFSSLKV+++SL A+ +GL++ P + H EKKRWL+FSVSS
Sbjct  466  GTVGAILMCVPPTLLICVVLAFSSLKVMIVSLVAVMLGLILHPCLTHCEKKRWLRFSVSS  525

Query  357  DLPDIDHTTR  328
            +LPDI HT  
Sbjct  526  NLPDI-HTAH  534



>gb|ADE21339.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=189

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  1    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  60

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  61   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  120

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  121  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  180

Query  333  TRESAA  316
               S +
Sbjct  181  HEHSES  186



>gb|ACD64196.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=190

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  2    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  61

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  62   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  121

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  122  CVPPTILICVVLALSSLKVMIVSVIAILFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  181

Query  333  TRESAA  316
               S +
Sbjct  182  HEHSES  187



>ref|XP_004300133.1| PREDICTED: probable polyamine transporter At1g31830 [Fragaria 
vesca subsp. vesca]
Length=472

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEM+SDSFQLLGMAERGMLPE F KRSR+GT
Sbjct  276  DIAKIVG-GVWLRWWIQGAAAMSNMGMFVAEMNSDSFQLLGMAERGMLPECFGKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+LLSWLSFQEIVAAENFLYC GMILEFIAF+ LR+K P A RPYKIP+
Sbjct  335  PVIGILFSASGVLLLSWLSFQEIVAAENFLYCVGMILEFIAFIRLRMKYPAASRPYKIPI  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GAVL+C PPT+LIGVVLA S LKV+V+SL AI IGLVMQP +++VE+KRW+KFS+S 
Sbjct  395  GTVGAVLLCTPPTLLIGVVLALSQLKVVVVSLIAIVIGLVMQPCLKYVERKRWIKFSISF  454

Query  357  DLPDIDHTTRESAASL  310
            DLPD+    +ES  SL
Sbjct  455  DLPDLQGANQESVNSL  470



>gb|ACD64133.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64177.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64180.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64181.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64193.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21342.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21343.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSVLL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>ref|XP_003517084.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X1 [Glycine max]
 gb|KHN41743.1| Putative transporter [Glycine soja]
Length=486

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAAMSNMGMFVAEMSSD+FQLLGMAERGMLPEFF KRSR+GTPLIGILFS
Sbjct  299  GAWLRWWLQAAAAMSNMGMFVAEMSSDAFQLLGMAERGMLPEFFGKRSRYGTPLIGILFS  358

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAF+ LRIK P+A RPYKIP GT GA++M
Sbjct  359  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFILLRIKHPNASRPYKIPGGTAGAIIM  418

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILIGVVL FSSLKV+VISL A+AIGLVMQP ++ VEKKRW+KFS SS+LPD  + 
Sbjct  419  CIPPTILIGVVLFFSSLKVMVISLIAMAIGLVMQPCLKLVEKKRWMKFSYSSELPDFGN-  477

Query  333  TRESAASLI  307
             +E   SL+
Sbjct  478  -QEGNRSLV  485



>gb|ADE21353.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTVGSVLL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|KJB71338.1| hypothetical protein B456_011G117200 [Gossypium raimondii]
Length=480

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+Q AAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSR+GT
Sbjct  290  DIAKL-LGGVWLRWWIQAAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAF+ LR+K P A RPYKIPV
Sbjct  349  PLIGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFIRLRMKYPAASRPYKIPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMC+PPTILI VVLA SSLKV VISL A+ IGLVMQPG+++VEK+RWLKFS S+
Sbjct  409  GTVGSILMCIPPTILICVVLAISSLKVAVISLVAVVIGLVMQPGLKYVEKRRWLKFSTSA  468

Query  357  DLPDIDHTT  331
            +LPD+ + +
Sbjct  469  NLPDLHNDS  477



>gb|ADE21390.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=192

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64167.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64168.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64187.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64188.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21338.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21384.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21385.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   294 bits (752),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAILFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64195.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=190

 Score =   293 bits (751),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  2    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  61

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  62   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  121

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  122  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  181

Query  333  TRESAA  316
               S +
Sbjct  182  HEHSES  187



>ref|XP_006573486.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X2 [Glycine max]
Length=490

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAAMSNMGMFVAEMSSD+FQLLGMAERGMLPEFF KRSR+GTPLIGILFS
Sbjct  303  GAWLRWWLQAAAAMSNMGMFVAEMSSDAFQLLGMAERGMLPEFFGKRSRYGTPLIGILFS  362

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAF+ LRIK P+A RPYKIP GT GA++M
Sbjct  363  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFILLRIKHPNASRPYKIPGGTAGAIIM  422

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILIGVVL FSSLKV+VISL A+AIGLVMQP ++ VEKKRW+KFS SS+LPD  + 
Sbjct  423  CIPPTILIGVVLFFSSLKVMVISLIAMAIGLVMQPCLKLVEKKRWMKFSYSSELPDFGN-  481

Query  333  TRESAASLI  307
             +E   SL+
Sbjct  482  -QEGNRSLV  489



>gb|ADE21366.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21395.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=192

 Score =   293 bits (751),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64199.1| amino acid permease-like protein, partial [Bahiopsis lanata]
 gb|ACD64200.1| amino acid permease-like protein, partial [Bahiopsis lanata]
 gb|ACD64201.1| amino acid permease-like protein, partial [Bahiopsis reticulata]
 gb|ACD64202.1| amino acid permease-like protein, partial [Bahiopsis reticulata]
Length=192

 Score =   293 bits (751),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WW+Q  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP IGILFS
Sbjct  4    GVWLRWWIQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPSIGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI IG  +QP ++  EKKRWLKFS  +DLPD+ + 
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFIGFALQPFLKFAEKKRWLKFSTKADLPDLLN-  182

Query  333  TRESAASLI  307
              E++ SL+
Sbjct  183  AHENSESLV  191



>gb|ACD64118.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64119.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64120.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64129.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64131.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64135.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64136.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64139.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64140.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64142.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64144.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64145.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64146.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64149.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64151.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64152.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64154.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64155.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64158.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64160.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64165.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64166.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64169.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64170.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64171.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64172.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64173.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64174.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64176.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64182.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64183.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64190.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64191.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64192.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64197.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64198.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21328.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21359.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21369.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21370.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21371.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21374.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21375.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21378.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21379.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21380.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21381.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21382.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21388.1| amino acid permease-like protein, partial [Helianthus neglectus]
 gb|ADE21392.1| amino acid permease-like protein, partial [Helianthus neglectus]
 gb|ADE21393.1| amino acid permease-like protein, partial [Helianthus neglectus]
 gb|ADE21394.1| amino acid permease-like protein, partial [Helianthus neglectus]
 gb|ADE21396.1| amino acid permease-like protein, partial [Helianthus neglectus]
 gb|ADE21398.1| amino acid permease-like protein, partial [Helianthus neglectus]
 gb|ADE21400.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=192

 Score =   293 bits (751),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64123.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64124.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64127.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64128.1| amino acid permease-like protein, partial [Helianthus annuus]
Length=192

 Score =   293 bits (750),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G+VL+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFLAFVRLRMKHPAASRPYKIPVGTVGSVLL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64122.1| amino acid permease-like protein, partial [Helianthus annuus]
Length=190

 Score =   293 bits (750),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  2    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  61

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  62   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  121

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI +VLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  122  CVPPTILICIVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  181

Query  333  TRESAA  316
               S +
Sbjct  182  HEHSES  187



>gb|ADE21331.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFLAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64156.1| amino acid permease-like protein, partial [Helianthus annuus]
Length=192

 Score =   293 bits (750),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAILFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64134.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64137.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64138.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64148.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64178.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21335.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21368.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   293 bits (749),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64125.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64126.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64157.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64159.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64161.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64162.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64185.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ACD64186.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21364.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   293 bits (749),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFLAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ADE21389.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=193

 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFLAFVRLRVKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ADE21346.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=187

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  867  WLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSAS  688
            WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSAS
Sbjct  1    WLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSAS  60

Query  687  GVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCV  508
            GVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+CV
Sbjct  61   GVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTVGSVLLCV  120

Query  507  PPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTR  328
            PPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T  
Sbjct  121  PPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFTEKKRWLKFSTKADLPDLLNTHE  180

Query  327  ESAA  316
             S +
Sbjct  181  HSES  184



>gb|ADE21360.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21361.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SS+KV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSIKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64189.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAILFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HDHSES  189



>gb|ADE21352.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  867  WLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSAS  688
            WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSAS
Sbjct  6    WLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSAS  65

Query  687  GVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCV  508
            GVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+CV
Sbjct  66   GVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTVGSVLLCV  125

Query  507  PPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTR  328
            PPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T  
Sbjct  126  PPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFTEKKRWLKFSTKADLPDLLNTHE  185

Query  327  ESAA  316
             S +
Sbjct  186  HSES  189



>gb|ACD64147.1| amino acid permease-like protein, partial [Helianthus annuus]
Length=192

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRW+KFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWVKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|ACD64117.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64132.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64141.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64143.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64150.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64153.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64163.1| amino acid permease-like protein, partial [Helianthus annuus]
 gb|ACD64164.1| amino acid permease-like protein, partial [Helianthus annuus]
Length=192

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HVHSES  189



>gb|ADE21345.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLG+AERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGVAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSVLL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>gb|KDP39761.1| hypothetical protein JCGZ_02781 [Jatropha curcas]
Length=471

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+QGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPE FAKRSRHGT
Sbjct  276  DIAKMLG-GVWLRWWIQGAAALSNMGMFVAEMSSDSFQLLGMAERGMLPELFAKRSRHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAF+ LRIK P A RPYKIP+
Sbjct  335  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFIQLRIKYPAASRPYKIPL  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA LMC+PPTILI VVL+ S+ KV+VISL A+AIGLV+QP +++VEKKRW+KF+ S+
Sbjct  395  GTTGATLMCIPPTILILVVLSLSTYKVMVISLVAVAIGLVLQPCLKYVEKKRWMKFATSA  454

Query  357  DLPDIDHTTRESAA  316
            DL D+ +  +E+++
Sbjct  455  DLLDLHNGNQENSS  468



>gb|ADE21330.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21333.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVLLLSWLSFQEIVAAENFLYCFGMILEFLAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>ref|XP_012070512.1| PREDICTED: probable polyamine transporter At1g31830 [Jatropha 
curcas]
Length=485

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+QGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPE FAKRSRHGT
Sbjct  290  DIAKMLG-GVWLRWWIQGAAALSNMGMFVAEMSSDSFQLLGMAERGMLPELFAKRSRHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAF+ LRIK P A RPYKIP+
Sbjct  349  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFIQLRIKYPAASRPYKIPL  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA LMC+PPTILI VVL+ S+ KV+VISL A+AIGLV+QP +++VEKKRW+KF+ S+
Sbjct  409  GTTGATLMCIPPTILILVVLSLSTYKVMVISLVAVAIGLVLQPCLKYVEKKRWMKFATSA  468

Query  357  DLPDIDHTTRESAA  316
            DL D+ +  +E+++
Sbjct  469  DLLDLHNGNQENSS  482



>gb|ACD64121.1| amino acid permease-like protein, partial [Helianthus annuus]
Length=190

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  2    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  61

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  62   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  121

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  122  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  181

Query  333  TRESAA  316
               S +
Sbjct  182  HVHSES  187



>ref|XP_011092634.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Sesamum indicum]
Length=554

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA I   G WL WW+QGAAAMSNMGMF+AEMSSDSFQLLGMAERGMLPE FA+RSR+GT
Sbjct  359  DIAMIVG-GVWLRWWIQGAAAMSNMGMFMAEMSSDSFQLLGMAERGMLPELFARRSRYGT  417

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFV LRI +P APRPYKIPV
Sbjct  418  PLVGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRIIAPAAPRPYKIPV  477

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMCVPPTILI VVLA SSLKV+++SL A+ IGL++QP I+H +KK WL+FSVSS
Sbjct  478  GTFGAILMCVPPTILICVVLALSSLKVMIVSLAAVVIGLILQPCIKHSKKKSWLRFSVSS  537

Query  357  DLPDIDHTTRESAASLI  307
            +LPDI     E+   +I
Sbjct  538  NLPDIHAGIHENETLII  554



>ref|XP_009365754.1| PREDICTED: probable polyamine transporter At1g31830 [Pyrus x 
bretschneideri]
Length=555

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 172/196 (88%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WW+QGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLP+FF KRSR+GT
Sbjct  359  DVAKIIG-GVWLRWWIQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPKFFGKRSRYGT  417

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFI+F+ LR+K P   RPYKIP 
Sbjct  418  PVIGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFISFIRLRVKYPATTRPYKIPT  477

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPT+LI VVLA S+LKV+++SL AI IGLVMQP + +VE+KRW+KFSVS+
Sbjct  478  GTVGAILMCIPPTVLICVVLALSTLKVVIVSLAAILIGLVMQPCLTYVERKRWIKFSVSA  537

Query  357  DLPDIDHTTRESAASL  310
            DLPD+    +ES  S+
Sbjct  538  DLPDLHGANQESVGSI  553



>gb|ADE21329.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV E+SSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEVSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HEHSES  189



>ref|XP_011092635.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Sesamum indicum]
Length=533

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA I   G WL WW+QGAAAMSNMGMF+AEMSSDSFQLLGMAERGMLPE FA+RSR+GT
Sbjct  338  DIAMIVG-GVWLRWWIQGAAAMSNMGMFMAEMSSDSFQLLGMAERGMLPELFARRSRYGT  396

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFV LRI +P APRPYKIPV
Sbjct  397  PLVGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRIIAPAAPRPYKIPV  456

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMCVPPTILI VVLA SSLKV+++SL A+ IGL++QP I+H +KK WL+FSVSS
Sbjct  457  GTFGAILMCVPPTILICVVLALSSLKVMIVSLAAVVIGLILQPCIKHSKKKSWLRFSVSS  516

Query  357  DLPDIDHTTRESAASLI  307
            +LPDI     E+   +I
Sbjct  517  NLPDIHAGIHENETLII  533



>gb|ACD64130.1| amino acid permease-like protein, partial [Helianthus annuus]
Length=192

 Score =   291 bits (745),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVILLSWLSFQEIVAAENFLYCFGMILEFLAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T
Sbjct  124  CVPPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNT  183

Query  333  TRESAA  316
               S +
Sbjct  184  HVHSES  189



>gb|ADE21347.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=187

 Score =   291 bits (744),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  867  WLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSAS  688
            WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSAS
Sbjct  1    WLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSAS  60

Query  687  GVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCV  508
            GV+LLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CV
Sbjct  61   GVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCV  120

Query  507  PPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTR  328
            PPTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T  
Sbjct  121  PPTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHE  180

Query  327  ESAA  316
             S +
Sbjct  181  HSES  184



>ref|XP_010538333.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Tarenaya hassleriana]
Length=472

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G+WL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGM+PEFFAKRSR+GTPLIGILFS
Sbjct  283  GSWLRWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMIPEFFAKRSRYGTPLIGILFS  342

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAEN LYC GMILEFIAFV LR+K P A RPYKIP+GTIG++LM
Sbjct  343  ASGVILLSWLSFQEIVAAENLLYCVGMILEFIAFVRLRMKYPAASRPYKIPLGTIGSILM  402

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI  V+ FSSLKV  +S   + IGLVMQP ++HVEK+RWLKFS+SSDLPD+   
Sbjct  403  CIPPTILICAVVVFSSLKVAAVSFVMLVIGLVMQPCLKHVEKRRWLKFSISSDLPDLHQD  462

Query  333  TRESAASLI  307
            TRE A SL+
Sbjct  463  TREIAESLM  471



>gb|EYU29097.1| hypothetical protein MIMGU_mgv1a003994mg [Erythranthe guttata]
Length=550

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   GAWLSWWV+GAAAMSNMGMFVAEMSSDSFQLLGMAERGM+PEFFA+RSR+GT
Sbjct  354  DVAKV-LGGAWLSWWVRGAAAMSNMGMFVAEMSSDSFQLLGMAERGMIPEFFARRSRYGT  412

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASG++LLSWLSFQEIVAAENFLYCFGMILEFIAFV LR  +P A RPYKIPV
Sbjct  413  PLVGILFSASGIVLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRFVAPHAARPYKIPV  472

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G  GAV MCVPP ILIGVVLAFSS+KV+++SL A+ +G+V+ P +R  EK+RWL+FS+S 
Sbjct  473  GPFGAVAMCVPPAILIGVVLAFSSVKVMIVSLVAVMVGVVLHPCLRQSEKRRWLRFSISE  532

Query  357  DLPDIDHTTRESAASLI  307
            +LPDI HT+     +L+
Sbjct  533  NLPDIHHTSVRDNDTLV  549



>ref|XP_010538332.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Tarenaya hassleriana]
Length=489

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G+WL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGM+PEFFAKRSR+GTPLIGILFS
Sbjct  300  GSWLRWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMIPEFFAKRSRYGTPLIGILFS  359

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAEN LYC GMILEFIAFV LR+K P A RPYKIP+GTIG++LM
Sbjct  360  ASGVILLSWLSFQEIVAAENLLYCVGMILEFIAFVRLRMKYPAASRPYKIPLGTIGSILM  419

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI  V+ FSSLKV  +S   + IGLVMQP ++HVEK+RWLKFS+SSDLPD+   
Sbjct  420  CIPPTILICAVVVFSSLKVAAVSFVMLVIGLVMQPCLKHVEKRRWLKFSISSDLPDLHQD  479

Query  333  TRESAASLI  307
            TRE A SL+
Sbjct  480  TREIAESLM  488



>gb|KHN11826.1| Putative transporter [Glycine soja]
Length=471

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAAMSNMGMFVAEMSSD+FQLLGMAERGMLPEFF+KRSR+GTPLIGILFS
Sbjct  284  GAWLRWWLQAAAAMSNMGMFVAEMSSDAFQLLGMAERGMLPEFFSKRSRYGTPLIGILFS  343

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAF+ LRIK P+A RPYKIP GT GA++M
Sbjct  344  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFILLRIKHPNASRPYKIPGGTAGAIIM  403

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILIGVVL FS+LKV+V+SL A+AIGL+MQP ++ VEKKRW+KFS SS+LPD  + 
Sbjct  404  CIPPTILIGVVLFFSTLKVMVVSLIAMAIGLLMQPCLKFVEKKRWMKFSHSSELPDFGN-  462

Query  333  TRESAASLI  307
             +E   +L+
Sbjct  463  -QEDTRTLV  470



>ref|XP_003534323.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X1 [Glycine max]
Length=486

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAAMSNMGMFVAEMSSD+FQLLGMAERGMLPEFF+KRSR+GTPLIGILFS
Sbjct  299  GAWLRWWLQAAAAMSNMGMFVAEMSSDAFQLLGMAERGMLPEFFSKRSRYGTPLIGILFS  358

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAF+ LRIK P+A RPYKIP GT GA++M
Sbjct  359  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFILLRIKHPNASRPYKIPGGTAGAIIM  418

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILIGVVL FS+LKV+V+SL A+AIGL+MQP ++ VEKKRW+KFS SS+LPD  + 
Sbjct  419  CIPPTILIGVVLFFSTLKVMVVSLIAMAIGLLMQPCLKFVEKKRWMKFSHSSELPDFGN-  477

Query  333  TRESAASLI  307
             +E   +L+
Sbjct  478  -QEDTRTLV  485



>ref|XP_008238050.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Prunus mume]
Length=468

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  276  DIAKIIG-GVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+ LSWLSFQEIVAAENFLYCFGMILEF++F+ LR+K P A RPYKIPV
Sbjct  335  PVIGILFSASGVLFLSWLSFQEIVAAENFLYCFGMILEFLSFIRLRVKYPAASRPYKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILI  VLAFS+LKV+V+S+GAI IGL MQP + + EK++W+KFS S+
Sbjct  395  GTVGAILLCIPPTILICTVLAFSTLKVVVVSVGAIMIGLAMQPCLMYAEKEKWIKFSTSA  454

Query  357  DLPDIDHTTRES  322
            DLPD+    + S
Sbjct  455  DLPDLHGANQGS  466



>gb|ADE21348.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21351.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            VILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+CVP
Sbjct  61   VILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPVGTVGSVLLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFTEKKRWLKFSTKADLPDLLNTHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>ref|XP_008238049.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Prunus mume]
Length=483

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  291  DIAKIIG-GVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  349

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+ LSWLSFQEIVAAENFLYCFGMILEF++F+ LR+K P A RPYKIPV
Sbjct  350  PVIGILFSASGVLFLSWLSFQEIVAAENFLYCFGMILEFLSFIRLRVKYPAASRPYKIPV  409

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILI  VLAFS+LKV+V+S+GAI IGL MQP + + EK++W+KFS S+
Sbjct  410  GTVGAILLCIPPTILICTVLAFSTLKVVVVSVGAIMIGLAMQPCLMYAEKEKWIKFSTSA  469

Query  357  DLPDIDHTTRES  322
            DLPD+    + S
Sbjct  470  DLPDLHGANQGS  481



>gb|ADE21349.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            VILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G+VL+CVP
Sbjct  61   VILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSVLLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>ref|XP_006587639.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X2 [Glycine max]
Length=516

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAAMSNMGMFVAEMSSD+FQLLGMAERGMLPEFF+KRSR+GTPLIGILFS
Sbjct  329  GAWLRWWLQAAAAMSNMGMFVAEMSSDAFQLLGMAERGMLPEFFSKRSRYGTPLIGILFS  388

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAF+ LRIK P+A RPYKIP GT GA++M
Sbjct  389  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFILLRIKHPNASRPYKIPGGTAGAIIM  448

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILIGVVL FS+LKV+V+SL A+AIGL+MQP ++ VEKKRW+KFS SS+LPD  + 
Sbjct  449  CIPPTILIGVVLFFSTLKVMVVSLIAMAIGLLMQPCLKFVEKKRWMKFSHSSELPDFGN-  507

Query  333  TRESAASLI  307
             +E   +L+
Sbjct  508  -QEDTRTLV  515



>gb|AFK37373.1| unknown [Lotus japonicus]
Length=462

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WW+Q AAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF  RSRHGTPLIGILFS
Sbjct  277  GVWLRWWLQAAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFKIRSRHGTPLIGILFS  336

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYC GMILEF AF+ LRI+ P+APRPYKIP GT+GAVLM
Sbjct  337  ASGVLLLSWLSFQEIVAAENFLYCLGMILEFNAFILLRIRYPNAPRPYKIPGGTVGAVLM  396

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILIGVVL FS+LKVLVISL A+AIGLVMQP +++ EKKRW+KFS +S+L DI+  
Sbjct  397  CIPPTILIGVVLYFSTLKVLVISLIAVAIGLVMQPCLKYAEKKRWMKFSQNSELTDINDE  456

Query  333  TRE  325
              +
Sbjct  457  GSQ  459



>gb|ADE21332.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21334.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21336.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21341.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21362.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21363.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21365.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21367.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21372.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21376.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21377.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21383.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            VILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVP
Sbjct  61   VILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>ref|XP_008373488.1| PREDICTED: LOW QUALITY PROTEIN: probable polyamine transporter 
At1g31830 [Malus domestica]
Length=475

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+Q AAA+SNMGMFVAEMSSDSFQLLGMAERGMLP+ F KRSRHGT
Sbjct  279  DIAKLIG-GVWLRWWIQAAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPKXFGKRSRHGT  337

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+LLSWLSFQEIVAAENFLYCFGMILEFI+F+ LR+K P   RPYKIPV
Sbjct  338  PVIGILFSASGVLLLSWLSFQEIVAAENFLYCFGMILEFISFIRLRVKYPATSRPYKIPV  397

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPTILI VVLA S+LK++V+SL AI IGLVMQP + +VE+KRW+KFSVS+
Sbjct  398  GTVGAILMCIPPTILICVVLALSTLKIVVVSLVAILIGLVMQPCLTYVERKRWMKFSVSA  457

Query  357  DLPDIDHTTRESAASL  310
            DLPD+    +E   S+
Sbjct  458  DLPDLHGANQEGVGSI  473



>ref|XP_010278806.1| PREDICTED: probable polyamine transporter At1g31830 [Nelumbo 
nucifera]
Length=473

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 173/196 (88%), Gaps = 5/196 (3%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGA+A+SNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSR+GT
Sbjct  276  DIAKIVG-GVWLRSWIQGASALSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSF+EIVAAENFLYCFGMILEFIAFV LR+++P A RPYKIPV
Sbjct  335  PLVGILFSASGVILLSWLSFEEIVAAENFLYCFGMILEFIAFVKLRVQNPTASRPYKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPTILI VVLA +S+KV+ ISL A+ IG ++ PG+++VEKKRW+KFS+SS
Sbjct  395  GTVGAILMCIPPTILICVVLAIASMKVMGISLLAVLIGFLLHPGLKYVEKKRWVKFSISS  454

Query  357  DLPDI----DHTTRES  322
            DLPD+    DH   ES
Sbjct  455  DLPDLYTATDHENTES  470



>gb|ADE21350.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            VILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVP
Sbjct  61   VILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>gb|ADE21344.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=192

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFS
Sbjct  4    GVWLRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFS  63

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+
Sbjct  64   ASGVLLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILL  123

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI--D  340
            CVPPTIL+ VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+   
Sbjct  124  CVPPTILLCVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLDA  183

Query  339  HTTRES  322
            H   ES
Sbjct  184  HEHSES  189



>ref|XP_006432851.1| hypothetical protein CICLE_v10001087mg [Citrus clementina]
 gb|ESR46091.1| hypothetical protein CICLE_v10001087mg [Citrus clementina]
Length=460

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPE FAKRSR+GT
Sbjct  264  DIAKV-LGGVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEVFAKRSRYGT  322

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSASGV+LLSWLSFQ+IVAAENFLYCFGMI+EFIAF+WLRI+ P A  PYKIP 
Sbjct  323  PLIGIIFSASGVVLLSWLSFQDIVAAENFLYCFGMIMEFIAFIWLRIQYPAASCPYKIPT  382

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA++MC+PPTILI VVLA S+LKV  +S+GA+ IGLVMQP +++ EKKR +KFS S+
Sbjct  383  GTVGAIIMCIPPTILICVVLALSTLKVAALSIGAVVIGLVMQPCLKYAEKKRLMKFSTSA  442

Query  357  DLPDIDHTTRESAASL  310
            +LPD+    +ES  SL
Sbjct  443  ELPDLHGPEQESVDSL  458



>gb|ADE21340.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21356.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21358.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            V+LLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVP
Sbjct  61   VLLLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>gb|ADE21337.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            VILLSWLSFQEIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G++L+CVP
Sbjct  61   VILLSWLSFQEIVAAENFLYCFGMILEFLAFVRLRMKHPAASRPYKIPVGTVGSILLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>ref|XP_010918090.1| PREDICTED: probable polyamine transporter At1g31830 [Elaeis guineensis]
Length=610

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 173/195 (89%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL+WWVQGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRS +GT
Sbjct  413  DIAKIVG-GVWLTWWVQGAAALSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSPYGT  471

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSASGV+LLSWLSFQEIVAAENFLYCFGM+LEF+AF+ LRIK+P A RPYK+P+
Sbjct  472  PLIGIMFSASGVLLLSWLSFQEIVAAENFLYCFGMLLEFVAFIRLRIKNPRASRPYKVPL  531

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIG +LM +PPT+LI VVL FSSLKV+++SL A+ IGL++QP +R+VEKKRWL+FS++ 
Sbjct  532  GTIGCILMIIPPTLLIFVVLVFSSLKVMLVSLAAVIIGLILQPCLRYVEKKRWLRFSINP  591

Query  357  DLPDIDHTTRESAAS  313
            DLPD   T  E+AA 
Sbjct  592  DLPDFRATGNENAAE  606



>gb|ADE21373.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   288 bits (736),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            VILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVP
Sbjct  61   VILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  +KKRWLKFS  +DLPD+ +T   
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAKKKRWLKFSTKADLPDLLNTHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>ref|XP_006489916.1| PREDICTED: probable polyamine transporter At1g31830-like [Citrus 
sinensis]
Length=268

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 170/201 (85%), Gaps = 6/201 (3%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL W +QGAAAMSNMGMFVAEMSS+SFQLLGMAERGMLPEFFAKRS +GT
Sbjct  67   DIAKVLG-GVWLRWCIQGAAAMSNMGMFVAEMSSNSFQLLGMAERGMLPEFFAKRSCYGT  125

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSASGV+LLSWLSF++IVAAENFLYCFGM++EFIAFVWLRI+ P A RPYKIP 
Sbjct  126  PLIGIIFSASGVVLLSWLSFRDIVAAENFLYCFGMVMEFIAFVWLRIQYPAASRPYKIPT  185

Query  537  GTIGAVLMCVPPTILI-----GVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLK  373
            GT+GA++MC+PPTILI      VVLA SSLKV V+S+GA+ IGLVMQP +++ EKKR +K
Sbjct  186  GTVGAIIMCIPPTILICVVLCCVVLALSSLKVAVLSVGAVVIGLVMQPCLKYAEKKRLMK  245

Query  372  FSVSSDLPDIDHTTRESAASL  310
            FS S++L D+    +ES  SL
Sbjct  246  FSTSAELSDLHGREQESVDSL  266



>ref|XP_006359232.1| PREDICTED: probable polyamine transporter At1g31830-like [Solanum 
tuberosum]
Length=468

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGAAA SNMGMFVAEMSSDSFQLLGMAERG+LPEFF+KRSR+GT
Sbjct  276  DIAKILG-GVWLRVWIQGAAATSNMGMFVAEMSSDSFQLLGMAERGLLPEFFSKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILF ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LRIKSP A RP+KIP 
Sbjct  335  PLFGILFLASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVLLRIKSPHALRPFKIPG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILI VVLA SS +V+V+SL A+AIGLVMQP ++ +E KRWLKFSVSS
Sbjct  395  GTVGAILLCIPPTILICVVLALSSFEVMVVSLAAVAIGLVMQPCLKLIENKRWLKFSVSS  454

Query  357  DLPDIDHTTRE  325
            DLPD D TT E
Sbjct  455  DLPD-DITTHE  464



>gb|ADE21357.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=186

 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = -1

Query  864  LSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASG  685
            L WWVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASG
Sbjct  1    LRWWVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASG  60

Query  684  VILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVP  505
            VILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVP
Sbjct  61   VILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVP  120

Query  504  PTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
            PTILI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +    
Sbjct  121  PTILICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNAHEH  180

Query  324  SAA  316
            S +
Sbjct  181  SES  183



>emb|CBI37465.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 168/197 (85%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   G WL WW+ GAAA SN+GMFVAEMSSDSFQLLGMAERGMLP  FAKRS +GT
Sbjct  173  DVAKMIG-GVWLGWWITGAAAASNLGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSHYGT  231

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSW+SFQEI+AAENFLYCFGMILEFIAFV LRIK P A RPYKIP+
Sbjct  232  PLIGILFSASGVLLLSWMSFQEIIAAENFLYCFGMILEFIAFVRLRIKYPAASRPYKIPL  291

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPTILI +VLA SSLKV V+SL A+ IGLV+QP ++ +E+KRWLKFSVSS
Sbjct  292  GTVGSILMCVPPTILICIVLALSSLKVAVVSLIAVIIGLVLQPCLKCIERKRWLKFSVSS  351

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+     E+   L+
Sbjct  352  DLPDLHCENHENVEPLL  368



>ref|XP_004245811.1| PREDICTED: probable polyamine transporter At1g31830 [Solanum 
lycopersicum]
Length=468

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGAAA SNMGMFVAEMSSDSFQLLGMAERG+LPEFF+KRSR+GT
Sbjct  276  DIAKI-LGGVWLRVWIQGAAAASNMGMFVAEMSSDSFQLLGMAERGLLPEFFSKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P APRP+KI  
Sbjct  335  PLFGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVLLRMKYPHAPRPFKIHG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPTILI VVLA SS KV+V+SL A+AIGLVMQP ++ +E KRWLKFS+SS
Sbjct  395  GTVGAILLCIPPTILICVVLALSSFKVMVVSLAAVAIGLVMQPCLKLIENKRWLKFSISS  454

Query  357  DLPDIDHTTRE  325
            DLPD D TT E
Sbjct  455  DLPD-DITTHE  464



>gb|ADE21354.1| amino acid permease-like protein, partial [Helianthus petiolaris]
 gb|ADE21355.1| amino acid permease-like protein, partial [Helianthus petiolaris]
Length=183

 Score =   285 bits (729),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -1

Query  855  WVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASGVIL  676
            WVQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASGVIL
Sbjct  1    WVQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASGVIL  60

Query  675  LSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVPPTI  496
            LSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVPPTI
Sbjct  61   LSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVPPTI  120

Query  495  LIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRESAA  316
            LI VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   S +
Sbjct  121  LICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEHSES  180



>ref|XP_008364484.1| PREDICTED: LOW QUALITY PROTEIN: probable polyamine transporter 
At1g31830 [Malus domestica]
Length=402

 Score =   293 bits (749),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMGMFVAEMSSDSFQLLGMAE+GMLP+FF KRSRHGT
Sbjct  206  DIAKIIG-GVWLRWWIQGAAAVSNMGMFVAEMSSDSFQLLGMAEQGMLPQFFGKRSRHGT  264

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
             +IGILFSASGV+ LSWLSFQEIVA EN LYCF +ILEFI+F+ LR+K P   RPYKIPV
Sbjct  265  SVIGILFSASGVLXLSWLSFQEIVAEENLLYCFEIILEFISFIRLRVKYPATSRPYKIPV  324

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+LMC+PPTILI VVLA S+LK++V+SL AI IGLVMQP + +VE+KRW+KFSVS+
Sbjct  325  GTVGAILMCIPPTILICVVLALSTLKIVVVSLVAILIGLVMQPCLTYVERKRWMKFSVSA  384

Query  357  DLPDIDHTTRESAASL  310
            DLPD+    +E   S+
Sbjct  385  DLPDLHGANQEGVGSI  400



>ref|XP_009365777.1| PREDICTED: probable polyamine transporter At1g31830, partial 
[Pyrus x bretschneideri]
Length=287

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAA+SNMGMFVAEMSSDSFQLLGMAERGMLP+FF +RSRHGT
Sbjct  91   DIAKIIG-GVWLRWWIQGAAAVSNMGMFVAEMSSDSFQLLGMAERGMLPKFFGERSRHGT  149

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
             +IGILFSASGV+ LSWLSFQEIVAAENFLYCFG+ILEFI+F+ LRIK P   RPYKIP+
Sbjct  150  QVIGILFSASGVLSLSWLSFQEIVAAENFLYCFGIILEFISFIRLRIKYPATSRPYKIPI  209

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
             T GA+LMC+PPT LI VVLA S+LK++V+SL AI IGLVMQP + +VEKKRW+KFSVS+
Sbjct  210  RTDGAILMCIPPTALICVVLALSTLKIVVVSLVAILIGLVMQPCLTYVEKKRWIKFSVSA  269

Query  357  DLPDIDHTTRESAASL  310
            DLPD+    + S  ++
Sbjct  270  DLPDLHGANQGSVGAI  285



>ref|XP_008800007.1| PREDICTED: probable polyamine transporter At1g31830 [Phoenix 
dactylifera]
Length=543

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL+WWVQGAAA+SN GMFVAEMSSDS+QLLGMAERGMLPEFF+KRSR+GT
Sbjct  346  DIAKI-LGGVWLTWWVQGAAALSNAGMFVAEMSSDSYQLLGMAERGMLPEFFSKRSRYGT  404

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSASGV+LLSWLSFQEIVAAENFLYCFGM+LEF+AF+ LRIK P A RPYK+P+
Sbjct  405  PLIGIVFSASGVLLLSWLSFQEIVAAENFLYCFGMLLEFVAFIRLRIKYPRASRPYKVPL  464

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIG +LM +PPT+LI VVLAFSSLKV+ +SL A+ IGLV+QP +R+VEKK+WL+FS+S 
Sbjct  465  GTIGCILMIIPPTLLIFVVLAFSSLKVMFVSLTAVIIGLVLQPCLRYVEKKQWLRFSISP  524

Query  357  DLPDIDHTTRESAAS  313
            DL D +    E+AA 
Sbjct  525  DLHDFEAPGNENAAE  539



>ref|XP_007048590.1| Amino acid permease family protein [Theobroma cacao]
 gb|EOX92747.1| Amino acid permease family protein [Theobroma cacao]
Length=532

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 173/197 (88%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL WW+Q AAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF KRSR+GT
Sbjct  336  DIAKM-LGGVWLRWWIQAAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFGKRSRYGT  394

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSW+SFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPV
Sbjct  395  PLIGILFSASGVILLSWMSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPYKIPV  454

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G+VLMC+PPTILI +VLA SSLKV V+SL A+ IGLVMQP +++VEK+RWLKFS+S+
Sbjct  455  GTVGSVLMCIPPTILICLVLALSSLKVAVVSLVAVVIGLVMQPALKYVEKRRWLKFSISA  514

Query  357  DLPDIDHTTRESAASLI  307
            DL D+  ++ ES  S I
Sbjct  515  DLADLHLSSHESTDSSI  531



>gb|KCW78428.1| hypothetical protein EUGRSUZ_D02589 [Eucalyptus grandis]
Length=474

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 178/198 (90%), Gaps = 2/198 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WWVQ AAAM+NMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRS+HGT
Sbjct  277  DIAKIIG-GVWLRWWVQAAAAMANMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSKHGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RPYKIPV
Sbjct  336  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVKLRIKYPNASRPYKIPV  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+ MC+PPTILIG+VLA S+LKV ++SL A+ IG +M+P +++V+KKRWLKFSV+S
Sbjct  396  GTIGAIAMCIPPTILIGIVLALSTLKVAIVSLVAVVIGFIMEPALKYVDKKRWLKFSVNS  455

Query  357  DLPDIDH-TTRESAASLI  307
            +L D+++ T+RES  SL+
Sbjct  456  NLIDLNNDTSRESTVSLV  473



>gb|AES95554.2| neutral amino acid transporter [Medicago truncatula]
Length=491

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WW+Q AAAMSNMGMFVAEMSSDS+QLLGMAERGMLPEFF KRSRHGTPLIGILFS
Sbjct  304  GVWLRWWLQAAAAMSNMGMFVAEMSSDSYQLLGMAERGMLPEFFTKRSRHGTPLIGILFS  363

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYC GMILEFIAF+ L+IK P+APRPYK+P GT GA++M
Sbjct  364  ASGVILLSWLSFQEIVAAENFLYCIGMILEFIAFILLKIKHPNAPRPYKVPGGTAGAIIM  423

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI VVLAFSSLKV +IS+ A+AIG+VMQP ++ +EKKRW+KFS S +LPD    
Sbjct  424  CIPPTILICVVLAFSSLKVFLISIVAMAIGIVMQPCLKFMEKKRWMKFSHSPELPDF--V  481

Query  333  TRESAASLI  307
              E   SL+
Sbjct  482  NGEDTQSLV  490



>ref|XP_003612596.1| Amino acid permease-like protein [Medicago truncatula]
 gb|KEH27676.1| neutral amino acid transporter [Medicago truncatula]
Length=475

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WW+Q AAAMSNMGMFVAEMSSDS+QLLGMAERGMLPEFF KRSRHGTPLIGILFS
Sbjct  288  GVWLRWWLQAAAAMSNMGMFVAEMSSDSYQLLGMAERGMLPEFFTKRSRHGTPLIGILFS  347

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYC GMILEFIAF+ L+IK P+APRPYK+P GT GA++M
Sbjct  348  ASGVILLSWLSFQEIVAAENFLYCIGMILEFIAFILLKIKHPNAPRPYKVPGGTAGAIIM  407

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI VVLAFSSLKV +IS+ A+AIG+VMQP ++ +EKKRW+KFS S +LPD    
Sbjct  408  CIPPTILICVVLAFSSLKVFLISIVAMAIGIVMQPCLKFMEKKRWMKFSHSPELPDF--V  465

Query  333  TRESAASLI  307
              E   SL+
Sbjct  466  NGEDTQSLV  474



>ref|XP_010054044.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Eucalyptus grandis]
 gb|KCW78427.1| hypothetical protein EUGRSUZ_D02589 [Eucalyptus grandis]
Length=488

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 178/198 (90%), Gaps = 2/198 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WWVQ AAAM+NMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRS+HGT
Sbjct  291  DIAKIIG-GVWLRWWVQAAAAMANMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSKHGT  349

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RPYKIPV
Sbjct  350  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVKLRIKYPNASRPYKIPV  409

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+ MC+PPTILIG+VLA S+LKV ++SL A+ IG +M+P +++V+KKRWLKFSV+S
Sbjct  410  GTIGAIAMCIPPTILIGIVLALSTLKVAIVSLVAVVIGFIMEPALKYVDKKRWLKFSVNS  469

Query  357  DLPDIDH-TTRESAASLI  307
            +L D+++ T+RES  SL+
Sbjct  470  NLIDLNNDTSRESTVSLV  487



>ref|XP_010665389.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Vitis vinifera]
Length=475

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 168/197 (85%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   G WL WW+ GAAA SN+GMFVAEMSSDSFQLLGMAERGMLP  FAKRS +GT
Sbjct  279  DVAKMIG-GVWLGWWITGAAAASNLGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSHYGT  337

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSW+SFQEI+AAENFLYCFGMILEFIAFV LRIK P A RPYKIP+
Sbjct  338  PLIGILFSASGVLLLSWMSFQEIIAAENFLYCFGMILEFIAFVRLRIKYPAASRPYKIPL  397

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPTILI +VLA SSLKV V+SL A+ IGLV+QP ++ +E+KRWLKFSVSS
Sbjct  398  GTVGSILMCVPPTILICIVLALSSLKVAVVSLIAVIIGLVLQPCLKCIERKRWLKFSVSS  457

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+     E+   L+
Sbjct  458  DLPDLHCENHENVEPLV  474



>ref|XP_006307388.1| hypothetical protein CARUB_v10009014mg [Capsella rubella]
 gb|EOA40286.1| hypothetical protein CARUB_v10009014mg [Capsella rubella]
Length=479

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK    GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  283  DVAK-ALGGAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  341

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+
Sbjct  342  PLLGILFSASGVILLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPI  401

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G+VLMCVPPTILI  V+A SSLKV  +S   + IG +M P + H+++K+WLKFS+SS
Sbjct  402  GTVGSVLMCVPPTILICAVVALSSLKVAAVSFVMLIIGFIMHPLLNHMDRKKWLKFSISS  461

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+   TRE   +LI
Sbjct  462  DLPDLQQETREYEETLI  478



>ref|XP_002893692.1| amino acid permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69951.1| amino acid permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPL+GILFS
Sbjct  305  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLLGILFS  364

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+GT G++LM
Sbjct  365  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPIGTTGSILM  424

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI  V+A SSLKV  +S+  + IG VM P + H+++KRWLKFS+SSDLPD+   
Sbjct  425  CVPPTILIFAVVALSSLKVAAVSIVMMIIGFVMHPCLNHMDRKRWLKFSISSDLPDLQQE  484

Query  333  TRESAASLI  307
            TRE   +LI
Sbjct  485  TREYEETLI  493



>gb|ADE21401.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=182

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  852  VQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASGVILL  673
            VQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASGVILL
Sbjct  1    VQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASGVILL  60

Query  672  SWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVPPTIL  493
            SWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVPPTIL
Sbjct  61   SWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVPPTIL  120

Query  492  IGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRESAAS  313
            I VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ + T E + S
Sbjct  121  ICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLN-THEHSES  179

Query  312  LI  307
            L+
Sbjct  180  LV  181



>ref|XP_010499733.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Camelina sativa]
 ref|XP_010499734.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Camelina sativa]
Length=498

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPL+GILFS
Sbjct  309  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLLGILFS  368

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+GT+G++LM
Sbjct  369  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKYPAASRPYKIPIGTVGSILM  428

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI  V+A SSLKV  +S+  + +G +M P + H+++KRW+KFS+SSDLPD+   
Sbjct  429  CVPPTILISAVVALSSLKVAAVSVVMLLVGFIMHPFLNHMDRKRWVKFSISSDLPDLQQQ  488

Query  333  TRESAASLI  307
            TRE   +LI
Sbjct  489  TREYEETLI  497



>ref|XP_010054043.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Eucalyptus grandis]
Length=540

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 178/198 (90%), Gaps = 2/198 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WWVQ AAAM+NMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRS+HGT
Sbjct  343  DIAKIIG-GVWLRWWVQAAAAMANMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSKHGT  401

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LRIK P+A RPYKIPV
Sbjct  402  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVKLRIKYPNASRPYKIPV  461

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+ MC+PPTILIG+VLA S+LKV ++SL A+ IG +M+P +++V+KKRWLKFSV+S
Sbjct  462  GTIGAIAMCIPPTILIGIVLALSTLKVAIVSLVAVVIGFIMEPALKYVDKKRWLKFSVNS  521

Query  357  DLPDIDH-TTRESAASLI  307
            +L D+++ T+RES  SL+
Sbjct  522  NLIDLNNDTSRESTVSLV  539



>ref|XP_010499735.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Camelina sativa]
Length=482

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPL+GILFS
Sbjct  293  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLLGILFS  352

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+GT+G++LM
Sbjct  353  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKYPAASRPYKIPIGTVGSILM  412

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI  V+A SSLKV  +S+  + +G +M P + H+++KRW+KFS+SSDLPD+   
Sbjct  413  CVPPTILISAVVALSSLKVAAVSVVMLLVGFIMHPFLNHMDRKRWVKFSISSDLPDLQQQ  472

Query  333  TRESAASLI  307
            TRE   +LI
Sbjct  473  TREYEETLI  481



>ref|XP_006415290.1| hypothetical protein EUTSA_v10007456mg [Eutrema salsugineum]
 gb|ESQ33643.1| hypothetical protein EUTSA_v10007456mg [Eutrema salsugineum]
Length=496

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPL+GILFS
Sbjct  307  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLLGILFS  366

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+GT+G++LM
Sbjct  367  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKYPAASRPYKIPIGTVGSILM  426

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI  V A SSLKV  +S   + IG +M P + H+++KRWLKFS+SSDLPD+   
Sbjct  427  CVPPTILIFAVAALSSLKVAAVSFVMLIIGFLMHPCLNHMDRKRWLKFSISSDLPDLQQQ  486

Query  333  TRESAASLI  307
            TRE   +LI
Sbjct  487  TRECEETLI  495



>ref|XP_006415289.1| hypothetical protein EUTSA_v10007456mg [Eutrema salsugineum]
 gb|ESQ33642.1| hypothetical protein EUTSA_v10007456mg [Eutrema salsugineum]
Length=479

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK    GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  283  DVAKA-LGGAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  341

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+
Sbjct  342  PLLGILFSASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKYPAASRPYKIPI  401

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPTILI  V A SSLKV  +S   + IG +M P + H+++KRWLKFS+SS
Sbjct  402  GTVGSILMCVPPTILIFAVAALSSLKVAAVSFVMLIIGFLMHPCLNHMDRKRWLKFSISS  461

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+   TRE   +LI
Sbjct  462  DLPDLQQQTRECEETLI  478



>ref|XP_002263817.2| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Vitis vinifera]
Length=517

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 168/197 (85%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   G WL WW+ GAAA SN+GMFVAEMSSDSFQLLGMAERGMLP  FAKRS +GT
Sbjct  321  DVAKMIG-GVWLGWWITGAAAASNLGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSHYGT  379

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSW+SFQEI+AAENFLYCFGMILEFIAFV LRIK P A RPYKIP+
Sbjct  380  PLIGILFSASGVLLLSWMSFQEIIAAENFLYCFGMILEFIAFVRLRIKYPAASRPYKIPL  439

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPTILI +VLA SSLKV V+SL A+ IGLV+QP ++ +E+KRWLKFSVSS
Sbjct  440  GTVGSILMCVPPTILICIVLALSSLKVAVVSLIAVIIGLVLQPCLKCIERKRWLKFSVSS  499

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+     E+   L+
Sbjct  500  DLPDLHCENHENVEPLV  516



>ref|XP_010478602.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Camelina sativa]
Length=483

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPL+GILFS
Sbjct  294  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLLGILFS  353

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+GT+G++LM
Sbjct  354  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPIGTVGSILM  413

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI  V+A SSLKV  +S+  + +G +M P + H+++KRW+KFS+SSDLPD+   
Sbjct  414  CVPPTILICAVVALSSLKVAAVSVVMLLVGFIMHPFLNHMDRKRWVKFSISSDLPDLQQQ  473

Query  333  TRESAASLI  307
            TRE   +LI
Sbjct  474  TREYEETLI  482



>ref|XP_010478600.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Camelina sativa]
 ref|XP_010478601.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Camelina sativa]
Length=499

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPL+GILFS
Sbjct  310  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLLGILFS  369

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+GT+G++LM
Sbjct  370  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPIGTVGSILM  429

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPTILI  V+A SSLKV  +S+  + +G +M P + H+++KRW+KFS+SSDLPD+   
Sbjct  430  CVPPTILICAVVALSSLKVAAVSVVMLLVGFIMHPFLNHMDRKRWVKFSISSDLPDLQQQ  489

Query  333  TRESAASLI  307
            TRE   +LI
Sbjct  490  TREYEETLI  498



>ref|XP_009396111.1| PREDICTED: probable polyamine transporter At1g31830 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 167/195 (86%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WWVQGA+A+SNMGMFVAEMSSDS+QLLGMAERGMLPEFF KRSR+GT
Sbjct  276  DVAKI-LAGVWLRWWVQGASALSNMGMFVAEMSSDSYQLLGMAERGMLPEFFGKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSW+SFQEIVAAENFLYCFGMILEF+AF+ LR+  P+APRPYKIP+
Sbjct  335  PLVGILFSASGVLLLSWMSFQEIVAAENFLYCFGMILEFVAFIKLRLIYPNAPRPYKIPL  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G +LM +PPTILI VVLA ++LKV+V+S+ A+ IG ++QP ++HVEKKR LKFSV+S
Sbjct  395  GTAGCILMIIPPTILICVVLALATLKVMVVSVTAMLIGFILQPCLKHVEKKRLLKFSVNS  454

Query  357  DLPDIDHTTRESAAS  313
            DLPD      E+   
Sbjct  455  DLPDFREAQCENTVE  469



>ref|XP_003572852.1| PREDICTED: polyamine transporter PUT1-like [Brachypodium distachyon]
Length=530

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 171/195 (88%), Gaps = 2/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR-HG  721
            D+A++   GAWL WWVQ A+A+SNMGMFVAEMSSDS+QLLGMAERGMLP FFA+RSR HG
Sbjct  330  DVARL-LGGAWLMWWVQAASALSNMGMFVAEMSSDSYQLLGMAERGMLPAFFARRSRRHG  388

Query  720  TPLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIP  541
            TPL+GILFSASGV+LLS +SFQEIVAAENFLYCFGMILEF+AFV LR++ PDAPRPY++P
Sbjct  389  TPLVGILFSASGVLLLSAMSFQEIVAAENFLYCFGMILEFLAFVLLRVRRPDAPRPYRVP  448

Query  540  VGTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVS  361
            +GT G V M +PPT LI VVLA S+LKV ++SLGA+AIGLV+QP +R VEKKRWL+FSV+
Sbjct  449  LGTAGCVAMLLPPTALIVVVLALSTLKVALVSLGAVAIGLVLQPALRFVEKKRWLRFSVN  508

Query  360  SDLPDIDHTTRESAA  316
             DLPDID T ++ AA
Sbjct  509  PDLPDIDVTRQQPAA  523



>ref|XP_010255748.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Nelumbo nucifera]
Length=487

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DI K+   G WL  W+QGAAA++NMGMFVAEMSSDSFQLLGMAERGMLPEFF  RSR+GT
Sbjct  290  DIGKM-LGGVWLRTWIQGAAALANMGMFVAEMSSDSFQLLGMAERGMLPEFFGNRSRYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSF+EIVAAENFLYCFGMILEFI+FV LRI++P A RP+KIPV
Sbjct  349  PLVGILFSASGVILLSWLSFEEIVAAENFLYCFGMILEFISFVKLRIQNPTASRPFKIPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+LMCVPPTILI VVLA +SLK++ ISL A+ IG ++ PG+++VEKKRW++FS+S+
Sbjct  409  GTIGAILMCVPPTILICVVLAIASLKIMGISLLAVLIGFLLHPGLKYVEKKRWMRFSISA  468

Query  357  DLPDIDHTTRESAASLI*N  301
            DLPD+   T   +   I N
Sbjct  469  DLPDLYAATNNESIETIRN  487



>ref|XP_004513415.1| PREDICTED: probable polyamine transporter At1g31830-like [Cicer 
arietinum]
Length=462

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA I   G WL WW+Q AAA+SNMG+FVAEMSSDSF LLGMAERGMLP+FF KRSR+GT
Sbjct  268  DIAMIIG-GVWLRWWLQAAAAVSNMGLFVAEMSSDSFMLLGMAERGMLPKFFTKRSRYGT  326

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGVILLSWLSF+EIVAAENFLYCFGMILEFIAF+ L+IK P+APRPYK+P 
Sbjct  327  PIIGILFSASGVILLSWLSFEEIVAAENFLYCFGMILEFIAFILLKIKKPNAPRPYKVPG  386

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGA++MC+PPTILI  VL FSS+KV+VIS  A+ IGLVMQP ++ VEKK+W+KFSVS 
Sbjct  387  GKIGAIVMCIPPTILICFVLYFSSIKVMVISFIALVIGLVMQPCLKFVEKKKWVKFSVSP  446

Query  357  DLPDIDH  337
            DLPD+D+
Sbjct  447  DLPDLDN  453



>ref|XP_003548709.1| PREDICTED: probable polyamine transporter At1g31830-like [Glycine 
max]
 gb|KHN47637.1| Putative transporter [Glycine soja]
Length=473

 Score =   290 bits (741),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL WW+Q AAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF+KRSR GTPL+GILFS
Sbjct  285  GVWLRWWLQAAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFSKRSRFGTPLVGILFS  344

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEF+AF+ LRI+ P+A RPYK+P GT GA+ +
Sbjct  345  ASGVILLSWLSFQEIVAAENFLYCFGMILEFVAFILLRIRHPNASRPYKVPGGTAGAITI  404

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPT+LI VVLAFSS KVLVISL A+AIGLVMQP ++ +E++RW+KFSV S+L D+D+ 
Sbjct  405  CIPPTVLIFVVLAFSSNKVLVISLIAMAIGLVMQPCLKIMEERRWMKFSVRSELQDLDN-  463

Query  333  TRESAASLI  307
              ES  S +
Sbjct  464  NEESIHSFV  472



>gb|ADE21399.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=182

 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -1

Query  852  VQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASGVILL  673
            VQ  AA+SNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASGVILL
Sbjct  1    VQAGAALSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASGVILL  60

Query  672  SWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVPPTIL  493
            SWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVPPTIL
Sbjct  61   SWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVPPTIL  120

Query  492  IGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRESAA  316
            I VVLA SSLKV+++S+ AI  G  ++P ++  EKKRWLKFS  +DLPD+ +T   S +
Sbjct  121  ICVVLALSSLKVMIVSVIAIFFGFALKPFLKFAEKKRWLKFSTKADLPDLLNTHEHSES  179



>gb|ADE21391.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=182

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -1

Query  852  VQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASGVILL  673
            VQ  AAMSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASGV+LL
Sbjct  1    VQAGAAMSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASGVLLL  60

Query  672  SWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVPPTIL  493
            SWLSFQEIV AENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVPPTIL
Sbjct  61   SWLSFQEIVPAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVPPTIL  120

Query  492  IGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRESAA  316
            I VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   S +
Sbjct  121  ICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEHSES  179



>ref|XP_010255749.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Nelumbo nucifera]
Length=535

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DI K+   G WL  W+QGAAA++NMGMFVAEMSSDSFQLLGMAERGMLPEFF  RSR+GT
Sbjct  338  DIGKM-LGGVWLRTWIQGAAALANMGMFVAEMSSDSFQLLGMAERGMLPEFFGNRSRYGT  396

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSF+EIVAAENFLYCFGMILEFI+FV LRI++P A RP+KIPV
Sbjct  397  PLVGILFSASGVILLSWLSFEEIVAAENFLYCFGMILEFISFVKLRIQNPTASRPFKIPV  456

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+LMCVPPTILI VVLA +SLK++ ISL A+ IG ++ PG+++VEKKRW++FS+S+
Sbjct  457  GTIGAILMCVPPTILICVVLAIASLKIMGISLLAVLIGFLLHPGLKYVEKKRWMRFSISA  516

Query  357  DLPDIDHTTRESAASLI*N  301
            DLPD+   T   +   I N
Sbjct  517  DLPDLYAATNNESIETIRN  535



>ref|XP_009418587.1| PREDICTED: probable polyamine transporter At1g31830 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418588.1| PREDICTED: probable polyamine transporter At1g31830 [Musa acuminata 
subsp. malaccensis]
Length=487

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 168/193 (87%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WWVQGA+A+SNMGMFVAEMSSDS+QLLGMAERGMLPEFF+KRSRHGT
Sbjct  290  DVAKI-VAGVWLRWWVQGASALSNMGMFVAEMSSDSYQLLGMAERGMLPEFFSKRSRHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSW+SFQEI+AAENFLYCFGMILE++AF+ LR+  P+A RPYK+P+
Sbjct  349  PLVGILFSASGVLLLSWMSFQEIIAAENFLYCFGMILEYVAFIKLRLSHPNASRPYKVPL  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G +LM VPPTILI VVLA +S KV+++S+ A+ IG V+QP ++HVEKK+ LKF+++S
Sbjct  409  GTAGCILMIVPPTILICVVLALASFKVMIVSIIAMLIGSVLQPCLKHVEKKKLLKFTLNS  468

Query  357  DLPDIDHTTRESA  319
            DLPD   +  ESA
Sbjct  469  DLPDFRESEHESA  481



>ref|XP_003631566.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Vitis vinifera]
 ref|XP_010646567.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Vitis vinifera]
Length=483

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 166/196 (85%), Gaps = 4/196 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGA+A+SNMGMFVAEMSSDSFQLLGMAERGMLP+FFAKRSR+GT
Sbjct  287  DIAKILG-GIWLRSWIQGASALSNMGMFVAEMSSDSFQLLGMAERGMLPDFFAKRSRYGT  345

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMI+EFIAFV LR++ P A RPY IPV
Sbjct  346  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRMRYPAASRPYMIPV  405

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMC+PPT+LI VVLA +S KV+VISL A+ IGLVMQP + + EKKRWL+FS+SS
Sbjct  406  GTTGAILMCIPPTLLICVVLALASFKVMVISLLAVMIGLVMQPCLLYAEKKRWLRFSMSS  465

Query  357  DLPDID---HTTRESA  319
            DLPD     H   ES 
Sbjct  466  DLPDFHSAYHGDTESG  481



>ref|XP_010646560.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Vitis vinifera]
 ref|XP_010646563.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Vitis vinifera]
Length=485

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 166/196 (85%), Gaps = 4/196 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGA+A+SNMGMFVAEMSSDSFQLLGMAERGMLP+FFAKRSR+GT
Sbjct  289  DIAKILG-GIWLRSWIQGASALSNMGMFVAEMSSDSFQLLGMAERGMLPDFFAKRSRYGT  347

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMI+EFIAFV LR++ P A RPY IPV
Sbjct  348  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRMRYPAASRPYMIPV  407

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMC+PPT+LI VVLA +S KV+VISL A+ IGLVMQP + + EKKRWL+FS+SS
Sbjct  408  GTTGAILMCIPPTLLICVVLALASFKVMVISLLAVMIGLVMQPCLLYAEKKRWLRFSMSS  467

Query  357  DLPDID---HTTRESA  319
            DLPD     H   ES 
Sbjct  468  DLPDFHSAYHGDTESG  483



>ref|XP_002280603.1| PREDICTED: probable polyamine transporter At1g31830 isoform X4 
[Vitis vinifera]
Length=469

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 166/196 (85%), Gaps = 4/196 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGA+A+SNMGMFVAEMSSDSFQLLGMAERGMLP+FFAKRSR+GT
Sbjct  273  DIAKILG-GIWLRSWIQGASALSNMGMFVAEMSSDSFQLLGMAERGMLPDFFAKRSRYGT  331

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMI+EFIAFV LR++ P A RPY IPV
Sbjct  332  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRMRYPAASRPYMIPV  391

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMC+PPT+LI VVLA +S KV+VISL A+ IGLVMQP + + EKKRWL+FS+SS
Sbjct  392  GTTGAILMCIPPTLLICVVLALASFKVMVISLLAVMIGLVMQPCLLYAEKKRWLRFSMSS  451

Query  357  DLPDID---HTTRESA  319
            DLPD     H   ES 
Sbjct  452  DLPDFHSAYHGDTESG  467



>ref|NP_973947.1| polyamine transporter 2 [Arabidopsis thaliana]
 dbj|BAH19774.1| AT1G31830 [Arabidopsis thaliana]
 gb|AEE31401.1| probable polyamine transporter [Arabidopsis thaliana]
Length=479

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK    GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  283  DVAK-ALGGAWLRWWVQAAAATSNMGMFIAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  341

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+
Sbjct  342  PLLGILFSASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPI  401

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G++LMC+PPTILI  V+A SSLKV  +S+  + IG ++ P + H+++KRW+KFS+SS
Sbjct  402  GTTGSILMCIPPTILICAVVALSSLKVAAVSIVMMIIGFLIHPLLNHMDRKRWVKFSISS  461

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+   TRE   +LI
Sbjct  462  DLPDLQQQTREYEETLI  478



>ref|NP_174466.1| polyamine transporter 2 [Arabidopsis thaliana]
 sp|Q9C6S5.1|PHSB_ARATH RecName: Full=Probable polyamine transporter At1g31830 [Arabidopsis 
thaliana]
 gb|AAG50709.1|AC079041_2 amino acid permease, putative [Arabidopsis thaliana]
 gb|ABO38788.1| At1g31830 [Arabidopsis thaliana]
 gb|AEE31400.1| probable polyamine transporter [Arabidopsis thaliana]
Length=495

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPL+GILFS
Sbjct  306  GAWLRWWVQAAAATSNMGMFIAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLLGILFS  365

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+GT G++LM
Sbjct  366  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPIGTTGSILM  425

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI  V+A SSLKV  +S+  + IG ++ P + H+++KRW+KFS+SSDLPD+   
Sbjct  426  CIPPTILICAVVALSSLKVAAVSIVMMIIGFLIHPLLNHMDRKRWVKFSISSDLPDLQQQ  485

Query  333  TRESAASLI  307
            TRE   +LI
Sbjct  486  TREYEETLI  494



>ref|XP_010943633.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Elaeis guineensis]
Length=472

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 167/195 (86%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WWVQGA+A+SNMGMFVAEMSSDS+QLLGM+ERGMLPEFF+KRSR+GT
Sbjct  275  DIAKI-LGGVWLRWWVQGASALSNMGMFVAEMSSDSYQLLGMSERGMLPEFFSKRSRYGT  333

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAENFLYCFGMILEF+AFV LRI+ P APRPY++P+
Sbjct  334  PLVGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFVAFVKLRIEQPTAPRPYRVPL  393

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
             T G +LM +PPT+LI VVLA +S KV+++S+ A+ +G V+QP + +VEK+RWL+FSVSS
Sbjct  394  ETTGCILMVLPPTLLICVVLALASFKVMIVSVVAMLVGFVLQPCLMYVEKRRWLRFSVSS  453

Query  357  DLPDIDHTTRESAAS  313
            DLPD      E+ A 
Sbjct  454  DLPDFRSAENENDAE  468



>ref|XP_010943632.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Elaeis guineensis]
Length=488

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 167/195 (86%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WWVQGA+A+SNMGMFVAEMSSDS+QLLGM+ERGMLPEFF+KRSR+GT
Sbjct  291  DIAKI-LGGVWLRWWVQGASALSNMGMFVAEMSSDSYQLLGMSERGMLPEFFSKRSRYGT  349

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAENFLYCFGMILEF+AFV LRI+ P APRPY++P+
Sbjct  350  PLVGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFVAFVKLRIEQPTAPRPYRVPL  409

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
             T G +LM +PPT+LI VVLA +S KV+++S+ A+ +G V+QP + +VEK+RWL+FSVSS
Sbjct  410  ETTGCILMVLPPTLLICVVLALASFKVMIVSVVAMLVGFVLQPCLMYVEKRRWLRFSVSS  469

Query  357  DLPDIDHTTRESAAS  313
            DLPD      E+ A 
Sbjct  470  DLPDFRSAENENDAE  484



>ref|XP_007158143.1| hypothetical protein PHAVU_002G128000g [Phaseolus vulgaris]
 ref|XP_007158144.1| hypothetical protein PHAVU_002G128000g [Phaseolus vulgaris]
 gb|ESW30137.1| hypothetical protein PHAVU_002G128000g [Phaseolus vulgaris]
 gb|ESW30138.1| hypothetical protein PHAVU_002G128000g [Phaseolus vulgaris]
Length=470

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 169/197 (86%), Gaps = 3/197 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA I   GAWL WW+Q AAAMSNMGMFVAEMSSD+FQLLGMAERGMLPE F+ RSRHGT
Sbjct  276  DIAMIIG-GAWLRWWLQAAAAMSNMGMFVAEMSSDAFQLLGMAERGMLPEIFSMRSRHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSW+SFQEIVAAENFLYCFGMILEFIAF+ LRIK P+A RPYKI  
Sbjct  335  PLIGILFSASGVILLSWMSFQEIVAAENFLYCFGMILEFIAFILLRIKHPNASRPYKISG  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA L+C+PPTILI VVL FSSLK++ ISL A+AIGLV+QP +++ EKKRW+KF+ +S
Sbjct  395  GTVGAFLICIPPTILICVVLFFSSLKIMFISLFAMAIGLVLQPCLKYAEKKRWMKFTHNS  454

Query  357  DLPDIDHTTRESAASLI  307
            +LPD  +  +E   SL+
Sbjct  455  ELPDFGN--QEITRSLV  469



>emb|CBI37466.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   286 bits (732),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WLSWW+ GAAA SN+GMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GTPLIGIL S
Sbjct  202  GVWLSWWIAGAAAASNLGMFVAEMSSDSFQLLGMAERGMLPSVFAKRSRYGTPLIGILLS  261

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSW+SFQE +AAENFLYCFGMILEFIAFV LRIK P APRPYKIP+GTIG++LM
Sbjct  262  ASGVLLLSWMSFQETIAAENFLYCFGMILEFIAFVRLRIKYPAAPRPYKIPLGTIGSILM  321

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI +++A SSLKV V SL  + IGL+MQP ++  E+K+W KFSVSSDLPD++  
Sbjct  322  CIPPTILICIMVALSSLKVAVASLIVVIIGLLMQPCLKCAERKKWFKFSVSSDLPDLNGE  381

Query  333  TRESAASLI  307
              E+   L+
Sbjct  382  NDENVVPLM  390



>gb|KEH17211.1| amino acid permease [Medicago truncatula]
Length=668

 Score =   293 bits (749),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 165/192 (86%), Gaps = 7/192 (4%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+  AAA+SNMG+FVAEMS+DSFQLLGMAERGMLPEFF KRSR+GTP+IGILFS
Sbjct  373  GAWLRWWLNAAAAVSNMGLFVAEMSADSFQLLGMAERGMLPEFFTKRSRYGTPIIGILFS  432

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSF EIVAAENFLYCFGMILEFIAF+ L+IK P+A RPYK+P G +GA+ +
Sbjct  433  ASGVILLSWLSFDEIVAAENFLYCFGMILEFIAFILLKIKKPNASRPYKVPGGKVGAIFL  492

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDH-  337
            C+PPTILIG VLAFSSLKV VIS+ A+ IGLVMQP ++ VE+K+W+KFSVS DLPD+D+ 
Sbjct  493  CIPPTILIGFVLAFSSLKVFVISVIAMVIGLVMQPCLKFVERKKWIKFSVSPDLPDLDNG  552

Query  336  ------TTRESA  319
                  TTR  A
Sbjct  553  ESTQTLTTRSHA  564



>ref|XP_009114955.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Brassica rapa]
 ref|XP_009114956.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Brassica rapa]
Length=481

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK    GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  285  DVAK-ALGGAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  343

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+
Sbjct  344  PLLGILFSASGVLLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPI  403

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPT+LI  V+A SSLKV  +S   + IG VM P + H+++K+ LKFS+SS
Sbjct  404  GTVGSILMCVPPTLLICAVVALSSLKVAAVSFVMLIIGFVMHPCLNHMDRKKILKFSISS  463

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+   TRE   +LI
Sbjct  464  DLPDLQQETRECQETLI  480



>emb|CDY12285.1| BnaA09g24850D [Brassica napus]
Length=498

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK    GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  302  DVAK-ALGGAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  360

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+
Sbjct  361  PLLGILFSASGVLLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPI  420

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPT+LI  V+A SSLKV  +S   + IG VM P + H+++K+ LKFS+SS
Sbjct  421  GTVGSILMCVPPTLLICAVVALSSLKVAAVSFVMLIIGFVMHPCLNHMDRKKILKFSISS  480

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+   TRE   +LI
Sbjct  481  DLPDLQQETRECQETLI  497



>ref|XP_010461005.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Camelina sativa]
Length=483

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLP+FFAKRSR+GTPL+GILFS
Sbjct  294  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPKFFAKRSRYGTPLLGILFS  353

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R K P A RPYKIP+GT+G++LM
Sbjct  354  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRTKYPAASRPYKIPIGTVGSILM  413

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPT+LI  V+A SSLKV  +S   + +G +M P + H+++KRW+KFS+SSDLPD+   
Sbjct  414  CVPPTLLICAVVALSSLKVAAVSFVMLLVGFIMHPFLNHMDRKRWVKFSISSDLPDLQQQ  473

Query  333  TRESAASLI  307
            TRE   +L+
Sbjct  474  TREYEETLL  482



>gb|ADE21397.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=182

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = -1

Query  852  VQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASGVILL  673
            VQ   AMSNM MFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASGVILL
Sbjct  1    VQAGPAMSNMEMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASGVILL  60

Query  672  SWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVPPTIL  493
            SWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RPYKIPVGT+G++L+CVPPTIL
Sbjct  61   SWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKHPAASRPYKIPVGTVGSILLCVPPTIL  120

Query  492  IGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRESAAS  313
            I VVLA SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ + T E + S
Sbjct  121  ICVVLALSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLN-THEHSES  179

Query  312  LI  307
            L+
Sbjct  180  LV  181



>ref|XP_009114953.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Brassica rapa]
 ref|XP_009114954.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Brassica rapa]
Length=498

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK    GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  302  DVAK-ALGGAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEFFAKRSRYGT  360

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R+K P A RPYKIP+
Sbjct  361  PLLGILFSASGVLLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPI  420

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPT+LI  V+A SSLKV  +S   + IG VM P + H+++K+ LKFS+SS
Sbjct  421  GTVGSILMCVPPTLLICAVVALSSLKVAAVSFVMLIIGFVMHPCLNHMDRKKILKFSISS  480

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+   TRE   +LI
Sbjct  481  DLPDLQQETRECQETLI  497



>ref|XP_010461004.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Camelina sativa]
 ref|XP_010461006.1| PREDICTED: probable polyamine transporter At1g31830 isoform X3 
[Camelina sativa]
Length=499

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WWVQ AAA SNMGMF+AEMSSDSFQLLGMAERGMLP+FFAKRSR+GTPL+GILFS
Sbjct  310  GAWLRWWVQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPKFFAKRSRYGTPLLGILFS  369

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAEN LYC GMILEFIAFV +R K P A RPYKIP+GT+G++LM
Sbjct  370  ASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRTKYPAASRPYKIPIGTVGSILM  429

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPPT+LI  V+A SSLKV  +S   + +G +M P + H+++KRW+KFS+SSDLPD+   
Sbjct  430  CVPPTLLICAVVALSSLKVAAVSFVMLLVGFIMHPFLNHMDRKRWVKFSISSDLPDLQQQ  489

Query  333  TRESAASLI  307
            TRE   +L+
Sbjct  490  TREYEETLL  498



>ref|XP_007156318.1| hypothetical protein PHAVU_003G276300g [Phaseolus vulgaris]
 gb|ESW28312.1| hypothetical protein PHAVU_003G276300g [Phaseolus vulgaris]
Length=476

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I   G WL WW+Q AAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFF KRSR+GT
Sbjct  282  DIAEIVG-GVWLRWWLQAAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFGKRSRYGT  340

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEF+AF+ LR+K P+A RPYKIP 
Sbjct  341  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFVAFILLRMKHPNASRPYKIPG  400

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GAV +C+PPTILI VV+AFS+ KVLVISL A+ IGLVMQP ++ +E++RW+KFSV  
Sbjct  401  GTAGAVAICIPPTILICVVMAFSTNKVLVISLIAVLIGLVMQPCLKILEERRWIKFSVRY  460

Query  357  DLPDIDHTTRESAASLI  307
            +L D+ +   ES  S I
Sbjct  461  ELQDLHN--EESTHSFI  475



>ref|XP_008775610.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Phoenix dactylifera]
Length=478

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGA+A+SNMGMF+AEMSSDS+QLLGM+ERGMLPEFF+KRSR+GT
Sbjct  275  DIAKILG-GVWLRWWIQGASALSNMGMFIAEMSSDSYQLLGMSERGMLPEFFSKRSRYGT  333

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSW+SFQEIVAAENFLYCFGMILEF+AF+ LRI+ P APRPY++P+
Sbjct  334  PLVGILFSASGVILLSWMSFQEIVAAENFLYCFGMILEFVAFIKLRIERPTAPRPYRVPL  393

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
             T+G +LM +PPT+LI VVLA +S KV+++SL A+ IG V+QP + ++EK+RWL+FS+SS
Sbjct  394  ETVGCILMVIPPTVLICVVLALASFKVMIVSLVAMLIGFVLQPCLMYMEKRRWLRFSISS  453

Query  357  DLPDIDHTTRESAAS  313
            DLPD      E+ A 
Sbjct  454  DLPDFRSAECENDAE  468



>ref|XP_010665391.1| PREDICTED: probable polyamine transporter At1g31830 [Vitis vinifera]
Length=502

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WLSWW+ GAAA SN+GMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GTPLIGIL S
Sbjct  313  GVWLSWWIAGAAAASNLGMFVAEMSSDSFQLLGMAERGMLPSVFAKRSRYGTPLIGILLS  372

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSW+SFQE +AAENFLYCFGMILEFIAFV LRIK P APRPYKIP+GTIG++LM
Sbjct  373  ASGVLLLSWMSFQETIAAENFLYCFGMILEFIAFVRLRIKYPAAPRPYKIPLGTIGSILM  432

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI +++A SSLKV V SL  + IGL+MQP ++  E+K+W KFSVSSDLPD++  
Sbjct  433  CIPPTILICIMVALSSLKVAVASLIVVIIGLLMQPCLKCAERKKWFKFSVSSDLPDLNGE  492

Query  333  TRESAASLI  307
              E+   L+
Sbjct  493  NDENVVPLV  501



>ref|XP_008775609.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Phoenix dactylifera]
Length=493

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGA+A+SNMGMF+AEMSSDS+QLLGM+ERGMLPEFF+KRSR+GT
Sbjct  290  DIAKI-LGGVWLRWWIQGASALSNMGMFIAEMSSDSYQLLGMSERGMLPEFFSKRSRYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSW+SFQEIVAAENFLYCFGMILEF+AF+ LRI+ P APRPY++P+
Sbjct  349  PLVGILFSASGVILLSWMSFQEIVAAENFLYCFGMILEFVAFIKLRIERPTAPRPYRVPL  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
             T+G +LM +PPT+LI VVLA +S KV+++SL A+ IG V+QP + ++EK+RWL+FS+SS
Sbjct  409  ETVGCILMVIPPTVLICVVLALASFKVMIVSLVAMLIGFVLQPCLMYMEKRRWLRFSISS  468

Query  357  DLPDIDHTTRESAAS  313
            DLPD      E+ A 
Sbjct  469  DLPDFRSAECENDAE  483



>ref|XP_010423447.1| PREDICTED: polyamine transporter RMV1 [Camelina sativa]
Length=491

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGMLP+ FAKRSR+GTP +GILFS
Sbjct  313  GAWLGWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPQVFAKRSRYGTPWVGILFS  372

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFV LR+K P A RP+KIPVG +G++LM
Sbjct  373  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVRLRMKYPAASRPFKIPVGVLGSILM  432

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI  343
            C+PPT+LIGV++AF++LKV  +SL AI IGLV+QP ++ VEKK WLKFS SS LP++
Sbjct  433  CIPPTVLIGVIMAFTNLKVAAVSLAAIVIGLVLQPCLKQVEKKGWLKFSTSSHLPNL  489



>ref|XP_006287622.1| hypothetical protein CARUB_v10000834mg [Capsella rubella]
 gb|EOA20520.1| hypothetical protein CARUB_v10000834mg [Capsella rubella]
Length=486

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGMLP+ FAKRSRHGTP +GILFS
Sbjct  308  GAWLGWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPQVFAKRSRHGTPWVGILFS  367

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAEN LYCFGMILEFIAFV LR+K P A RP+KIPVG +G++LM
Sbjct  368  ASGVILLSWLSFQEIVAAENLLYCFGMILEFIAFVRLRMKQPAASRPFKIPVGVLGSILM  427

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI  343
            C+PPT+LIGV++AF++LKV  +SL AI IGLV+QP ++ VEKK WLKFS SS LP++
Sbjct  428  CIPPTVLIGVIMAFTNLKVAAVSLAAIVIGLVLQPCLKQVEKKGWLKFSTSSHLPNL  484



>ref|XP_010112984.1| Y+L amino acid transporter 2 [Morus notabilis]
 gb|EXC35155.1| Y+L amino acid transporter 2 [Morus notabilis]
Length=478

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+Q AAAMSNMGMFVA +SSDSFQLLGMAERGMLP +FA+RSRHGT
Sbjct  277  DIAKILG-GVWLRWWIQVAAAMSNMGMFVATLSSDSFQLLGMAERGMLPAYFAQRSRHGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASG++LL WLSFQEIVAAENFL+CFGMILEFIAFV LR+K P A RPYKIPV
Sbjct  336  PLMGILFSASGILLLCWLSFQEIVAAENFLHCFGMILEFIAFVRLRVKRPTAARPYKIPV  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA++MC+P TI I +VL  SS+KVLVIS+G IAIG ++ P ++HVEKK  +KFS S+
Sbjct  396  GTVGAIVMCIPSTIFICIVLVLSSVKVLVISMGVIAIGFMINPLLKHVEKKGLMKFSTST  455

Query  357  DLPDIDHTTRESAA  316
            DLPDID    E+ +
Sbjct  456  DLPDIDGAHEENNS  469



>ref|XP_004512388.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X7 [Cicer arietinum]
Length=448

 Score =   284 bits (726),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA I   G WL WW+Q AAA+SNMGMFVAEMSSDSFQLLGMA+RGMLPEFF KRSR+GT
Sbjct  254  DIAMIIG-GVWLRWWLQAAAALSNMGMFVAEMSSDSFQLLGMADRGMLPEFFTKRSRYGT  312

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYC GMILEFIAF+ L+IK P+A RPYK+P 
Sbjct  313  PLIGILFSASGVILLSWLSFQEIVAAENFLYCIGMILEFIAFILLKIKRPNASRPYKVPG  372

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G  GA++MC+PPTILI VVLAFSSLKV V+SL A++IGLV+QP ++ +EKKRW+KFS S 
Sbjct  373  GVTGAIIMCIPPTILICVVLAFSSLKVFVVSLVAMSIGLVLQPCLKFMEKKRWMKFSHSP  432

Query  357  DLPDIDH  337
            +LP+ + 
Sbjct  433  ELPNFED  439



>gb|ADE21386.1| amino acid permease-like protein, partial [Helianthus neglectus]
 gb|ADE21387.1| amino acid permease-like protein, partial [Helianthus neglectus]
Length=176

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -1

Query  834  MSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASGVILLSWLSFQ  655
            MSNMGMFV EMSSDSFQLLGMAERGM+PEFFAKRSRHGTP +GILFSASGVILLSWLSFQ
Sbjct  1    MSNMGMFVTEMSSDSFQLLGMAERGMIPEFFAKRSRHGTPTLGILFSASGVILLSWLSFQ  60

Query  654  EIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVPPTILIGVVLA  475
            EIVAAENFLYCFGMILEF+AFV LR+K P A RPYKIPVGT+G++L+CVPPTILI VVLA
Sbjct  61   EIVAAENFLYCFGMILEFLAFVRLRMKHPAASRPYKIPVGTVGSILLCVPPTILICVVLA  120

Query  474  FSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRESAA  316
             SSLKV+++S+ AI  G  +QP ++  EKKRWLKFS  +DLPD+ +T   S +
Sbjct  121  LSSLKVMIVSVIAIFFGFALQPFLKFAEKKRWLKFSTKADLPDLLNTHEHSES  173



>ref|XP_004512382.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X1 [Cicer arietinum]
 ref|XP_004512383.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X2 [Cicer arietinum]
Length=494

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA I   G WL WW+Q AAA+SNMGMFVAEMSSDSFQLLGMA+RGMLPEFF KRSR+GT
Sbjct  300  DIAMIIG-GVWLRWWLQAAAALSNMGMFVAEMSSDSFQLLGMADRGMLPEFFTKRSRYGT  358

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYC GMILEFIAF+ L+IK P+A RPYK+P 
Sbjct  359  PLIGILFSASGVILLSWLSFQEIVAAENFLYCIGMILEFIAFILLKIKRPNASRPYKVPG  418

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G  GA++MC+PPTILI VVLAFSSLKV V+SL A++IGLV+QP ++ +EKKRW+KFS S 
Sbjct  419  GVTGAIIMCIPPTILICVVLAFSSLKVFVVSLVAMSIGLVLQPCLKFMEKKRWMKFSHSP  478

Query  357  DLPDIDH  337
            +LP+ + 
Sbjct  479  ELPNFED  485



>ref|XP_004512384.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512385.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X4 [Cicer arietinum]
 ref|XP_004512386.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X5 [Cicer arietinum]
 ref|XP_004512387.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 
X6 [Cicer arietinum]
Length=472

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA I   G WL WW+Q AAA+SNMGMFVAEMSSDSFQLLGMA+RGMLPEFF KRSR+GT
Sbjct  278  DIAMIIG-GVWLRWWLQAAAALSNMGMFVAEMSSDSFQLLGMADRGMLPEFFTKRSRYGT  336

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENFLYC GMILEFIAF+ L+IK P+A RPYK+P 
Sbjct  337  PLIGILFSASGVILLSWLSFQEIVAAENFLYCIGMILEFIAFILLKIKRPNASRPYKVPG  396

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G  GA++MC+PPTILI VVLAFSSLKV V+SL A++IGLV+QP ++ +EKKRW+KFS S 
Sbjct  397  GVTGAIIMCIPPTILICVVLAFSSLKVFVVSLVAMSIGLVLQPCLKFMEKKRWMKFSHSP  456

Query  357  DLPDIDH  337
            +LP+ + 
Sbjct  457  ELPNFED  463



>ref|XP_010452471.1| PREDICTED: polyamine transporter RMV1-like [Camelina sativa]
Length=492

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGMLP+ FAKRSR+GTP +GILFS
Sbjct  314  GAWLGWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPQVFAKRSRYGTPWVGILFS  373

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAEN LYCFGMILEFIAFV LR+K P A RP+KIPVG +G++LM
Sbjct  374  ASGVILLSWLSFQEIVAAENLLYCFGMILEFIAFVRLRMKYPAASRPFKIPVGVLGSILM  433

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI  343
            C+PPTILIGV++AF++LKV  +SL AI IGLV+QP ++ VEKK WLKFS SS LP++
Sbjct  434  CIPPTILIGVIMAFTNLKVAAVSLAAIVIGLVLQPCLKQVEKKGWLKFSTSSHLPNL  490



>ref|XP_004953578.1| PREDICTED: polyamine transporter PUT1-like isoform X2 [Setaria 
italica]
Length=480

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   GAWL WWVQ AAA+SNMGMFVAEMSSDS+QLLGMAERGMLP FFA+RSRHGT
Sbjct  282  DLAKL-LGGAWLMWWVQAAAALSNMGMFVAEMSSDSYQLLGMAERGMLPAFFARRSRHGT  340

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLS +SFQEIVAAENFLYCFGM+LEF+AFV LR++ P APRPY++P+
Sbjct  341  PLVGILFSASGVLLLSSMSFQEIVAAENFLYCFGMLLEFVAFVLLRVRRPGAPRPYRVPL  400

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G V M VPPT LI VVLA S+LKV ++SLGA+A+GLV+QP +R VEKK WL+F+V+S
Sbjct  401  GTAGCVAMLVPPTALIVVVLALSTLKVALVSLGAVAVGLVLQPLLRLVEKKGWLRFAVNS  460

Query  357  DLPDIDHTTRESAAS  313
            DLPDI       AA 
Sbjct  461  DLPDIGVGRAPDAAD  475



>ref|XP_004295555.2| PREDICTED: probable polyamine transporter At1g31830 [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+Q AAAMSNMGMFVAEM+SDSFQLLGMAERGMLP+ F KRSR+GT
Sbjct  372  DIAKIVG-GVWLRWWIQAAAAMSNMGMFVAEMNSDSFQLLGMAERGMLPKCFGKRSRYGT  430

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGI+FSASGVILLSWLSFQEI+AAENFLYC GMILEFIAF+ LR+K P A RP+KIPV
Sbjct  431  PVIGIMFSASGVILLSWLSFQEIIAAENFLYCIGMILEFIAFIRLRMKYPAASRPFKIPV  490

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GAVL+C+PPT+LIGVVL  S  +V+++SL AI IGL MQP ++ VE+KRW+KFS+SS
Sbjct  491  GTVGAVLLCIPPTVLIGVVLVLSQPRVVIVSLIAIVIGLFMQPFLKDVERKRWMKFSISS  550

Query  357  DLPDI  343
            DLPD+
Sbjct  551  DLPDL  555



>ref|XP_010491097.1| PREDICTED: polyamine transporter RMV1-like [Camelina sativa]
Length=493

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DI K+   GAWL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGMLP+ FAKRS +GT
Sbjct  308  DIGKVIG-GAWLGWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPQVFAKRSSYGT  366

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGVILLSWLSFQEIVAAEN LYCFGMILEFIAFV LR+K P A RP+KIPV
Sbjct  367  PWVGILFSASGVILLSWLSFQEIVAAENLLYCFGMILEFIAFVRLRMKYPAASRPFKIPV  426

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G +G++LMC+PPTILIGV++AF++LKV+ +SL AI IGLV+QP ++ VEKK WLKFS SS
Sbjct  427  GVLGSILMCIPPTILIGVIMAFTNLKVVAVSLAAIVIGLVLQPCLKQVEKKGWLKFSTSS  486

Query  357  DLPDI  343
             LP++
Sbjct  487  HLPNL  491



>ref|XP_004953577.1| PREDICTED: polyamine transporter PUT1-like isoform X1 [Setaria 
italica]
Length=535

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   GAWL WWVQ AAA+SNMGMFVAEMSSDS+QLLGMAERGMLP FFA+RSRHGT
Sbjct  337  DLAKL-LGGAWLMWWVQAAAALSNMGMFVAEMSSDSYQLLGMAERGMLPAFFARRSRHGT  395

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLS +SFQEIVAAENFLYCFGM+LEF+AFV LR++ P APRPY++P+
Sbjct  396  PLVGILFSASGVLLLSSMSFQEIVAAENFLYCFGMLLEFVAFVLLRVRRPGAPRPYRVPL  455

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G V M VPPT LI VVLA S+LKV ++SLGA+A+GLV+QP +R VEKK WL+F+V+S
Sbjct  456  GTAGCVAMLVPPTALIVVVLALSTLKVALVSLGAVAVGLVLQPLLRLVEKKGWLRFAVNS  515

Query  357  DLPDIDHTTRESAAS  313
            DLPDI       AA 
Sbjct  516  DLPDIGVGRAPDAAD  530



>gb|EMT01924.1| Putative transporter [Aegilops tauschii]
Length=491

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 166/193 (86%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   GAWL WW+Q AAAMSNMGMFVAEMSSDS+QLLGMAERGMLP FFA RSR+GT
Sbjct  278  DIAKL-LGGAWLMWWMQAAAAMSNMGMFVAEMSSDSYQLLGMAERGMLPAFFATRSRYGT  336

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLS +SFQEIVAAENFLYCFGM+LEF++FV LR++ PDAPRPY++P+
Sbjct  337  PLVGILFSASGVLLLSTMSFQEIVAAENFLYCFGMLLEFLSFVLLRVRRPDAPRPYRVPL  396

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G V M VP T LI  VLA S+LKV ++SLGA+A+GLV+QP ++ VEKKRWL+FSV+S
Sbjct  397  GTAGCVAMLVPATALIVAVLALSTLKVALVSLGAVAVGLVLQPVLKFVEKKRWLRFSVNS  456

Query  357  DLPDIDHTTRESA  319
            DLP ID   + +A
Sbjct  457  DLPGIDVNHQPAA  469



>gb|KEH44393.1| neutral amino acid transporter [Medicago truncatula]
Length=462

 Score =   280 bits (715),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL  WVQ A+A+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GTPLIGILFS
Sbjct  283  GVWLRTWVQVASALSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLIGILFS  342

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYCFGM++EF+AFV LRIK P+  RPYKIPVG IG VLM
Sbjct  343  ASGVVLLSWLSFQEIVAAENFLYCFGMLMEFVAFVKLRIKFPNVSRPYKIPVGKIGGVLM  402

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI  343
            C+ PT+LI VVLA ++LKV +IS+ A+ IGLV+QP ++++E+KRW +FSV+ DLPDI
Sbjct  403  CIVPTLLIFVVLALATLKVFLISISAVIIGLVLQPCLKYIERKRWFRFSVNPDLPDI  459



>ref|XP_002871174.1| amino acid permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47433.1| amino acid permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 160/185 (86%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DI KI   GAWL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGMLP+ FAKRSR+GT
Sbjct  303  DIGKIIG-GAWLGWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPKVFAKRSRYGT  361

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGVILLSWLSFQEIVAAEN LYCFGM+LEFI FV LR+K P A RP+KIPV
Sbjct  362  PWVGILFSASGVILLSWLSFQEIVAAENLLYCFGMVLEFITFVRLRMKYPAATRPFKIPV  421

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G +G++LMC+PPT+LIGV++A ++LKV ++SL AI IGLV+QP ++ VEKK WLKFS SS
Sbjct  422  GVLGSILMCIPPTVLIGVIMALTNLKVALVSLAAIVIGLVLQPCLKQVEKKGWLKFSTSS  481

Query  357  DLPDI  343
             LP++
Sbjct  482  HLPNL  486



>ref|XP_009420373.1| PREDICTED: polyamine transporter PUT1-like [Musa acuminata subsp. 
malaccensis]
Length=481

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL+WWVQGA+A+SNMGMFVAEMSSDS+QLLGMAERGMLPEFF++RSR GTPLIGILFS
Sbjct  282  GVWLTWWVQGASALSNMGMFVAEMSSDSYQLLGMAERGMLPEFFSRRSRFGTPLIGILFS  341

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYCFGM++EF+AFV LR+K P A RPYK+P+GT+G++LM
Sbjct  342  ASGVLLLSWLSFQEIVAAENFLYCFGMLIEFLAFVTLRMKYPTASRPYKVPLGTVGSILM  401

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
             VPPT+LI  VLA SSLKV ++S+ A+ +G  +QP +++VEKKRWL+FSVS  LP +  T
Sbjct  402  LVPPTLLILGVLALSSLKVAMVSIVALLMGFALQPCLKYVEKKRWLRFSVSPHLPHLGAT  461

Query  333  TRESAA  316
            T++  A
Sbjct  462  TQDENA  467



>ref|XP_006647741.1| PREDICTED: polyamine transporter PUT1-like [Oryza brachyantha]
Length=540

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   GAWL WWVQ AAA+SNMGMFVAEMSSDS+QLLGMAERGMLP FFA RSR+GT
Sbjct  342  DIAKL-LGGAWLMWWVQSAAAVSNMGMFVAEMSSDSYQLLGMAERGMLPAFFAARSRYGT  400

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGV+LLS +SFQEIVAAENFLYCFGM+LEF AFV  R++ PDAPRPY++P+
Sbjct  401  PLAGILFSASGVLLLSTMSFQEIVAAENFLYCFGMLLEFAAFVMHRVRRPDAPRPYRVPL  460

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G V M VPPT LI VVLA S+LKV ++SLGA+A+GLV+QP +R VEKKRWL+FSV+ 
Sbjct  461  GTAGCVAMLVPPTALIAVVLALSTLKVALVSLGAVAVGLVLQPALRFVEKKRWLRFSVNP  520

Query  357  DLPDI  343
            DLP+I
Sbjct  521  DLPEI  525



>dbj|BAK02239.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 167/193 (87%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   GAWL WW+Q AAAMSNMGMFVAEMSSDS+QLLGMAERGMLP FFA RSR+GT
Sbjct  326  DIAKL-LGGAWLMWWMQAAAAMSNMGMFVAEMSSDSYQLLGMAERGMLPAFFATRSRYGT  384

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLS +SFQEIVAAENFLYCFGM+LEF++FV LR++ PDAPRPY++P+
Sbjct  385  PLVGILFSASGVLLLSTMSFQEIVAAENFLYCFGMLLEFLSFVLLRVRRPDAPRPYRVPL  444

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G V+M VP T LI  VLA S+LKV ++SLGA+AIGLV+QP ++ VEKK+WL+FSV+S
Sbjct  445  GTAGCVVMLVPATALIVAVLALSTLKVALVSLGALAIGLVLQPLLKFVEKKQWLRFSVNS  504

Query  357  DLPDIDHTTRESA  319
            DLP ID   + +A
Sbjct  505  DLPGIDVNHQPAA  517



>emb|CBI37826.3| unnamed protein product [Vitis vinifera]
Length=979

 Score =   290 bits (742),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 166/198 (84%), Gaps = 4/198 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGA+A+SNMGMFVAEMSSDSFQLLGMAERGMLP+FFAKRSR+GT
Sbjct  308  DIAKI-LGGIWLRSWIQGASALSNMGMFVAEMSSDSFQLLGMAERGMLPDFFAKRSRYGT  366

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMI+EFIAFV LR++ P A RPY IPV
Sbjct  367  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRMRYPAASRPYMIPV  426

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMC+PPT+LI VVLA +S KV+VISL A+ IGLVMQP + + EKKRWL+FS+SS
Sbjct  427  GTTGAILMCIPPTLLICVVLALASFKVMVISLLAVMIGLVMQPCLLYAEKKRWLRFSMSS  486

Query  357  DLPDID---HTTRESAAS  313
            DLPD     H   ES   
Sbjct  487  DLPDFHSAYHGDTESGKQ  504



>ref|XP_011463407.1| PREDICTED: polyamine transporter RMV1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=496

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 158/179 (88%), Gaps = 1/179 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPE F KRSR+GT
Sbjct  318  DIAKIVG-GVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPECFGKRSRYGT  376

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+LLSWLSF EIVAAENFLYC GMILEFIAF+ LR+K P A RPYKIP+
Sbjct  377  PVIGILFSASGVLLLSWLSFLEIVAAENFLYCVGMILEFIAFIRLRMKYPAASRPYKIPI  436

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVS  361
            GT+GAVL+C PPT+LIGVVLA S  KV+V+SL A+ IGLVMQP +++VE+KRW+KFS+ 
Sbjct  437  GTVGAVLLCTPPTLLIGVVLALSKRKVVVVSLIALVIGLVMQPCLKYVERKRWMKFSIK  495



>ref|XP_008236066.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Prunus mume]
Length=486

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 163/194 (84%), Gaps = 4/194 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL +WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSRHGT
Sbjct  290  DIAKM-LGGVWLRFWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  349  PLVGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+L+C+PPT+LI VVLA +S KV+ IS+ A+ IGLV+QP + + ++KRW  FS++S
Sbjct  409  GTAGAILICIPPTLLIFVVLALASPKVMAISISAVIIGLVLQPCVEYTKRKRWFNFSMNS  468

Query  357  DLPDI---DHTTRE  325
            DLPDI   DH   E
Sbjct  469  DLPDIHAPDHQCNE  482



>ref|XP_008236067.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Prunus mume]
Length=472

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 163/194 (84%), Gaps = 4/194 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL +WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSRHGT
Sbjct  276  DIAKM-LGGVWLRFWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  335  PLVGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+L+C+PPT+LI VVLA +S KV+ IS+ A+ IGLV+QP + + ++KRW  FS++S
Sbjct  395  GTAGAILICIPPTLLIFVVLALASPKVMAISISAVIIGLVLQPCVEYTKRKRWFNFSMNS  454

Query  357  DLPDI---DHTTRE  325
            DLPDI   DH   E
Sbjct  455  DLPDIHAPDHQCNE  468



>ref|XP_011463405.1| PREDICTED: polyamine transporter RMV1-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011463406.1| PREDICTED: polyamine transporter RMV1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=513

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WW+QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPE F KRSR+GT
Sbjct  335  DIAKIVG-GVWLRWWIQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPECFGKRSRYGT  393

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P+IGILFSASGV+LLSWLSF EIVAAENFLYC GMILEFIAF+ LR+K P A RPYKIP+
Sbjct  394  PVIGILFSASGVLLLSWLSFLEIVAAENFLYCVGMILEFIAFIRLRMKYPAASRPYKIPI  453

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSV  364
            GT+GAVL+C PPT+LIGVVLA S  KV+V+SL A+ IGLVMQP +++VE+KRW+KFS+
Sbjct  454  GTVGAVLLCTPPTLLIGVVLALSKRKVVVVSLIALVIGLVMQPCLKYVERKRWMKFSI  511



>ref|NP_196182.1| polyamine uptake transporter 3 [Arabidopsis thaliana]
 sp|Q9FFL1.1|RMV1_ARATH RecName: Full=Polyamine transporter RMV1; AltName: Full=Protein 
RESISTANT TO METHYL VIOLOGEN 1 [Arabidopsis thaliana]
 dbj|BAB09657.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC43680.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37657.1| At5g05630 [Arabidopsis thaliana]
 gb|AED90901.1| polyamine uptake transporter 3 [Arabidopsis thaliana]
Length=490

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DI K+   G WL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGMLPE FAKRSR+ T
Sbjct  305  DIGKVIG-GVWLGWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEVFAKRSRYRT  363

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGVI+LSWLSFQEIVAAEN LYCFGM+LEFI FV LR+K P A RP+KIPV
Sbjct  364  PWVGILFSASGVIILSWLSFQEIVAAENLLYCFGMVLEFITFVRLRMKYPAASRPFKIPV  423

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G +G+VLMC+PPT+LIGV++AF++LKV ++SL AI IGLV+QP ++ VEKK WLKFS SS
Sbjct  424  GVLGSVLMCIPPTVLIGVIMAFTNLKVALVSLAAIVIGLVLQPCLKQVEKKGWLKFSTSS  483

Query  357  DLPDI  343
             LP++
Sbjct  484  HLPNL  488



>ref|NP_001047840.1| Os02g0700500 [Oryza sativa Japonica Group]
 sp|Q6Z8D0.1|PUT1_ORYSJ RecName: Full=Polyamine transporter PUT1; AltName: Full=Polyamine 
uptake transporter 1; Short=OsPUT1 [Oryza sativa Japonica 
Group]
 sp|A2X8M8.1|PUT1_ORYSI RecName: Full=Polyamine transporter PUT1; AltName: Full=Polyamine 
uptake transporter 1; Short=OsPUT1 [Oryza sativa Indica 
Group]
 dbj|BAD07518.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAD07889.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF09754.1| Os02g0700500 [Oryza sativa Japonica Group]
 gb|EAY87188.1| hypothetical protein OsI_08590 [Oryza sativa Indica Group]
 gb|EAZ24299.1| hypothetical protein OsJ_08051 [Oryza sativa Japonica Group]
Length=531

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   GAWL WWVQ AAA+SNMGMFVAEMSSDS+QLLGMAERGMLP FFA RSR+GT
Sbjct  333  DIAKL-LGGAWLMWWVQSAAALSNMGMFVAEMSSDSYQLLGMAERGMLPSFFAARSRYGT  391

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGV+LLS +SFQEIVAAENFLYCFGM+LEF+AF+  R++ PDA RPY++P+
Sbjct  392  PLAGILFSASGVLLLSMMSFQEIVAAENFLYCFGMLLEFVAFILHRVRRPDAARPYRVPL  451

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G V M VPPT LI VVLA S+LKV V+SLGA+A+GLV+QP +R VEKKRWL+FSV+ 
Sbjct  452  GTAGCVAMLVPPTALIAVVLALSTLKVAVVSLGAVAMGLVLQPALRFVEKKRWLRFSVNP  511

Query  357  DLPDI  343
            DLP+I
Sbjct  512  DLPEI  516



>ref|XP_007199817.1| hypothetical protein PRUPE_ppa005214mg [Prunus persica]
 gb|EMJ01016.1| hypothetical protein PRUPE_ppa005214mg [Prunus persica]
Length=472

 Score =   277 bits (708),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 162/194 (84%), Gaps = 4/194 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL +WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSRHGT
Sbjct  276  DIAKM-LGGVWLRFWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  335  PLVGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+L+C+PPT+LI VVLA +S KV+ IS+ A+ IGLV+QP + + ++ RW  FS++S
Sbjct  395  GTAGAILICIPPTLLIFVVLALASPKVMAISISAVIIGLVLQPCVEYTKRNRWFNFSMNS  454

Query  357  DLPDI---DHTTRE  325
            DLPDI   DH   E
Sbjct  455  DLPDIHAPDHQCNE  468



>ref|XP_010540726.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Tarenaya hassleriana]
Length=490

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK    G WL WWVQ AAA SNMGMF+A+MSSDSF LLGMAE G++PEFFAKRSR+GT
Sbjct  298  DIAKAIE-GEWLGWWVQAAAATSNMGMFLAKMSSDSFLLLGMAEHGVIPEFFAKRSRYGT  356

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAEN LY  GM+LEF AFV LR+K P+A RPYKIPV
Sbjct  357  PLVGILFSASGVILLSWLSFQEIVAAENLLYSLGMMLEFFAFVRLRMKYPNASRPYKIPV  416

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IG+++MC+PPTILI  ++AFS+LKV  +SL  + IGLVM+P + H  KKRWLKFS+SS
Sbjct  417  GIIGSIVMCIPPTILISAIMAFSTLKVAAVSLCIVVIGLVMKPCLDHT-KKRWLKFSISS  475

Query  357  DLPDIDHTTRES  322
            DLPD+ H + ES
Sbjct  476  DLPDLHHESEES  487



>gb|ERN15644.1| hypothetical protein AMTR_s00048p00199050 [Amborella trichopoda]
Length=470

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WW++ AAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  275  DLAKILG-GVWLRWWMEAAAALSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRNGT  333

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P IGILFSASGV+LLSWLSFQEIVAAEN+LYCFGMILEF+AF+ LRI++P A RPYK+P 
Sbjct  334  PSIGILFSASGVVLLSWLSFQEIVAAENYLYCFGMILEFVAFIRLRIQNPTASRPYKVPF  393

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMC+PPT LI VVLA +SLKV+ ISL A+  G ++   I +++KK+ ++FS+ S
Sbjct  394  GTVGSILMCIPPTALICVVLAVASLKVMAISLAAVMFGFILYLLIGYIKKKQLVRFSICS  453

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+  +  +S+  +I
Sbjct  454  DLPDLQESRHDSSEPVI  470



>ref|XP_006854177.2| PREDICTED: probable polyamine transporter At1g31830 [Amborella 
trichopoda]
Length=489

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL WW++ AAA+SNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSR+GT
Sbjct  294  DLAKILG-GVWLRWWMEAAAALSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRNGT  352

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P IGILFSASGV+LLSWLSFQEIVAAEN+LYCFGMILEF+AF+ LRI++P A RPYK+P 
Sbjct  353  PSIGILFSASGVVLLSWLSFQEIVAAENYLYCFGMILEFVAFIRLRIQNPTASRPYKVPF  412

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMC+PPT LI VVLA +SLKV+ ISL A+  G ++   I +++KK+ ++FS+ S
Sbjct  413  GTVGSILMCIPPTALICVVLAVASLKVMAISLAAVMFGFILYLLIGYIKKKQLVRFSICS  472

Query  357  DLPDIDHTTRESAASLI  307
            DLPD+  +  +S+  +I
Sbjct  473  DLPDLQESRHDSSEPVI  489



>ref|XP_010540724.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Tarenaya hassleriana]
Length=513

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK    G WL WWVQ AAA SNMGMF+A+MSSDSF LLGMAE G++PEFFAKRSR+GT
Sbjct  321  DIAKAIE-GEWLGWWVQAAAATSNMGMFLAKMSSDSFLLLGMAEHGVIPEFFAKRSRYGT  379

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGVILLSWLSFQEIVAAEN LY  GM+LEF AFV LR+K P+A RPYKIPV
Sbjct  380  PLVGILFSASGVILLSWLSFQEIVAAENLLYSLGMMLEFFAFVRLRMKYPNASRPYKIPV  439

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IG+++MC+PPTILI  ++AFS+LKV  +SL  + IGLVM+P + H  KKRWLKFS+SS
Sbjct  440  GIIGSIVMCIPPTILISAIMAFSTLKVAAVSLCIVVIGLVMKPCLDHT-KKRWLKFSISS  498

Query  357  DLPDIDHTTRES  322
            DLPD+ H + ES
Sbjct  499  DLPDLHHESEES  510



>emb|CDX70141.1| BnaA10g24900D [Brassica napus]
Length=487

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+ K+   G WL WW++ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPE FA+RSR+GT
Sbjct  302  DVGKVIG-GGWLGWWIRAAAAASNMGMFLAEMSSDSFQLLGMAERGMLPEVFARRSRYGT  360

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGVI+LSWLSFQEIVAAEN LYCFGM+LEF+AFV LR+K P A RP+KIPV
Sbjct  361  PWVGILFSASGVIVLSWLSFQEIVAAENLLYCFGMVLEFVAFVRLRVKYPAASRPFKIPV  420

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G +G+V+MCVPPT+LIG + AFS LKV  +SL A+ IGLV+QP ++ VEKK WLKFSVSS
Sbjct  421  GVLGSVIMCVPPTVLIGFIAAFSDLKVAGVSLAAVVIGLVLQPCLKQVEKKGWLKFSVSS  480

Query  357  DLPDI  343
             LPD+
Sbjct  481  HLPDL  485



>ref|XP_010918087.1| PREDICTED: polyamine transporter PUT1-like isoform X2 [Elaeis 
guineensis]
Length=472

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 169/193 (88%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL+WW+QGAAA SNMGMF+A+MSS S+QLLGMAE GMLP+FF+ RSR+GT
Sbjct  275  DIAKIIG-GVWLTWWMQGAAAASNMGMFIAKMSSYSYQLLGMAELGMLPKFFSMRSRYGT  333

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSASGV+LLSWLSFQEI+AAEN LYCFGM+LEF+AF+ LRIK P APRPYKIP+
Sbjct  334  PLIGIMFSASGVLLLSWLSFQEIIAAENILYCFGMLLEFLAFMRLRIKCPMAPRPYKIPL  393

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIG++L+ +PPT++I V LAF+SLK+++IS  A+ IGL+++P ++++EKKRWL+FS+ +
Sbjct  394  GTIGSILIIIPPTLVIFVELAFASLKIMIISFVAVIIGLILRPCLKYLEKKRWLRFSIIT  453

Query  357  DLPDIDHTTRESA  319
            D+PD+  T  E+A
Sbjct  454  DIPDLRATENENA  466



>ref|XP_006399022.1| hypothetical protein EUTSA_v10013376mg [Eutrema salsugineum]
 gb|ESQ40475.1| hypothetical protein EUTSA_v10013376mg [Eutrema salsugineum]
Length=489

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DI K+   GAWL WW+Q AAA SNMGMF+AEMSSDSFQLLGMAERGMLPE FAKRSR+GT
Sbjct  304  DIGKVIG-GAWLGWWIQAAAATSNMGMFLAEMSSDSFQLLGMAERGMLPEVFAKRSRYGT  362

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGV+LLSWLSFQEIVAAE+ LYCFGM+LEFIAFV LR+K P A RP+KIPV
Sbjct  363  PWVGILFSASGVVLLSWLSFQEIVAAESLLYCFGMVLEFIAFVRLRVKHPAASRPFKIPV  422

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G +G++LMC+PPTILIGV+ AFS+LKV  +SL A+ IGLV++P ++HVEKK WLKFSVSS
Sbjct  423  GVLGSILMCIPPTILIGVIAAFSNLKVAAVSLAAVVIGLVLRPCLKHVEKKGWLKFSVSS  482

Query  357  DLPDI  343
             LPD+
Sbjct  483  HLPDL  487



>gb|ABF97257.1| amino acid permease family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF97259.1| amino acid permease family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG88256.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+A+I   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  277  DVARILG-GFWLHSWLQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  336  PLIGIMFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVVHPNASRPYKIPL  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PPTILI VV+  +S KV+V+S+ A+ +G V+QP + +VEK+RWLKFS+S+
Sbjct  396  GTIGAVLMIIPPTILIVVVMMLASFKVMVVSIMAMLVGFVLQPALVYVEKRRWLKFSISA  455

Query  357  DLPDIDHTTRESAASL  310
            +LPD+ ++  E  +++
Sbjct  456  ELPDLPYSNVEEDSTI  471



>gb|AAR10855.1| putative amino acid permease [Oryza sativa Japonica Group]
 gb|ABF97258.1| amino acid permease family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=492

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+A+I   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  294  DVARILG-GFWLHSWLQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  352

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  353  PLIGIMFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVVHPNASRPYKIPL  412

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PPTILI VV+  +S KV+V+S+ A+ +G V+QP + +VEK+RWLKFS+S+
Sbjct  413  GTIGAVLMIIPPTILIVVVMMLASFKVMVVSIMAMLVGFVLQPALVYVEKRRWLKFSISA  472

Query  357  DLPDIDHTTRESAASL  310
            +LPD+ ++  E  +++
Sbjct  473  ELPDLPYSNVEEDSTI  488



>ref|XP_002452695.1| hypothetical protein SORBIDRAFT_04g030810 [Sorghum bicolor]
 gb|EES05671.1| hypothetical protein SORBIDRAFT_04g030810 [Sorghum bicolor]
Length=535

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AK+   GAWL WWVQ AAA+SNMGMFVAEMSSDS+QLLGMAERGMLP FFA+RSRHGT
Sbjct  337  DLAKL-LGGAWLMWWVQAAAALSNMGMFVAEMSSDSYQLLGMAERGMLPAFFARRSRHGT  395

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLS LSFQEIVAAENFLYCFGM+LEFIAFV LR++ PDAPRPY++P+
Sbjct  396  PLVGILFSASGVLLLSSLSFQEIVAAENFLYCFGMLLEFIAFVLLRVRRPDAPRPYRVPL  455

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT G V M VPPT LI VVLA S+LKV ++SLGA+A+GLV+QP +R VEKK  L+F+V+S
Sbjct  456  GTAGCVAMLVPPTALIVVVLALSTLKVALVSLGAVAVGLVLQPALRFVEKKGLLRFAVNS  515

Query  357  DLPDI  343
            DLPDI
Sbjct  516  DLPDI  520



>ref|XP_003555208.2| PREDICTED: probable polyamine transporter At1g31830-like [Glycine 
max]
Length=466

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = -1

Query  891  AKIPRV--GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            +++ RV  G WL  WVQ A+A+SNMGMF+AEMSSDSFQLLGMAERGM+PEFFAKRSR+GT
Sbjct  279  SEVARVIGGVWLRSWVQAASALSNMGMFMAEMSSDSFQLLGMAERGMVPEFFAKRSRYGT  338

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAENFLYCFGM++EF+AFV LR K P A RPYK+PV
Sbjct  339  PLVGILFSASGVVLLSWLSFQEIVAAENFLYCFGMLMEFVAFVKLRRKLPYAERPYKVPV  398

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G  GA+LMCV PT+LI VVLA +S KV ++S  A+ IGLV++P ++++E++RWL+FSV+ 
Sbjct  399  GKTGAILMCVLPTLLIFVVLALASFKVFIVSFSAVIIGLVLRPCLKYMEQRRWLRFSVNP  458

Query  357  DLPDIDHT  334
            DLPDI  T
Sbjct  459  DLPDIRAT  466



>ref|XP_006659161.1| PREDICTED: probable polyamine transporter At1g31830-like [Oryza 
brachyantha]
Length=475

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+A+I   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  277  DVARILG-GFWLHSWIQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  336  PLIGILFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVVHPNASRPYKIPL  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PPTILI VV+  +S KV+V+S+ A+ +G  +QPG+ +VEK+RWLKFS+S+
Sbjct  396  GTIGAVLMIIPPTILIVVVMMLASFKVMVVSILAMLVGFALQPGLVYVEKRRWLKFSISA  455

Query  357  DLPDIDHTTRESAAS  313
            +LPD+  +  E  ++
Sbjct  456  ELPDLPDSIAEEDST  470



>ref|XP_004972759.1| PREDICTED: probable polyamine transporter At1g31830-like [Setaria 
italica]
Length=493

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 165/200 (83%), Gaps = 4/200 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I   G WL  W+QGAAA+SNMG F+ EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  294  DIARI-LGGVWLHSWIQGAAALSNMGNFLTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  352

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GVILLSW+SFQEIVAAEN+LYCFGMILEFIAF+ LR+  PD  RPYKIP+
Sbjct  353  PLIGILFSAFGVILLSWMSFQEIVAAENYLYCFGMILEFIAFIKLRMTHPDTSRPYKIPL  412

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PP +LI VV+A +S KV+ +S+ A+ IG V+QP + +VEK+RWL+FS+S+
Sbjct  413  GTIGAVLMIIPPALLIVVVMALASFKVMAVSIMAMIIGFVLQPCLVYVEKRRWLRFSISA  472

Query  357  DLPDI---DHTTRESAASLI  307
            DLPD+      T + A  L+
Sbjct  473  DLPDLPDSHEATSDDAVPLV  492



>ref|XP_010918086.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Elaeis guineensis]
Length=532

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 169/193 (88%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL+WW+QGAAA SNMGMF+A+MSS S+QLLGMAE GMLP+FF+ RSR+GT
Sbjct  335  DIAKIIG-GVWLTWWMQGAAAASNMGMFIAKMSSYSYQLLGMAELGMLPKFFSMRSRYGT  393

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSASGV+LLSWLSFQEI+AAEN LYCFGM+LEF+AF+ LRIK P APRPYKIP+
Sbjct  394  PLIGIMFSASGVLLLSWLSFQEIIAAENILYCFGMLLEFLAFMRLRIKCPMAPRPYKIPL  453

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIG++L+ +PPT++I V LAF+SLK+++IS  A+ IGL+++P ++++EKKRWL+FS+ +
Sbjct  454  GTIGSILIIIPPTLVIFVELAFASLKIMIISFVAVIIGLILRPCLKYLEKKRWLRFSIIT  513

Query  357  DLPDIDHTTRESA  319
            D+PD+  T  E+A
Sbjct  514  DIPDLRATENENA  526



>emb|CDX98852.1| BnaC09g49830D [Brassica napus]
Length=489

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 158/185 (85%), Gaps = 2/185 (1%)
 Frame = -1

Query  891  AKIPRV--GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            A+I +V  G WL WW++ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPE FA+RSR+GT
Sbjct  303  AEIGKVIGGGWLGWWIRAAAAASNMGMFLAEMSSDSFQLLGMAERGMLPEVFARRSRYGT  362

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGV++LSWLSFQEIVAAEN LYCFGM+LEFIAFV LR+K P A RP+KIPV
Sbjct  363  PWVGILFSASGVVVLSWLSFQEIVAAENLLYCFGMVLEFIAFVRLRVKHPAASRPFKIPV  422

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G +G+V+MCVPPT+LIG + AFS LKV  +SL A+  GLV+QP ++ VEKK W+KFSVSS
Sbjct  423  GVLGSVIMCVPPTVLIGFIAAFSDLKVAGVSLAAVVFGLVLQPCLKKVEKKGWVKFSVSS  482

Query  357  DLPDI  343
             LPD+
Sbjct  483  HLPDL  487



>gb|EAZ27574.1| hypothetical protein OsJ_11523 [Oryza sativa Japonica Group]
Length=529

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+A+I   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  331  DVARILG-GFWLHSWLQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  389

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  390  PLIGIMFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVVHPNASRPYKIPL  449

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PPTILI VV+  +S KV+V+S+ A+ +G V+QP + +VEK+RWLKFS+S+
Sbjct  450  GTIGAVLMIIPPTILIVVVMMLASFKVMVVSIMAMLVGFVLQPALVYVEKRRWLKFSISA  509

Query  357  DLPDIDHTTRESAASL  310
            +LPD+ ++  E  +++
Sbjct  510  ELPDLPYSNVEEDSTI  525



>ref|XP_008358365.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Malus domestica]
Length=470

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GT
Sbjct  276  DIAKMLG-GVWLRTWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  335  PLTGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVLA ++ KV+ +S+ A+ IGL++ P I H ++KRW  FS +S
Sbjct  395  GTVGAILICIPPTVLIFVVLALATPKVMAVSIAAVIIGLLLHPCIEHTKQKRWFNFSTNS  454

Query  357  DLPDIDHTTRE  325
            +LPDI +   +
Sbjct  455  NLPDIHNAYDQ  465



>gb|KHN11505.1| Putative transporter [Glycine soja]
Length=440

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 161/188 (86%), Gaps = 2/188 (1%)
 Frame = -1

Query  891  AKIPRV--GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            +++ RV  G WL  WVQ A+A+SNMGMF+AEMSSDSFQLLGMAERGM+PEFFAKRSR+GT
Sbjct  253  SEVARVIGGVWLRSWVQAASALSNMGMFMAEMSSDSFQLLGMAERGMVPEFFAKRSRYGT  312

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSASGV+LLSWLSFQEIVAAENFLYCFGM++EF+AFV LR K P A RPYK+PV
Sbjct  313  PLVGILFSASGVVLLSWLSFQEIVAAENFLYCFGMLMEFVAFVKLRRKLPYAERPYKVPV  372

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G  GA+LMCV PT+LI VVLA +S KV ++S  A+ IGLV++P ++ +E++RWL+FSV+ 
Sbjct  373  GKTGAILMCVLPTLLIFVVLALASFKVFIVSFSAVIIGLVLRPCLKCMEQRRWLRFSVNP  432

Query  357  DLPDIDHT  334
            DLPDI  T
Sbjct  433  DLPDIRAT  440



>gb|EAY90746.1| hypothetical protein OsI_12346 [Oryza sativa Indica Group]
Length=529

 Score =   273 bits (699),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+A+I   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  331  DVARILG-GFWLHSWLQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  389

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  390  PLIGIMFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVVHPNASRPYKIPL  449

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PPTILI VV+  +S KV+V+S+ A+ +G V+QP + +VEK+RWLKFS+S+
Sbjct  450  GTIGAVLMIIPPTILIVVVMMLASFKVMVVSIVAMLVGFVLQPALVYVEKRRWLKFSISA  509

Query  357  DLPDIDHTTRESAASL  310
            +LPD+ ++  E  +++
Sbjct  510  ELPDLPYSNVEEDSTI  525



>ref|XP_009122163.1| PREDICTED: polyamine transporter RMV1 [Brassica rapa]
Length=491

 Score =   272 bits (695),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+ K+   G WL WW++ AAA SNMGMF+AEMSSDSFQLLGMAERGMLPE FA+RSR+GT
Sbjct  306  DVGKVIG-GGWLGWWIRAAAAASNMGMFLAEMSSDSFQLLGMAERGMLPEVFARRSRYGT  364

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGV++LSWLSFQEIVAAEN LYCFGM+LEF+AFV LR+K P A RP+KIPV
Sbjct  365  PWVGILFSASGVVVLSWLSFQEIVAAENLLYCFGMVLEFVAFVRLRVKYPAASRPFKIPV  424

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G +G+V+MCVPPT+LIG + AFS LKV  +SL A+ IGLV+QP ++ VEKK WLKFSVSS
Sbjct  425  GVLGSVIMCVPPTVLIGFIAAFSDLKVAGVSLAAVVIGLVLQPCLKKVEKKGWLKFSVSS  484

Query  357  DLPDI  343
             L D+
Sbjct  485  HLSDL  489



>ref|XP_008358364.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Malus domestica]
Length=480

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GT
Sbjct  286  DIAKMLG-GVWLRTWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRYGT  344

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  345  PLTGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  404

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVLA ++ KV+ +S+ A+ IGL++ P I H ++KRW  FS +S
Sbjct  405  GTVGAILICIPPTVLIFVVLALATPKVMAVSIAAVIIGLLLHPCIEHTKQKRWFNFSTNS  464

Query  357  DLPDIDHTTRE  325
            +LPDI +   +
Sbjct  465  NLPDIHNAYDQ  475



>ref|XP_002443914.1| hypothetical protein SORBIDRAFT_07g004285 [Sorghum bicolor]
 gb|EES13409.1| hypothetical protein SORBIDRAFT_07g004285 [Sorghum bicolor]
Length=493

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 164/200 (82%), Gaps = 4/200 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I   G WL  W+Q AAA+SNMG F+ EMSSDS+QLLGMAERGMLP+FFAKRS HGT
Sbjct  294  DIARI-LGGIWLHSWIQAAAALSNMGNFLTEMSSDSYQLLGMAERGMLPDFFAKRSHHGT  352

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GVILLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  353  PLIGILFSAFGVILLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVTHPNASRPYKIPL  412

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PP +LI VV+A +S KV+ +S+ A+ IG V+QP + +VEKKRWL+FS+S+
Sbjct  413  GTIGAVLMIIPPAVLIIVVMAIASYKVMAVSILAMVIGFVLQPCLGYVEKKRWLRFSISA  472

Query  357  DLPDI---DHTTRESAASLI  307
            DLPD+     T  + A  L+
Sbjct  473  DLPDLPDAQETAEDDAVPLV  492



>ref|NP_001050538.1| Os03g0576900 [Oryza sativa Japonica Group]
 gb|ABF97256.1| amino acid permease family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12452.1| Os03g0576900 [Oryza sativa Japonica Group]
 dbj|BAG92427.1| unnamed protein product [Oryza sativa Japonica Group]
Length=550

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+A+I   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  352  DVARI-LGGFWLHSWLQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  410

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGI+FSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  411  PLIGIMFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVVHPNASRPYKIPL  470

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PPTILI VV+  +S KV+V+S+ A+ +G V+QP + +VEK+RWLKFS+S+
Sbjct  471  GTIGAVLMIIPPTILIVVVMMLASFKVMVVSIMAMLVGFVLQPALVYVEKRRWLKFSISA  530

Query  357  DLPDIDHTTRESAASL  310
            +LPD+ ++  E  +++
Sbjct  531  ELPDLPYSNVEEDSTI  546



>ref|XP_004290749.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Fragaria vesca subsp. vesca]
Length=460

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WV  AAA+SNMGMFVAEMSSDSFQLLGMAE GMLP FFAKRSR+GT
Sbjct  272  DIAKILG-GVWLRTWVLAAAALSNMGMFVAEMSSDSFQLLGMAEIGMLPSFFAKRSRYGT  330

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR + P+ PRPYKIP 
Sbjct  331  PLTGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRFQHPNLPRPYKIPF  390

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGA+L+C+PPT+LI VVLA +SLK++ IS+ A  +GLV+QP + +++KKRW  FS S 
Sbjct  391  GNIGAILICIPPTVLILVVLALASLKIMAISIAAAVVGLVLQPCVEYMKKKRWYDFSGSF  450

Query  357  DLPDIDHTT  331
            D PD  + +
Sbjct  451  DNPDCQYAS  459



>ref|XP_009340496.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Pyrus x bretschneideri]
Length=470

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GT
Sbjct  276  DIAKMLG-GVWLRTWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  335  PLTGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PP +LI VVLA ++ KV+ +S+ A+ IGL++QP I + + KRW  FS +S
Sbjct  395  GTVGAILICIPPAVLIFVVLALATPKVMAVSIAAVIIGLLLQPCIEYTKHKRWFNFSTNS  454

Query  357  DLPDIDHTTRE  325
            DLPDI +   +
Sbjct  455  DLPDIHNAYDQ  465



>ref|XP_009340495.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Pyrus x bretschneideri]
Length=480

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GT
Sbjct  286  DIAKMLG-GVWLRTWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRYGT  344

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  345  PLTGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  404

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PP +LI VVLA ++ KV+ +S+ A+ IGL++QP I + + KRW  FS +S
Sbjct  405  GTVGAILICIPPAVLIFVVLALATPKVMAVSIAAVIIGLLLQPCIEYTKHKRWFNFSTNS  464

Query  357  DLPDIDHTTRE  325
            DLPDI +   +
Sbjct  465  DLPDIHNAYDQ  475



>ref|XP_004290748.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Fragaria vesca subsp. vesca]
Length=474

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WV  AAA+SNMGMFVAEMSSDSFQLLGMAE GMLP FFAKRSR+GT
Sbjct  286  DIAKILG-GVWLRTWVLAAAALSNMGMFVAEMSSDSFQLLGMAEIGMLPSFFAKRSRYGT  344

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR + P+ PRPYKIP 
Sbjct  345  PLTGILFSASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRFQHPNLPRPYKIPF  404

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            G IGA+L+C+PPT+LI VVLA +SLK++ IS+ A  +GLV+QP + +++KKRW  FS S 
Sbjct  405  GNIGAILICIPPTVLILVVLALASLKIMAISIAAAVVGLVLQPCVEYMKKKRWYDFSGSF  464

Query  357  DLPDIDHTT  331
            D PD  + +
Sbjct  465  DNPDCQYAS  473



>ref|XP_011088641.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Sesamum indicum]
 ref|XP_011088642.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Sesamum indicum]
Length=470

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+ KI   G WL +W+Q A+A+SNMGMFVAEMSSDSFQLLGMAERGMLPE FA+RSRHGT
Sbjct  276  DVGKIVG-GVWLRFWIQVASAVSNMGMFVAEMSSDSFQLLGMAERGMLPECFARRSRHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGV+LLSWLSFQEIVAAENFLYCFGMI+EFIAFV LRI  P A RPYK+PV
Sbjct  335  PFVGILFSASGVVLLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRIDHPAASRPYKVPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMC+ PT+LI VVLA +S KV+ +SL A+ IGL++QP +++ EKKRWL+FSVSS
Sbjct  395  GTTGAILMCIAPTLLILVVLALASFKVMGLSLFAVLIGLILQPCLKYTEKKRWLRFSVSS  454

Query  357  DLPDIDHTTRESAA  316
            DLPD   T ++  A
Sbjct  455  DLPDFLSTAQDYRA  468



>ref|XP_010906713.1| PREDICTED: polyamine transporter RMV1 [Elaeis guineensis]
Length=556

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DI KI   G WL+WW+QGAAA SNMGMF+ +MSS S+QLLGMAE GMLPEFF++RS+HGT
Sbjct  353  DITKI-LGGVWLTWWMQGAAASSNMGMFLTKMSSYSYQLLGMAEWGMLPEFFSRRSQHGT  411

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLI ILFSASGV+LLSWLSFQEI+AAEN LYCFGM+LEF+AF+ LR+K P APRPYKIP+
Sbjct  412  PLIAILFSASGVLLLSWLSFQEIIAAENILYCFGMLLEFLAFMRLRMKYPRAPRPYKIPL  471

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIG++L+ +PPT+LI V LAFSS K++++S  A+  GLV+QP ++H++KK+WL+FS+S 
Sbjct  472  GTIGSILVIIPPTLLIFVELAFSSPKIMIVSAAAMIAGLVLQPCLKHLKKKQWLRFSISP  531

Query  357  DLPDIDHTTRESA  319
            DLPD   TT E+A
Sbjct  532  DLPDFIETTCENA  544



>ref|XP_011088640.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Sesamum indicum]
Length=484

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+ KI   G WL +W+Q A+A+SNMGMFVAEMSSDSFQLLGMAERGMLPE FA+RSRHGT
Sbjct  290  DVGKIVG-GVWLRFWIQVASAVSNMGMFVAEMSSDSFQLLGMAERGMLPECFARRSRHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P +GILFSASGV+LLSWLSFQEIVAAENFLYCFGMI+EFIAFV LRI  P A RPYK+PV
Sbjct  349  PFVGILFSASGVVLLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRIDHPAASRPYKVPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+LMC+ PT+LI VVLA +S KV+ +SL A+ IGL++QP +++ EKKRWL+FSVSS
Sbjct  409  GTTGAILMCIAPTLLILVVLALASFKVMGLSLFAVLIGLILQPCLKYTEKKRWLRFSVSS  468

Query  357  DLPDIDHTTRESAA  316
            DLPD   T ++  A
Sbjct  469  DLPDFLSTAQDYRA  482



>gb|EYU37507.1| hypothetical protein MIMGU_mgv1a019424mg, partial [Erythranthe 
guttata]
Length=523

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            GAWLSWW+Q AAAM+NMGMFVAEMS+DSFQLLGMAERGMLPE FA+RSR+GTPL+GILFS
Sbjct  341  GAWLSWWIQAAAAMANMGMFVAEMSADSFQLLGMAERGMLPEVFARRSRYGTPLVGILFS  400

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV++LSW+SFQEIVAAENFLYCFGM LEF AFVWLRIK+P APRPYK+PVG +GAVL+
Sbjct  401  ASGVLMLSWMSFQEIVAAENFLYCFGMGLEFTAFVWLRIKAPFAPRPYKVPVGKVGAVLI  460

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            CVPP +L+ +VLAFS+LKV V+S+G + IGLV QP ++++EKK  L+FSVSSDLPDI   
Sbjct  461  CVPPMVLMCIVLAFSTLKVFVVSVGCVGIGLVFQPLMKYIEKKGLLRFSVSSDLPDIHGA  520

Query  333  TRE  325
              E
Sbjct  521  APE  523



>ref|XP_007041749.1| Amino acid permease family protein [Theobroma cacao]
 gb|EOX97580.1| Amino acid permease family protein [Theobroma cacao]
Length=500

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL  W+Q AAA+SNMGMF+AEMSSDSFQL GMA RGMLPEFFAKRSR+GTPL+GILFS
Sbjct  319  GVWLLAWIQAAAALSNMGMFLAEMSSDSFQLEGMATRGMLPEFFAKRSRYGTPLVGILFS  378

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSFQEIVAAENFLYCFGMI+EFIAFV LRI  P   RP+KIPV T GA+LM
Sbjct  379  ASGVLLLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRIGHPAESRPFKIPVSTAGAILM  438

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPT+LI VVLAF+SLKV++IS+ A  IGLV++P +R+ EKKRWL+FS+++D+ D    
Sbjct  439  CIPPTLLILVVLAFASLKVMLISVVAAIIGLVLEPCLRYSEKKRWLRFSMNADIHDFHSA  498

Query  333  TR  328
             R
Sbjct  499  YR  500



>ref|XP_010086840.1| putative transporter [Morus notabilis]
 gb|EXB24038.1| putative transporter [Morus notabilis]
Length=484

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL +WVQ A+A+SNMGMFVAEMSSD++QL GMA RGMLP FF K+SRHGTPL+GILFS
Sbjct  298  GVWLRFWVQAASALSNMGMFVAEMSSDAYQLQGMACRGMLPAFFGKKSRHGTPLMGILFS  357

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RPYKIPVGT GA+L+
Sbjct  358  ASGVILLSWLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKYPAASRPYKIPVGTAGAILL  417

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI---  343
            C+PPT+LI VVLA +S KV+VIS+ A+ IGLVMQP +++ EKKRWL+FSV SDLPDI   
Sbjct  418  CIPPTLLILVVLALASSKVMVISILAVIIGLVMQPCLKYSEKKRWLRFSVESDLPDILSA  477

Query  342  DHTTRE  325
            DH   E
Sbjct  478  DHQCNE  483



>ref|XP_009355626.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Pyrus x bretschneideri]
Length=470

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GT
Sbjct  276  DIAKMLG-GVWLRTWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLS+LSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  335  PLTGILFSASGVILLSFLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI  VLA ++ KV+VIS+ A+ IGL++QP I + + KRW  FS  S
Sbjct  395  GTVGAILICIPPTLLIFAVLALATPKVMVISIAAMIIGLLLQPCIEYTKNKRWFNFSTKS  454

Query  357  DLPDIDHTTRESA  319
            DLPDI +   + +
Sbjct  455  DLPDIHNAYDQCS  467



>ref|XP_006432849.1| hypothetical protein CICLE_v10003646mg [Citrus clementina]
 gb|ESR46089.1| hypothetical protein CICLE_v10003646mg [Citrus clementina]
Length=463

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 155/188 (82%), Gaps = 10/188 (5%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WLSW +QG AAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRS +GTPLIGI+FS
Sbjct  284  GVWLSWCIQGVAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSCYGTPLIGIIFS  343

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGV+LLSWLSF++IVAAENFLYCFGMI+EFIAFVWLRI+ P A RPYKIP GT+ A++M
Sbjct  344  ASGVVLLSWLSFRDIVAAENFLYCFGMIMEFIAFVWLRIQYPAASRPYKIPTGTVRAIIM  403

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHT  334
            C+PPTILI V L          S+GA+ IGLVMQP +++ EKKR +KFS S++L D+   
Sbjct  404  CIPPTILIFVAL----------SVGAVVIGLVMQPCLKYAEKKRLMKFSTSAELSDLHGP  453

Query  333  TRESAASL  310
             +ES  SL
Sbjct  454  EQESVDSL  461



>ref|XP_009355624.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Pyrus x bretschneideri]
Length=484

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A+A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRSR+GT
Sbjct  290  DIAKMLG-GVWLRTWVLAASALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSRYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLS+LSFQEIVAAEN+LYCFGMI+EFIAFV LR+K P A RP+KIPV
Sbjct  349  PLTGILFSASGVILLSFLSFQEIVAAENYLYCFGMIMEFIAFVKLRMKHPAASRPFKIPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI  VLA ++ KV+VIS+ A+ IGL++QP I + + KRW  FS  S
Sbjct  409  GTVGAILICIPPTLLIFAVLALATPKVMVISIAAMIIGLLLQPCIEYTKNKRWFNFSTKS  468

Query  357  DLPDIDHTTRESA  319
            DLPDI +   + +
Sbjct  469  DLPDIHNAYDQCS  481



>ref|XP_006432847.1| hypothetical protein CICLE_v10000996mg [Citrus clementina]
 gb|ESR46087.1| hypothetical protein CICLE_v10000996mg [Citrus clementina]
Length=480

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 158/185 (85%), Gaps = 5/185 (3%)
 Frame = -1

Query  849  QGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFSASGVILLS  670
            +GAAAMSNMGMFVAEMSS+SFQLLGMAE GMLPEFFAKRS +GTPLIGI+FSASGV+LLS
Sbjct  294  KGAAAMSNMGMFVAEMSSNSFQLLGMAECGMLPEFFAKRSCYGTPLIGIIFSASGVVLLS  353

Query  669  WLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLMCVPPTILI  490
            WLSF++IVAAENFLYCFGM++EFIAFVWLRI+ P A RPYKIP GT+GA++MC+PPTILI
Sbjct  354  WLSFRDIVAAENFLYCFGMVMEFIAFVWLRIQYPAASRPYKIPTGTVGAIIMCIPPTILI  413

Query  489  -----GVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDIDHTTRE  325
                  VVLA SSLKV V+S+GA+ IGLVMQP ++  EKKR +KFS S++L D+    +E
Sbjct  414  CVVLCCVVLALSSLKVAVLSVGAVVIGLVMQPCLKCAEKKRLMKFSTSAELSDLHGPEQE  473

Query  324  SAASL  310
            S  SL
Sbjct  474  SVDSL  478



>ref|XP_003573441.1| PREDICTED: probable polyamine transporter At1g31830 [Brachypodium 
distachyon]
Length=495

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 159/189 (84%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            D+AKI   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSRHGT
Sbjct  295  DVAKI-LGGFWLHSWIQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRHGT  353

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL+GILFSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+  RPY+IP+
Sbjct  354  PLVGILFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRMTHPNTSRPYRIPL  413

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GAVLM +PP ILI VV+A +S KV+ +S+ A+ IG  +QP + +VEKKRWL+FSVS 
Sbjct  414  GTVGAVLMIIPPAILIIVVMALASFKVMAVSILAVLIGFALQPSLVYVEKKRWLRFSVSE  473

Query  357  DLPDIDHTT  331
            DLP++  ++
Sbjct  474  DLPELPDSS  482



>gb|AGT16029.1| permease [Saccharum hybrid cultivar R570]
Length=476

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 164/200 (82%), Gaps = 4/200 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I   G WL  W+Q AAA+SNMG F+ EMSSDS+QLLGMAERGMLP+FFAKRS +GT
Sbjct  277  DIARI-LGGIWLHSWIQAAAALSNMGNFLTEMSSDSYQLLGMAERGMLPDFFAKRSHYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GVILLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  336  PLIGILFSAFGVILLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVTHPNASRPYKIPL  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PP +LI VV+A +S KV+ +S+ A+ IG ++QP + +VEKKRWL+FS+S+
Sbjct  396  GTIGAVLMIIPPALLIVVVMALASYKVMAVSILAMVIGFMLQPCLGYVEKKRWLRFSISA  455

Query  357  DLPDI---DHTTRESAASLI  307
            DLPD+     T  + A  L+
Sbjct  456  DLPDLPDAQGTAEDDAVPLV  475



>gb|KJB77779.1| hypothetical protein B456_012G156700 [Gossypium raimondii]
Length=485

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL  WVQ AAA+SNMGMF+AEMSSDSFQL GMA RGMLPE FAKRSR+GTPL+GILFS
Sbjct  304  GVWLLTWVQAAAALSNMGMFLAEMSSDSFQLEGMASRGMLPELFAKRSRYGTPLVGILFS  363

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEI+AAENFLYCFGMI+EFIAFV LR+  P   RPYKIPVGT GA+LM
Sbjct  364  ASGVILLSWLSFQEIIAAENFLYCFGMIMEFIAFVKLRVDRPAESRPYKIPVGTAGAILM  423

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI  343
            C+PPT+LI VVLA +S KV+V+S  A+ IGL ++P +R+ E+KRWLKFS++ DL D+
Sbjct  424  CIPPTLLILVVLAIASFKVMVVSTVAVMIGLALEPCLRYSERKRWLKFSMNPDLYDL  480



>gb|KJB77778.1| hypothetical protein B456_012G156700 [Gossypium raimondii]
Length=470

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  873  GAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGTPLIGILFS  694
            G WL  WVQ AAA+SNMGMF+AEMSSDSFQL GMA RGMLPE FAKRSR+GTPL+GILFS
Sbjct  289  GVWLLTWVQAAAALSNMGMFLAEMSSDSFQLEGMASRGMLPELFAKRSRYGTPLVGILFS  348

Query  693  ASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPVGTIGAVLM  514
            ASGVILLSWLSFQEI+AAENFLYCFGMI+EFIAFV LR+  P   RPYKIPVGT GA+LM
Sbjct  349  ASGVILLSWLSFQEIIAAENFLYCFGMIMEFIAFVKLRVDRPAESRPYKIPVGTAGAILM  408

Query  513  CVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSSDLPDI  343
            C+PPT+LI VVLA +S KV+V+S  A+ IGL ++P +R+ E+KRWLKFS++ DL D+
Sbjct  409  CIPPTLLILVVLAIASFKVMVVSTVAVMIGLALEPCLRYSERKRWLKFSMNPDLYDL  465



>gb|KCW55585.1| hypothetical protein EUGRSUZ_I01455 [Eucalyptus grandis]
Length=446

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQ A+A+SN GMF+AEMSSDSFQLLGMAERGMLPEFFAKRS +GT
Sbjct  252  DIAKI-LGGVWLRSWVQAASALSNTGMFMAEMSSDSFQLLGMAERGMLPEFFAKRSCYGT  310

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVI+LSWLSFQEIVAAENFLYCFGMI+EF+AFV LR+K P A RPY+IPV
Sbjct  311  PLFGILFSASGVIMLSWLSFQEIVAAENFLYCFGMIMEFVAFVKLRVKHPTASRPYRIPV  370

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMC+PPT+L+ VV+A +  KV+ +SL A+ IGLV++P +R+ EK+RW +FS+S+
Sbjct  371  GTVGSILMCIPPTMLLLVVVALAPNKVMGLSLVAVMIGLVLEPCLRYAEKRRWFRFSISA  430

Query  357  DLPD  346
            +L D
Sbjct  431  NLQD  434



>gb|AGT16601.1| amino acid permease-like protein [Saccharum hybrid cultivar R570]
Length=476

 Score =   266 bits (681),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I   G WL  W+Q AAA+SNMG F+ EMSSDS+QLLGMAERGMLP+FFAKRS +GT
Sbjct  277  DIARILG-GIWLHSWIQAAAALSNMGNFLTEMSSDSYQLLGMAERGMLPDFFAKRSHYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GVILLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  336  PLIGILFSAFGVILLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVTHPNASRPYKIPL  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGAVLM +PP +LI VV+  +S KV+ +S+ A+ IG V+QP + +VEKKRWL+FS+S+
Sbjct  396  GTIGAVLMIIPPALLIVVVMVLASYKVMAVSILAMVIGFVLQPCLGYVEKKRWLRFSISA  455

Query  357  DLPDI---DHTTRESAASLI  307
            DLPD+     T  + A  L+
Sbjct  456  DLPDLPDAQGTAEDDAVPLV  475



>ref|XP_008347507.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Malus domestica]
Length=470

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 157/193 (81%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRS HGT
Sbjct  276  DIAKMLG-GVWLRTWVLAAXALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSXHGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLS+LSFQEIVAAEN+LYCFGMI+EFIAFV LR+  P A RP+KIPV
Sbjct  335  PLTGILFSASGVILLSFLSFQEIVAAENYLYCFGMIMEFIAFVKLRMXXPAASRPFKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVLA ++ KV+VIS+ A+ IGL++QP I + + KRW  FS  S
Sbjct  395  GTVGAILICIPPTLLIFVVLALATPKVMVISIAAMIIGLLLQPCIEYTKNKRWFNFSTKS  454

Query  357  DLPDIDHTTRESA  319
            DLPDI +   + +
Sbjct  455  DLPDIHNAYDQCS  467



>ref|XP_009588090.1| PREDICTED: probable polyamine transporter At1g31830 [Nicotiana 
tomentosiformis]
Length=466

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQGA+A+SNMGMF+AEMS DSFQLLGMAERGMLP+FFAKRS +GT
Sbjct  273  DIAKIIG-GVWLRLWVQGASAVSNMGMFLAEMSGDSFQLLGMAERGMLPDFFAKRSHYGT  331

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEIVAAENF+YC GMI+EFIAFV LRIK P   RPY IP+
Sbjct  332  PLIGILFSASGVILLSWLSFQEIVAAENFMYCCGMIVEFIAFVKLRIKYPAVSRPYMIPL  391

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMCVPPT  I VV+A  + KV+++S  AI +GL++QP + + +KK+WL FSVSS
Sbjct  392  GTVGSILMCVPPTFFILVVMALCTFKVMIVSFLAILVGLILQPCLVYCDKKKWLSFSVSS  451

Query  357  DLPDIDHTTR  328
            DL D+  +  
Sbjct  452  DLVDLQSSYH  461



>ref|XP_008347506.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Malus domestica]
Length=484

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 157/193 (81%), Gaps = 1/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  WV  A A+SNMGMFVAEMSSDSFQLLGMAERGMLP  FAKRS HGT
Sbjct  290  DIAKMLG-GVWLRTWVLAAXALSNMGMFVAEMSSDSFQLLGMAERGMLPSIFAKRSXHGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLS+LSFQEIVAAEN+LYCFGMI+EFIAFV LR+  P A RP+KIPV
Sbjct  349  PLTGILFSASGVILLSFLSFQEIVAAENYLYCFGMIMEFIAFVKLRMXXPAASRPFKIPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVLA ++ KV+VIS+ A+ IGL++QP I + + KRW  FS  S
Sbjct  409  GTVGAILICIPPTLLIFVVLALATPKVMVISIAAMIIGLLLQPCIEYTKNKRWFNFSTKS  468

Query  357  DLPDIDHTTRESA  319
            DLPDI +   + +
Sbjct  469  DLPDIHNAYDQCS  481



>gb|AGT16594.1| amino acid permease-like protein [Saccharum hybrid cultivar R570]
 gb|AGT16599.1| amino acid permease-like protein [Saccharum hybrid cultivar R570]
Length=371

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I     WL  W+Q  AA+SN+G F+ EM+SDS+QLLGMAERGMLPEFFAKRSRHGT
Sbjct  172  DIARILG-DVWLQSWMQAVAALSNVGNFLTEMNSDSYQLLGMAERGMLPEFFAKRSRHGT  230

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSW+ FQEIVA EN+LYCFGMILEFIAFV LR+  P+A +PYKIP 
Sbjct  231  PLTGILFSASGVILLSWMRFQEIVATENYLYCFGMILEFIAFVKLRVTHPNAYQPYKIPR  290

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIG VLM +PPT+ I +V+A +S KV+ +S+ A+ IG+V+QP + +VEKKRWL+FS+S+
Sbjct  291  GTIGVVLMIIPPTLSIVMVVALASYKVMAVSIVAMVIGIVLQPCLVYVEKKRWLRFSISA  350

Query  357  DLPDIDHTTRESA  319
            DLPD+   T+E+A
Sbjct  351  DLPDL-LDTQETA  362



>ref|XP_010028769.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Eucalyptus grandis]
Length=484

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQ A+A+SN GMF+AEMSSDSFQLLGMAERGMLPEFFAKRS +GT
Sbjct  290  DIAKI-LGGVWLRSWVQAASALSNTGMFMAEMSSDSFQLLGMAERGMLPEFFAKRSCYGT  348

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVI+LSWLSFQEIVAAENFLYCFGMI+EF+AFV LR+K P A RPY+IPV
Sbjct  349  PLFGILFSASGVIMLSWLSFQEIVAAENFLYCFGMIMEFVAFVKLRVKHPTASRPYRIPV  408

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMC+PPT+L+ VV+A +  KV+ +SL A+ IGLV++P +R+ EK+RW +FS+S+
Sbjct  409  GTVGSILMCIPPTMLLLVVVALAPNKVMGLSLVAVMIGLVLEPCLRYAEKRRWFRFSISA  468

Query  357  DLPD  346
            +L D
Sbjct  469  NLQD  472



>ref|XP_010028770.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Eucalyptus grandis]
 ref|XP_010028771.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Eucalyptus grandis]
Length=471

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQ A+A+SN GMF+AEMSSDSFQLLGMAERGMLPEFFAKRS +GT
Sbjct  277  DIAKI-LGGVWLRSWVQAASALSNTGMFMAEMSSDSFQLLGMAERGMLPEFFAKRSCYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVI+LSWLSFQEIVAAENFLYCFGMI+EF+AFV LR+K P A RPY+IPV
Sbjct  336  PLFGILFSASGVIMLSWLSFQEIVAAENFLYCFGMIMEFVAFVKLRVKHPTASRPYRIPV  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LMC+PPT+L+ VV+A +  KV+ +SL A+ IGLV++P +R+ EK+RW +FS+S+
Sbjct  396  GTVGSILMCIPPTMLLLVVVALAPNKVMGLSLVAVMIGLVLEPCLRYAEKRRWFRFSISA  455

Query  357  DLPD  346
            +L D
Sbjct  456  NLQD  459



>ref|XP_008661395.1| PREDICTED: uncharacterized protein LOC100193038 isoform X1 [Zea 
mays]
 gb|ACN27671.1| unknown [Zea mays]
 gb|AFW57231.1| hypothetical protein ZEAMMB73_592623 [Zea mays]
Length=493

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I   G WL  W+Q AAA+SNMG F+ EMSSDS+QLLGMAERGMLP+FFAKRS +GT
Sbjct  294  DIARI-LGGIWLHSWIQAAAALSNMGNFLTEMSSDSYQLLGMAERGMLPDFFAKRSHYGT  352

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GVILLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  353  PLIGILFSAFGVILLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVYHPNASRPYKIPL  412

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+LM +PP +LI VV+A +S KV+V+S+ A+  G V+QP + +VEKKRWL+FS+S+
Sbjct  413  GTIGAILMIIPPGLLIIVVMALASYKVMVVSILAMVFGFVLQPCLVYVEKKRWLRFSISA  472

Query  357  DLPDI  343
            DLPD+
Sbjct  473  DLPDL  477



>ref|XP_008661396.1| PREDICTED: uncharacterized protein LOC100193038 isoform X2 [Zea 
mays]
Length=476

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIA+I   G WL  W+Q AAA+SNMG F+ EMSSDS+QLLGMAERGMLP+FFAKRS +GT
Sbjct  277  DIARILG-GIWLHSWIQAAAALSNMGNFLTEMSSDSYQLLGMAERGMLPDFFAKRSHYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GVILLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P+A RPYKIP+
Sbjct  336  PLIGILFSAFGVILLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRVYHPNASRPYKIPL  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIGA+LM +PP +LI VV+A +S KV+V+S+ A+  G V+QP + +VEKKRWL+FS+S+
Sbjct  396  GTIGAILMIIPPGLLIIVVMALASYKVMVVSILAMVFGFVLQPCLVYVEKKRWLRFSISA  455

Query  357  DLPDI  343
            DLPD+
Sbjct  456  DLPDL  460



>ref|XP_009792834.1| PREDICTED: probable polyamine transporter At1g31830 [Nicotiana 
sylvestris]
 ref|XP_009792835.1| PREDICTED: probable polyamine transporter At1g31830 [Nicotiana 
sylvestris]
Length=470

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  WVQGA+A+SNMGMF+AEMS DSFQLLGMAERGMLP+FFAKRSR+GT
Sbjct  277  DIAKIIG-GVWLRLWVQGASAVSNMGMFLAEMSGDSFQLLGMAERGMLPDFFAKRSRYGT  335

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGV+LLSWLSFQEIVAA NFLYC GMI+EFIAFV LRIK P A RPY+IP+
Sbjct  336  PLIGILFSASGVVLLSWLSFQEIVAAANFLYCCGMIVEFIAFVKLRIKYPAASRPYRIPL  395

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
             T+G++LMCVPPT+ I VV+A  + KV+++S   I +G+++QP + + +KK+WL FSVSS
Sbjct  396  STVGSILMCVPPTLFILVVMALCTFKVMIVSFLVILVGIILQPCLVYCDKKKWLSFSVSS  455

Query  357  DLPDIDHT  334
            DL D+  +
Sbjct  456  DLVDLQSS  463



>ref|XP_012077719.1| PREDICTED: probable polyamine transporter At1g31830 isoform X2 
[Jatropha curcas]
Length=415

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGA+A+SNMGMF+AEMSSDSFQLLGMAERGMLP FFAKRSR+GT
Sbjct  227  DIAKIIG-GVWLRLWIQGASALSNMGMFMAEMSSDSFQLLGMAERGMLPAFFAKRSRYGT  285

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P  GILFSASGVILLSWL+FQEIVAAENFLYCFGMI+EFIAFV LRI++P   RPYKIPV
Sbjct  286  PTAGILFSASGVILLSWLTFQEIVAAENFLYCFGMIMEFIAFVKLRIENPQITRPYKIPV  345

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVLA +SLKV+ IS+ A+ +GLVMQP + + E KRW +FS +S
Sbjct  346  GTVGAILICIPPTLLILVVLALASLKVIAISIIAVVLGLVMQPCLTYAESKRWFRFSYNS  405

Query  357  DLPDIDHT  334
            DL     T
Sbjct  406  DLASFRST  413



>ref|XP_008800055.1| PREDICTED: polyamine transporter RMV1-like [Phoenix dactylifera]
Length=532

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 163/195 (84%), Gaps = 1/195 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL+WW+Q AAA SNMGMF+A+MSS S+QLLGMAE GMLP+FF+ RSR+GT
Sbjct  335  DIAKIIG-GVWLTWWMQAAAASSNMGMFIAKMSSYSYQLLGMAELGMLPKFFSMRSRYGT  393

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSASGVILLSWLSFQEI+AAEN LYCFGM+LEF+AF+ LRIK P APRPY+IP+
Sbjct  394  PLIGILFSASGVILLSWLSFQEIIAAENILYCFGMLLEFLAFMRLRIKHPMAPRPYRIPL  453

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G++LM +PPT+LI V LAF+S K++ +SL A+ IG V++P ++ +EKK+WL+FS  +
Sbjct  454  GTVGSILMIIPPTLLIFVELAFASHKIMFVSLAAMIIGHVLRPCLKRLEKKQWLRFSKIT  513

Query  357  DLPDIDHTTRESAAS  313
            D+PD   T   +AA 
Sbjct  514  DIPDFGATQNANAAE  528



>dbj|BAK08341.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  294  DIAKILG-GFWLHSWIQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  352

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P   RP++IP+
Sbjct  353  PLIGILFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRMTHPSTSRPFRIPL  412

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G+VLM +PPTILI VV+  +S KV+ +S+ A+ +G  +QP + ++EKKRWL+FSVS 
Sbjct  413  GTVGSVLMIIPPTILIVVVMVLASFKVMAVSVLAVLVGFALQPALVYMEKKRWLRFSVSE  472

Query  357  DLPDIDHTT  331
            DLPD+  ++
Sbjct  473  DLPDLLESS  481



>ref|XP_010315394.1| PREDICTED: probable polyamine transporter At1g31830 [Solanum 
lycopersicum]
Length=461

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 1/191 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL WWVQGA+A+SNMGMF+AEMS DS+QLLGMAERGMLPEFFAKRS +GT
Sbjct  268  DIAKIIG-GVWLRWWVQGASAVSNMGMFLAEMSGDSYQLLGMAERGMLPEFFAKRSHYGT  326

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P I ILFSASGV+LLS LSFQEIVAAENF+ CFGMILEF+ FV LRIK P A RPY+IP+
Sbjct  327  PFISILFSASGVVLLSCLSFQEIVAAENFMNCFGMILEFLCFVKLRIKYPAASRPYRIPL  386

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GTIG++L+C+PPT+ + VV+A  S KV+++S  AI +GL+MQP + + +KK+WL FSVSS
Sbjct  387  GTIGSILICLPPTLFLLVVIALCSFKVMIVSFLAILVGLIMQPCLIYCDKKKWLSFSVSS  446

Query  357  DLPDIDHTTRE  325
            DL ++     +
Sbjct  447  DLVELQTNYHQ  457



>ref|XP_012077717.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Jatropha curcas]
 ref|XP_012077718.1| PREDICTED: probable polyamine transporter At1g31830 isoform X1 
[Jatropha curcas]
 gb|KDP33289.1| hypothetical protein JCGZ_13076 [Jatropha curcas]
Length=464

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+QGA+A+SNMGMF+AEMSSDSFQLLGMAERGMLP FFAKRSR+GT
Sbjct  276  DIAKIIG-GVWLRLWIQGASALSNMGMFMAEMSSDSFQLLGMAERGMLPAFFAKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P  GILFSASGVILLSWL+FQEIVAAENFLYCFGMI+EFIAFV LRI++P   RPYKIPV
Sbjct  335  PTAGILFSASGVILLSWLTFQEIVAAENFLYCFGMIMEFIAFVKLRIENPQITRPYKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVLA +SLKV+ IS+ A+ +GLVMQP + + E KRW +FS +S
Sbjct  395  GTVGAILICIPPTLLILVVLALASLKVIAISIIAVVLGLVMQPCLTYAESKRWFRFSYNS  454

Query  357  DLPDIDHT  334
            DL     T
Sbjct  455  DLASFRST  462



>dbj|BAJ89860.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAKI   G WL  W+Q AAA+SNMG FV EMSSDS+QLLGMAERGMLPEFFAKRSR+GT
Sbjct  309  DIAKI-LGGFWLHSWIQAAAALSNMGNFVTEMSSDSYQLLGMAERGMLPEFFAKRSRYGT  367

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PLIGILFSA GV+LLSW+SFQEI+AAEN+LYCFGMILEFIAF+ LR+  P   RP++IP+
Sbjct  368  PLIGILFSAFGVVLLSWMSFQEIIAAENYLYCFGMILEFIAFIKLRMTHPSTSRPFRIPL  427

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+G+VLM +PPTILI VV+  +S KV+ +S+ A+ +G  +QP + ++EKKRWL+FSVS 
Sbjct  428  GTVGSVLMIIPPTILIVVVMVLASFKVMAVSVLAVLVGFALQPALVYMEKKRWLRFSVSE  487

Query  357  DLPDIDHTT  331
            DLPD+  ++
Sbjct  488  DLPDLLESS  496



>ref|XP_002510495.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF52682.1| amino acid transporter, putative [Ricinus communis]
Length=455

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            DIAK+   G WL  W+QGA+A SNMGMFVAEMSSDSFQLLGMAE GMLPE FAKRSR+GT
Sbjct  275  DIAKV-LGGVWLRSWIQGASAFSNMGMFVAEMSSDSFQLLGMAEHGMLPELFAKRSRYGT  333

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            P  GILFSASGVILLSWLSFQEIVAAENFLYCFGMI+EFIAFV LR+ +P+APRPYKIPV
Sbjct  334  PHAGILFSASGVILLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRLHNPEAPRPYKIPV  393

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT GA+L+C+PPT+LI VVLA +SLKV+ IS+  + +GLVMQP + + EKKRWL+FS + 
Sbjct  394  GTAGAILICIPPTLLILVVLALASLKVMAISITIVLLGLVMQPCLTYAEKKRWLRFSSNV  453

Query  357  DL  352
            DL
Sbjct  454  DL  455



>ref|XP_011046633.1| PREDICTED: probable polyamine transporter At1g31830 [Populus 
euphratica]
 ref|XP_011046634.1| PREDICTED: probable polyamine transporter At1g31830 [Populus 
euphratica]
 ref|XP_011046635.1| PREDICTED: probable polyamine transporter At1g31830 [Populus 
euphratica]
Length=462

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            ++AKI   G WL  W+QGA+A SNMGMFVAEMSSDSFQLLGMAERGMLPE F+KRSR+GT
Sbjct  276  EVAKI-LGGVWLRSWIQGASAFSNMGMFVAEMSSDSFQLLGMAERGMLPEIFSKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMI+EFIAFV LR+  P APRPYKIPV
Sbjct  335  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRMDYPAAPRPYKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVL  +SLKV+ IS  A+ IGL+M+P + + EKKRW +FS +S
Sbjct  395  GTVGAILICIPPTLLILVVLTLASLKVMAISSVALIIGLIMKPCLDYAEKKRWFRFSKNS  454

Query  357  DLPDIDH  337
            DL  I  
Sbjct  455  DLSSIHS  461



>ref|XP_002306199.1| hypothetical protein POPTR_0004s18450g [Populus trichocarpa]
 ref|XP_006384586.1| hypothetical protein POPTR_0004s18450g [Populus trichocarpa]
 gb|EEE86710.1| hypothetical protein POPTR_0004s18450g [Populus trichocarpa]
 gb|ERP62383.1| hypothetical protein POPTR_0004s18450g [Populus trichocarpa]
Length=462

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = -1

Query  897  DIAKIPRVGAWLSWWVQGAAAMSNMGMFVAEMSSDSFQLLGMAERGMLPEFFAKRSRHGT  718
            +IAKI   G WL  W+QGA+A SNMGMFVAEMSSDSFQLLGMAERGMLPE F KRSR+GT
Sbjct  276  EIAKI-LGGVWLRSWIQGASAFSNMGMFVAEMSSDSFQLLGMAERGMLPEIFGKRSRYGT  334

Query  717  PLIGILFSASGVILLSWLSFQEIVAAENFLYCFGMILEFIAFVWLRIKSPDAPRPYKIPV  538
            PL GILFSASGVILLSWLSFQEIVAAENFLYCFGMI+EFIAFV LR+  P APRPYKIPV
Sbjct  335  PLTGILFSASGVILLSWLSFQEIVAAENFLYCFGMIMEFIAFVKLRMDYPAAPRPYKIPV  394

Query  537  GTIGAVLMCVPPTILIGVVLAFSSLKVLVISLGAIAIGLVMQPGIRHVEKKRWLKFSVSS  358
            GT+GA+L+C+PPT+LI VVL  +SLKV+ IS  A+ +GL+M+P + + EKKRW +FS +S
Sbjct  395  GTVGAILICIPPTLLILVVLTLASLKVMAISSVALIVGLIMKPCLDYAEKKRWFRFSKNS  454

Query  357  DLPDIDH  337
            DL  I  
Sbjct  455  DLSSIHS  461



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2049935769300