BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364818.1|  PREDICTED: uncharacterized protein LOC102594852    129   1e-31   Solanum tuberosum [potatoes]
ref|XP_004232605.1|  PREDICTED: uncharacterized protein LOC101246304    125   3e-30   Solanum lycopersicum
ref|XP_009593254.1|  PREDICTED: uncharacterized protein LOC104089941    124   8e-30   Nicotiana tomentosiformis
ref|XP_009629022.1|  PREDICTED: dual specificity protein kinase s...    120   2e-28   Nicotiana tomentosiformis
ref|XP_009792090.1|  PREDICTED: uncharacterized protein LOC104239210    118   2e-27   Nicotiana sylvestris
ref|XP_006448576.1|  hypothetical protein CICLE_v10015639mg             117   2e-27   Citrus clementina [clementine]
ref|XP_006468594.1|  PREDICTED: uncharacterized protein LOC102614205    115   9e-27   Citrus sinensis [apfelsine]
emb|CDP04102.1|  unnamed protein product                                114   2e-26   Coffea canephora [robusta coffee]
ref|XP_009798027.1|  PREDICTED: uncharacterized protein LOC104244298    114   2e-26   Nicotiana sylvestris
emb|CAN68394.1|  hypothetical protein VITISV_042519                     112   2e-25   Vitis vinifera
ref|XP_002263612.1|  PREDICTED: uncharacterized protein LOC100256507    112   2e-25   Vitis vinifera
ref|XP_010100595.1|  Putative Glutamine amidotransferase                108   2e-24   Morus notabilis
ref|XP_002299382.2|  hypothetical protein POPTR_0001s12320g             107   5e-24   
ref|XP_010260812.1|  PREDICTED: uncharacterized protein LOC104599795    106   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_002303720.2|  hypothetical protein POPTR_0003s15520g             105   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002303719.2|  hypothetical protein POPTR_0003s15520g             105   3e-23   
ref|XP_008225940.1|  PREDICTED: uncharacterized protein LOC103325537    105   4e-23   Prunus mume [ume]
ref|XP_007212311.1|  hypothetical protein PRUPE_ppa006731mg             104   9e-23   Prunus persica
ref|XP_011008217.1|  PREDICTED: uncharacterized protein LOC105113658    103   1e-22   Populus euphratica
ref|XP_011022300.1|  PREDICTED: uncharacterized protein LOC105124...    102   5e-22   Populus euphratica
ref|XP_011022299.1|  PREDICTED: uncharacterized protein LOC105124...    102   6e-22   Populus euphratica
gb|KHN21364.1|  Putative GMP synthase [glutamine-hydrolyzing]           100   2e-21   Glycine soja [wild soybean]
ref|XP_008383248.1|  PREDICTED: uncharacterized protein LOC103445971  99.8    3e-21   
ref|XP_003531474.1|  PREDICTED: uncharacterized protein LOC100791725  98.6    1e-20   Glycine max [soybeans]
ref|XP_009368563.1|  PREDICTED: titin-like                            97.1    3e-20   Pyrus x bretschneideri [bai li]
ref|XP_007149154.1|  hypothetical protein PHAVU_005G045900g           95.9    8e-20   Phaseolus vulgaris [French bean]
ref|XP_009363279.1|  PREDICTED: uncharacterized protein LOC103953267  95.5    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_004295546.1|  PREDICTED: uncharacterized protein LOC101298985  94.4    4e-19   Fragaria vesca subsp. vesca
ref|XP_007022761.1|  DNA glycosylase superfamily protein isoform 1    94.0    4e-19   
ref|XP_007022762.1|  DNA glycosylase superfamily protein isoform 2    94.0    5e-19   
ref|XP_003546838.1|  PREDICTED: uncharacterized protein LOC100811352  93.6    5e-19   Glycine max [soybeans]
gb|KHN48850.1|  Putative GMP synthase [glutamine-hydrolyzing]         93.6    5e-19   Glycine soja [wild soybean]
ref|XP_007133461.1|  hypothetical protein PHAVU_011G180500g           91.3    3e-18   Phaseolus vulgaris [French bean]
ref|XP_008364234.1|  PREDICTED: uncharacterized protein LOC103427927  90.9    5e-18   
ref|XP_009368609.1|  PREDICTED: uncharacterized protein LOC103958107  90.1    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_009368625.1|  PREDICTED: uncharacterized protein LOC103958120  89.7    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_012092185.1|  PREDICTED: uncharacterized protein LOC105649949  89.4    2e-17   Jatropha curcas
ref|XP_002312220.1|  methyladenine glycosylase family protein         89.4    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009785679.1|  PREDICTED: uncharacterized protein LOC104233914  88.6    3e-17   Nicotiana sylvestris
ref|XP_004293832.1|  PREDICTED: uncharacterized protein LOC101310385  88.2    4e-17   Fragaria vesca subsp. vesca
ref|XP_011012959.1|  PREDICTED: uncharacterized protein LOC105117079  88.2    5e-17   Populus euphratica
ref|XP_002315089.2|  methyladenine glycosylase family protein         88.2    6e-17   
ref|XP_008383216.1|  PREDICTED: uncharacterized protein LOC103445940  87.0    2e-16   Malus domestica [apple tree]
ref|XP_002515807.1|  DNA-3-methyladenine glycosylase, putative        86.7    2e-16   
gb|KJB14126.1|  hypothetical protein B456_002G111100                  85.1    2e-16   Gossypium raimondii
gb|KJB14125.1|  hypothetical protein B456_002G111100                  85.1    3e-16   Gossypium raimondii
ref|XP_007040982.1|  DNA glycosylase superfamily protein, putative    85.5    4e-16   
ref|XP_009592127.1|  PREDICTED: uncharacterized protein LOC104089024  84.7    6e-16   Nicotiana tomentosiformis
gb|KJB14128.1|  hypothetical protein B456_002G111100                  85.1    7e-16   Gossypium raimondii
gb|KJB14124.1|  hypothetical protein B456_002G111100                  84.7    8e-16   Gossypium raimondii
ref|XP_010670018.1|  PREDICTED: uncharacterized protein LOC104887122  84.7    1e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH38202.1|  DNA-3-methyladenine glycosylase I                     83.6    1e-15   Medicago truncatula
ref|XP_012075493.1|  PREDICTED: uncharacterized protein LOC105636759  84.0    2e-15   Jatropha curcas
ref|XP_011014375.1|  PREDICTED: uncharacterized protein LOC105118177  84.0    2e-15   Populus euphratica
ref|XP_003595924.1|  DNA-3-methyladenine glycosylase                  83.2    2e-15   Medicago truncatula
gb|AFK37052.1|  unknown                                               83.2    3e-15   Medicago truncatula
ref|XP_008465610.1|  PREDICTED: uncharacterized protein LOC103503249  81.6    3e-15   Cucumis melo [Oriental melon]
ref|XP_002530111.1|  DNA-3-methyladenine glycosylase, putative        83.2    3e-15   Ricinus communis
ref|XP_004517238.1|  PREDICTED: uncharacterized protein LOC101500749  80.9    6e-15   
ref|XP_007211731.1|  hypothetical protein PRUPE_ppa006139mg           82.4    7e-15   Prunus persica
gb|KEH19325.1|  DNA-3-methyladenine glycosylase I                     80.5    1e-14   Medicago truncatula
gb|KHG21574.1|  putative GMP synthase [glutamine-hydrolyzing]         80.9    1e-14   Gossypium arboreum [tree cotton]
ref|XP_004139917.2|  PREDICTED: uncharacterized protein LOC101218536  81.3    1e-14   Cucumis sativus [cucumbers]
ref|XP_010092457.1|  Putative Glutamine amidotransferase              81.6    1e-14   Morus notabilis
ref|XP_004509997.1|  PREDICTED: uncharacterized protein LOC101508...  80.1    2e-14   
gb|KEH19324.1|  DNA-3-methyladenine glycosylase I                     80.5    2e-14   Medicago truncatula
gb|ACJ83955.1|  unknown                                               78.6    3e-14   Medicago truncatula
ref|XP_004509996.1|  PREDICTED: uncharacterized protein LOC101508...  79.7    5e-14   Cicer arietinum [garbanzo]
ref|XP_010928808.1|  PREDICTED: uncharacterized protein LOC105050470  78.2    1e-13   Elaeis guineensis
ref|XP_006422312.1|  hypothetical protein CICLE_v10005040mg           78.6    2e-13   Citrus clementina [clementine]
gb|KHN35318.1|  Putative GMP synthase [glutamine-hydrolyzing]         76.6    6e-13   Glycine soja [wild soybean]
ref|XP_003545728.1|  PREDICTED: uncharacterized protein LOC100793449  76.3    7e-13   Glycine max [soybeans]
ref|XP_008346069.1|  PREDICTED: uncharacterized protein LOC103409028  75.9    1e-12   
gb|KHN38170.1|  Putative GMP synthase [glutamine-hydrolyzing]         74.7    3e-12   Glycine soja [wild soybean]
ref|XP_003531809.1|  PREDICTED: uncharacterized protein LOC100793991  74.7    3e-12   Glycine max [soybeans]
ref|XP_009363313.1|  PREDICTED: uncharacterized protein LOC103953300  71.6    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_008798468.1|  PREDICTED: uncharacterized protein LOC103713352  70.9    5e-11   Phoenix dactylifera
ref|XP_010060864.1|  PREDICTED: uncharacterized protein LOC104448688  63.9    6e-09   
ref|XP_006352614.1|  PREDICTED: uncharacterized protein LOC102598399  64.3    6e-09   Solanum tuberosum [potatoes]
gb|EYU43616.1|  hypothetical protein MIMGU_mgv1a008239mg              61.2    8e-08   Erythranthe guttata [common monkey flower]
gb|EYU43617.1|  hypothetical protein MIMGU_mgv1a008239mg              60.8    9e-08   Erythranthe guttata [common monkey flower]
ref|XP_010543112.1|  PREDICTED: uncharacterized protein LOC104816138  60.8    9e-08   Tarenaya hassleriana [spider flower]
gb|KFK31617.1|  hypothetical protein AALP_AA6G136400                  60.1    2e-07   Arabis alpina [alpine rockcress]
ref|XP_010481722.1|  PREDICTED: uncharacterized protein LOC104760495  59.3    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010537096.1|  PREDICTED: uncharacterized protein LOC104811922  59.3    4e-07   Tarenaya hassleriana [spider flower]
ref|XP_010441839.1|  PREDICTED: uncharacterized protein LOC104724961  58.9    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009418223.1|  PREDICTED: uncharacterized protein LOC103998466  58.5    7e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008225980.1|  PREDICTED: uncharacterized protein LOC103325571  58.5    8e-07   Prunus mume [ume]
ref|XP_010494515.1|  PREDICTED: uncharacterized protein LOC104771648  57.8    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010058073.1|  PREDICTED: uncharacterized protein LOC104445842  57.4    2e-06   Eucalyptus grandis [rose gum]
gb|ACJ84482.1|  unknown                                               54.7    4e-06   Medicago truncatula
ref|XP_002863551.1|  methyladenine glycosylase family protein         55.1    9e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_011096870.1|  PREDICTED: uncharacterized protein LOC105175920  55.1    1e-05   Sesamum indicum [beniseed]
ref|NP_199281.1|  putative 3-methyladenine glycosylase I              53.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64486.1|  unknown                                               53.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08411.1|  BnaA05g26470D                                        53.9    3e-05   Brassica napus [oilseed rape]
ref|XP_009146594.1|  PREDICTED: uncharacterized protein LOC103870233  53.5    3e-05   Brassica rapa
ref|XP_010499388.1|  PREDICTED: uncharacterized protein LOC104776915  53.5    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006407303.1|  hypothetical protein EUTSA_v10021188mg           53.5    3e-05   Eutrema salsugineum [saltwater cress]
emb|CDY42170.1|  BnaC05g40490D                                        53.5    3e-05   Brassica napus [oilseed rape]
ref|XP_002884921.1|  methyladenine glycosylase family protein         53.5    3e-05   
ref|NP_566433.1|  putative 3-methyladenine glycosylase I              53.5    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486996.1|  PREDICTED: uncharacterized protein LOC104765039  53.5    3e-05   Camelina sativa [gold-of-pleasure]
gb|AAM61316.1|  unknown                                               53.5    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465048.1|  PREDICTED: uncharacterized protein LOC104745492  53.5    3e-05   Camelina sativa [gold-of-pleasure]
ref|NP_001044528.1|  Os01g0799500                                     53.5    4e-05   
gb|EAY76151.1|  hypothetical protein OsI_04083                        53.5    4e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006280615.1|  hypothetical protein CARUB_v10026580mg           52.8    6e-05   
emb|CDY52672.1|  BnaC01g38620D                                        52.8    7e-05   Brassica napus [oilseed rape]
gb|KFK38618.1|  hypothetical protein AALP_AA3G137700                  52.4    7e-05   Arabis alpina [alpine rockcress]
ref|XP_009120354.1|  PREDICTED: uncharacterized protein LOC103845269  52.4    7e-05   Brassica rapa
ref|XP_006398092.1|  hypothetical protein EUTSA_v10000945mg           52.4    9e-05   Eutrema salsugineum [saltwater cress]
ref|XP_006644844.1|  PREDICTED: uncharacterized protein LOC102709508  52.0    1e-04   Oryza brachyantha
ref|XP_006298177.1|  hypothetical protein CARUB_v10014226mg           51.2    2e-04   Capsella rubella
emb|CDY14939.1|  BnaA02g22810D                                        50.8    3e-04   Brassica napus [oilseed rape]
ref|XP_004248406.1|  PREDICTED: uncharacterized protein LOC101258999  50.8    3e-04   Solanum lycopersicum
ref|XP_009123626.1|  PREDICTED: uncharacterized protein LOC103848479  50.4    4e-04   



>ref|XP_006364818.1| PREDICTED: uncharacterized protein LOC102594852 [Solanum tuberosum]
Length=395

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 120/185 (65%), Gaps = 24/185 (13%)
 Frame = +1

Query  118  MCSSETKLQAAPN---------VLQPNRNRVSLLERRSSLKKpssaavlplpp-psraaa  267
            MC+S+TKLQ++P          VLQP+ N V L ERR+SLKK ++ A        ++   
Sbjct  1    MCNSKTKLQSSPQTLSQINGRPVLQPHSNIVPLYERRNSLKKTTNTAASVTANGSTKVKT  60

Query  268  sltttppaspKIKSPRQPAVKRSGN-DPNGLNSSAEKVSTPkpssatl------------  408
            S +TTPP SPK+KSPR PA+KR  N DPNGL+SSAEK+ TPK ++               
Sbjct  61   SSSTTPPVSPKMKSPRLPAIKRGNNIDPNGLSSSAEKIVTPKGTANKAPILLKKPKKSSG  120

Query  409  -lakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
             LA        +   +++++V+ PGSIAAARREQVAI QVQRKMKIAHYGRTKSAKY+GK
Sbjct  121  GLASPPYVENSSLKYSSSLIVEAPGSIAAARREQVAIAQVQRKMKIAHYGRTKSAKYEGK  180

Query  586  VASGD  600
            V+S D
Sbjct  181  VSSLD  185



>ref|XP_004232605.1| PREDICTED: uncharacterized protein LOC101246304 [Solanum lycopersicum]
Length=395

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 119/185 (64%), Gaps = 24/185 (13%)
 Frame = +1

Query  118  MCSSETKLQAAPN---------VLQPNRNRVSLLERRSSLKKpssaavlplpp-psraaa  267
            MC+S+TKLQ++           VLQP+ N V L ERR+SLKK +  A        ++   
Sbjct  1    MCNSKTKLQSSAQTLSQINGRPVLQPHSNIVPLYERRNSLKKTTHTAAPVTANGSTKVKM  60

Query  268  sltttppaspKIKSPRQPAVKRSGN-DPNGLNSSAEKVSTPkpssatl------------  408
            S +TTPP SPK+KSPR PA+KR  N DPNGL+SSAEK+ TPK ++               
Sbjct  61   SSSTTPPVSPKMKSPRLPAIKRGNNIDPNGLSSSAEKIVTPKGTANKAPILLKKPKKSSG  120

Query  409  -lakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
             LA  S     +   +++++V+ PGSIAAARREQVAI QVQRKMKIAHYGRTKSAKY+GK
Sbjct  121  GLASPSSVENSSLKYSSSLIVEAPGSIAAARREQVAIAQVQRKMKIAHYGRTKSAKYEGK  180

Query  586  VASGD  600
            V+S D
Sbjct  181  VSSLD  185



>ref|XP_009593254.1| PREDICTED: uncharacterized protein LOC104089941 [Nicotiana tomentosiformis]
Length=403

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 105/196 (54%), Gaps = 33/196 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPN---------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaas  270
            MCSS+TKLQ +P          VLQPN N V L E R+SLKK        +       A 
Sbjct  1    MCSSKTKLQGSPQTISQINGRPVLQPNSNIVPLFEHRNSLKKTPPKTTSAVVLQRTNNAP  60

Query  271  ltttppaspKI-----------KSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllak  417
              T      KI           KSPRQPA KR   DPN L+SS EKV +PK ++      
Sbjct  61   PATNGNTKVKISVTTPPVSPKLKSPRQPATKRGNIDPNVLSSSGEKVLSPKGTANKTTTL  120

Query  418  k-------------skkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGR  558
                          S     +   +++++++ PGSIAAARREQVA  QVQRKMKIAHYGR
Sbjct  121  LKKPKKSSWGITLPSSVENSSLKYSSSLIIEAPGSIAAARREQVATAQVQRKMKIAHYGR  180

Query  559  TKSAKYDGKVASGDFS  606
            TKSAKY+GKV+S D+S
Sbjct  181  TKSAKYEGKVSSFDYS  196



>ref|XP_009629022.1| PREDICTED: dual specificity protein kinase splA-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 117/210 (56%), Gaps = 48/210 (23%)
 Frame = +1

Query  118  MCSSETKLQ---AAPN-------------VLQPNRNRVSLLERRSSLKKp----------  219
            MCSS +KLQ   +A N             VLQPNRN+V LLERR+SLK            
Sbjct  1    MCSSNSKLQRSSSADNITTQTISHINGRPVLQPNRNQVPLLERRNSLKNSPTKISSAAAL  60

Query  220  -------------ssaavlplpppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLN  360
                         S+         S       TTPP SPKIKSPRQPA+ R  N+PNGLN
Sbjct  61   HPLSSPRIDISPPSTTNCNNNNKISAKIKPFVTTPPISPKIKSPRQPAIMR-DNNPNGLN  119

Query  361  SSAEKVSTPkpssatllakksk--------kgggagapaaaVMVDEPGSIAAARREQVAI  516
            SSAE+  +PK ++ +    K                  +++++V+ PGSIAAARREQVA 
Sbjct  120  SSAERAVSPKDTTKSTYLVKKSKNSSGIPCAENSLLKCSSSLIVEAPGSIAAARREQVAN  179

Query  517  MQVQRKMKIAHYGRTKSAKYDGKVASGDFS  606
            MQVQRKM+IAHYGRTKSAK++GKV++ DFS
Sbjct  180  MQVQRKMRIAHYGRTKSAKFEGKVSAADFS  209



>ref|XP_009792090.1| PREDICTED: uncharacterized protein LOC104239210 [Nicotiana sylvestris]
Length=412

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 114/198 (58%), Gaps = 42/198 (21%)
 Frame = +1

Query  118  MCSSETKLQ---AAPN-------------VLQPNRNRVSLLERRSSLKKp----------  219
            MCSS +KLQ   +A N             VLQPNRN+V LLERR+SLK            
Sbjct  1    MCSSNSKLQRSNSADNITPQTISHINGRPVLQPNRNQVPLLERRNSLKSSPNKLHPLSSP  60

Query  220  -------ssaavlplpppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKV  378
                    +         S       TTPP SPKIKSPRQPA+KR  +DPNGLNSSAE+V
Sbjct  61   RIDISPSCTTNGNNSNKISAKIKPFVTTPPISPKIKSPRQPAIKRD-DDPNGLNSSAERV  119

Query  379  STPkpssatllakksk--------kgggagapaaaVMVDEPGSIAAARREQVAIMQVQRK  534
             +PK ++ +    K              +   +++++V+ PGSIAAARREQVA MQVQRK
Sbjct  120  VSPKDTTKSTYLVKKSKNSSGIPCAENSSLKYSSSLIVEAPGSIAAARREQVANMQVQRK  179

Query  535  MKIAHYGRTKSAKYDGKV  588
            M+IAHYGRTKSAK++GKV
Sbjct  180  MRIAHYGRTKSAKFEGKV  197



>ref|XP_006448576.1| hypothetical protein CICLE_v10015639mg [Citrus clementina]
 gb|ESR61816.1| hypothetical protein CICLE_v10015639mg [Citrus clementina]
Length=375

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 104/168 (62%), Gaps = 10/168 (6%)
 Frame = +1

Query  118  MCSSETKLQAAPN-----VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaaslttt  282
            MCSS++KL +A       VLQP  N+V  LE+RSS+KK  S           + +   + 
Sbjct  1    MCSSKSKLHSATQINGRPVLQPTSNQVPSLEKRSSIKKTGSPKSPITTNNVNSKSFTKSL  60

Query  283  pp--aspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkgggagapaa  456
                 SPK+KSPR  AVKR GNDPN LN+SAEK+ TP         KK K    A    +
Sbjct  61   LSPPVSPKLKSPRPAAVKR-GNDPNVLNTSAEKIMTP--KKLASFVKKPKNAEVAPCYDS  117

Query  457  aVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            +++V+ PGSIAAARRE VAIMQ QRK++IAHYGRTKSAK++GKV   D
Sbjct  118  SLIVEAPGSIAAARREHVAIMQEQRKLRIAHYGRTKSAKFEGKVPGLD  165



>ref|XP_006468594.1| PREDICTED: uncharacterized protein LOC102614205 [Citrus sinensis]
 gb|KDO77184.1| hypothetical protein CISIN_1g017244mg [Citrus sinensis]
Length=375

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 106/168 (63%), Gaps = 10/168 (6%)
 Frame = +1

Query  118  MCSSETKLQAAPN-----VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaaslttt  282
            MCSS++KL +A       VLQP  N+V  LE+R+S+KK  S           + +   + 
Sbjct  1    MCSSKSKLHSATQINGRPVLQPTSNQVPSLEKRNSIKKTGSPKSPITTDNVNSKSFTKSL  60

Query  283  pp--aspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkgggagapaa  456
                 SPK+KSPR  AVKR GNDPN LN+SAEK+ TP       L KK K  G A    +
Sbjct  61   LSPPVSPKLKSPRPAAVKR-GNDPNVLNTSAEKIMTP--KKLASLVKKPKNVGVAPCYDS  117

Query  457  aVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            +++V+ PGSIAAARRE VAIMQ QRK++IAHYGRTKSAK++GKV   D
Sbjct  118  SLIVEAPGSIAAARREHVAIMQEQRKLRIAHYGRTKSAKFEGKVPGLD  165



>emb|CDP04102.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 111/193 (58%), Gaps = 33/193 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------------VLQPNRNRVSLLERRSSLKKpssaavlplppps  255
            MCSS++K Q + +              VLQPN NR  LLER  +    +           
Sbjct  1    MCSSKSKPQGSNSHEISPTLSHINGRPVLQPNCNRTPLLERPPAAASTTITTSTGGNSSP  60

Query  256  raaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkgg  435
            R  AS+TTTPPASP++KSPRQPA KR GNDPNGLNSS EKV TP+ ++ + +  K K   
Sbjct  61   RIRASVTTTPPASPQLKSPRQPATKR-GNDPNGLNSSVEKVVTPRSTTKSSVTSKKKSKK  119

Query  436  gagapaaaV------------------MVDEPGSIAAARREQVAIMQVQRKMKIAHYGRT  561
             +      V                  +V+ PGSIAAARRE VAIMQVQRKMKIAHYGRT
Sbjct  120  SSNGGGGHVTDSAENSSSSSLKYSSSLIVEAPGSIAAARREHVAIMQVQRKMKIAHYGRT  179

Query  562  KSAKYDGKVASGD  600
            KSAKY+GKV   D
Sbjct  180  KSAKYEGKVIPLD  192



>ref|XP_009798027.1| PREDICTED: uncharacterized protein LOC104244298 [Nicotiana sylvestris]
Length=403

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 98/190 (52%), Gaps = 33/190 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPN---------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaas  270
            MCSS+TKLQ +           VLQPN N + L E R+SLKK    A          +A 
Sbjct  1    MCSSKTKLQGSQQTISQINGRPVLQPNSNILPLFEHRNSLKKTPPKATSAPVLQRTNSAP  60

Query  271  ltttppaspKI-----------KSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllak  417
              T      KI           KSPRQPA+KR   DPN L SSAEK+ TPK ++      
Sbjct  61   PATNGSTKVKISVTTPPVSPKLKSPRQPAIKRGNIDPNVLTSSAEKILTPKGTANKAPTL  120

Query  418  ks-------------kkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGR  558
                                    +++++V+ PGSIAAARREQVA  QVQRKMKIAHYGR
Sbjct  121  LKKPKQSSGGITSPPSVENSLLKYSSSMIVEAPGSIAAARREQVATAQVQRKMKIAHYGR  180

Query  559  TKSAKYDGKV  588
            TKS KY+GKV
Sbjct  181  TKSGKYEGKV  190



>emb|CAN68394.1| hypothetical protein VITISV_042519 [Vitis vinifera]
Length=398

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 104/192 (54%), Gaps = 32/192 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPNV------------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS++KL    ++            LQP  NR+  LER  S KK S  +     P S  
Sbjct  1    MCSSKSKLHQGIDITPSKAQINGRPALQPTCNRIPSLERHHSFKKISPKSPTSPLPASLP  60

Query  262  aasltttpp---------aspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTP---------  387
              +               ASP +KSPRQPA+KR GNDPNGLNSS EKV TP         
Sbjct  61   PPTTIINTTKTKPSLTPPASPNLKSPRQPALKR-GNDPNGLNSSLEKVLTPRGTTKSSSS  119

Query  388  -kpssatllakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTK  564
             K +              +   +++ +V+ PGSIAAARREQ+AIMQVQRKM+IAHYGRTK
Sbjct  120  PKKTKKCSAGLAPSSDTSSLNYSSSFIVEAPGSIAAARREQMAIMQVQRKMRIAHYGRTK  179

Query  565  SAKYDGKVASGD  600
            SAKY+ K++  D
Sbjct  180  SAKYEEKISPVD  191



>ref|XP_002263612.1| PREDICTED: uncharacterized protein LOC100256507 [Vitis vinifera]
 emb|CBI27376.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 104/192 (54%), Gaps = 32/192 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPNV------------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS++KL    ++            LQP  NR+  LER  S KK S  +     P S  
Sbjct  1    MCSSKSKLHQGIDITPSKAQINGRPALQPTCNRIPSLERHHSFKKISPKSPTSPLPASPP  60

Query  262  aasltttpp---------aspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTP---------  387
              +               ASP +KSPRQPA+KR GNDPNGLNSS EKV TP         
Sbjct  61   PPTTIINTTKTKPSLTPPASPNLKSPRQPALKR-GNDPNGLNSSLEKVLTPRGTTKSSSS  119

Query  388  -kpssatllakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTK  564
             K +              +   +++++V+ PGSIAAARREQ+AIMQVQRKM+IAHYGRTK
Sbjct  120  PKKTKKCSAGLAPSSDTSSLNYSSSLIVEAPGSIAAARREQMAIMQVQRKMRIAHYGRTK  179

Query  565  SAKYDGKVASGD  600
            SAKY+ K+   D
Sbjct  180  SAKYEEKIGPVD  191



>ref|XP_010100595.1| Putative Glutamine amidotransferase [Morus notabilis]
 gb|EXB83232.1| Putative Glutamine amidotransferase [Morus notabilis]
Length=394

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 108/175 (62%), Gaps = 16/175 (9%)
 Frame = +1

Query  112  NIMCSSETKLQAAPNVLQPNRNRVSLLERRSSLKKpssaavlplppp------sraaasl  273
            N + S+E K+   P VLQP  NRVS LERR SLKK +  +    P        +      
Sbjct  13   NTITSAEPKINGRP-VLQPTCNRVSSLERRMSLKKTTPKSPTSPPLALPIQNGACKTKPS  71

Query  274  tttppaspKIKSPRQPAVKRSGNDPN-GLNSSAEKVSTPkpssatllakkskkgg-----  435
            T +PP SPK+ SPR PA+KR G DPN  LNSSAEKV TP+    +  + K  K       
Sbjct  72   TLSPPVSPKLPSPRPPAIKR-GKDPNYELNSSAEKVLTPRCIIKSTSSIKKSKKCGGAGV  130

Query  436  --gagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVAS  594
                   +++++V+ PGSIAAARREQVAIMQ QRK++IAHYGRTKSAK++GKV +
Sbjct  131  VAETLKNSSSLIVEAPGSIAAARREQVAIMQEQRKIRIAHYGRTKSAKFEGKVVA  185



>ref|XP_002299382.2| hypothetical protein POPTR_0001s12320g [Populus trichocarpa]
 gb|EEE84187.2| hypothetical protein POPTR_0001s12320g [Populus trichocarpa]
Length=373

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 98/190 (52%), Gaps = 56/190 (29%)
 Frame = +1

Query  118  MCSSETKLQAAPN-------------VLQPNRNRVSLLERRSSLKKpssaavlplppp--  252
            MCS + +L  + N             VLQP  N+V  LERR+SLKK S A      P   
Sbjct  1    MCSFKFRLHRSANNIATPIAKINGRPVLQPKSNQVPSLERRNSLKKNSPAKSPTQEPAAV  60

Query  253  --------------sraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPk  390
                          ++       +PP SPK+KSP  PAVKR GNDP+GLN+SAEKV TP 
Sbjct  61   PPIPLMQPAGNAAGTKTKQPSGLSPPISPKLKSPVLPAVKR-GNDPDGLNTSAEKVWTP-  118

Query  391  pssatllakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
                                     ++ PGSIAAARRE VA+MQ QRKM+IAHYGRTKSA
Sbjct  119  -------------------------LESPGSIAAARREHVAVMQEQRKMRIAHYGRTKSA  153

Query  571  KYDGKVASGD  600
            KY GKV   D
Sbjct  154  KYHGKVVPAD  163



>ref|XP_010260812.1| PREDICTED: uncharacterized protein LOC104599795 [Nelumbo nucifera]
Length=406

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 100/171 (58%), Gaps = 22/171 (13%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppasp-------KIKSPR  315
            VLQP  NRVS LERR SLKK S  +    PPP     +  TT            K KSPR
Sbjct  27   VLQPTCNRVSSLERRPSLKKISPKSPAAAPPPPPPPPTTATTGIKVSRSPPISPKSKSPR  86

Query  316  QPAVKRSGNDPNGLNSSAEKVSTPkps--------------satllakkskkgggagapa  453
             PA+KR GNDPNGLNSS +K +TP+ +              S++           +   +
Sbjct  87   PPALKR-GNDPNGLNSSVDKAATPRSTPKQAALVRKKSKNSSSSATGVAPSIDTCSLNYS  145

Query  454  aaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGDFS  606
            ++++V+ PGSIAAARREQV ++Q QRKM+IAHYGRTKSAK++GKV   D S
Sbjct  146  SSLIVEAPGSIAAARREQVTLIQAQRKMRIAHYGRTKSAKFEGKVVPLDSS  196



>ref|XP_002303720.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
 gb|EEE78699.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
Length=417

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 109/201 (54%), Gaps = 41/201 (20%)
 Frame = +1

Query  118  MCSSETKL-QAAPN------------VLQPNRNRVSLLERRSSLKKps------------  222
            MCSS+++L Q+  N            VLQP  N+V  LER +SLKK S            
Sbjct  1    MCSSKSRLNQSTSNIATTIAKINGRPVLQPKSNQVPSLERHNSLKKNSPPKSPTREPAGP  60

Query  223  ---saavlplpppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkp  393
                         ++       +PP SPK+KSPR PAVKR GN+P GLN+SAEKV TP+ 
Sbjct  61   PVPLMQPACNAAGTKTRLPSALSPPISPKLKSPRPPAVKR-GNEPGGLNTSAEKVLTPRS  119

Query  394  ssatllakk------------skkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKM  537
            ++    +                    A   +++++V+ PGSIAAARREQVA+MQ QRKM
Sbjct  120  TTKVTTSTVKKSKKSSTAGVPHSVDTFAMKYSSSLLVEAPGSIAAARREQVAVMQEQRKM  179

Query  538  KIAHYGRTKSAKYDGKVASGD  600
            +IAHYGRTKSAKY GK+   +
Sbjct  180  RIAHYGRTKSAKYQGKIVPAN  200



>ref|XP_002303719.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
 gb|EEE78698.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
Length=420

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 109/201 (54%), Gaps = 41/201 (20%)
 Frame = +1

Query  118  MCSSETKL-QAAPN------------VLQPNRNRVSLLERRSSLKKps------------  222
            MCSS+++L Q+  N            VLQP  N+V  LER +SLKK S            
Sbjct  1    MCSSKSRLNQSTSNIATTIAKINGRPVLQPKSNQVPSLERHNSLKKNSPPKSPTREPAGP  60

Query  223  ---saavlplpppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkp  393
                         ++       +PP SPK+KSPR PAVKR GN+P GLN+SAEKV TP+ 
Sbjct  61   PVPLMQPACNAAGTKTRLPSALSPPISPKLKSPRPPAVKR-GNEPGGLNTSAEKVLTPRS  119

Query  394  ssatllakk------------skkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKM  537
            ++    +                    A   +++++V+ PGSIAAARREQVA+MQ QRKM
Sbjct  120  TTKVTTSTVKKSKKSSTAGVPHSVDTFAMKYSSSLLVEAPGSIAAARREQVAVMQEQRKM  179

Query  538  KIAHYGRTKSAKYDGKVASGD  600
            +IAHYGRTKSAKY GK+   +
Sbjct  180  RIAHYGRTKSAKYQGKIVPAN  200



>ref|XP_008225940.1| PREDICTED: uncharacterized protein LOC103325537 [Prunus mume]
Length=390

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 110/195 (56%), Gaps = 33/195 (17%)
 Frame = +1

Query  118  MCSSETKLQ-------AAPN-----VLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ KLQ       + P      VLQP  N+   LE+R SLKK S   + P P PS  
Sbjct  1    MCSSKPKLQRTTSVPPSTPKMNRRPVLQPTGNQFPSLEQRKSLKKSSQEPLAPTPLPSPL  60

Query  262  aasltttppa---spKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatlla------  414
             ++ T    +   SPK+ SPR PA KR G DPN LNSSAEKV TP+ ++    +      
Sbjct  61   PSAKTKASFSPPISPKLPSPRPPAFKR-GKDPNELNSSAEKVVTPRCTTKFTSSVKKSKK  119

Query  415  -----kkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
                   +          ++++V+ PGSIAAARREQVA MQ QRKM+IAHYGRTKSAK +
Sbjct  120  SSGSVAAAPSAESILKNISSLIVEAPGSIAAARREQVATMQEQRKMRIAHYGRTKSAKNE  179

Query  580  GKV------ASGDFS  606
            GKV      A+ DFS
Sbjct  180  GKVIPLYASATTDFS  194



>ref|XP_007212311.1| hypothetical protein PRUPE_ppa006731mg [Prunus persica]
 gb|EMJ13510.1| hypothetical protein PRUPE_ppa006731mg [Prunus persica]
Length=397

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 107/189 (57%), Gaps = 27/189 (14%)
 Frame = +1

Query  118  MCSSETKLQ-------AAPN-----VLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ KLQ       + P      VLQP  N+   LE+R SLKK S   + P P PS  
Sbjct  1    MCSSKPKLQRTTSVPPSTPKMNRRPVLQPTGNQFPSLEQRKSLKKSSQEPLAPTPLPSPL  60

Query  262  aasltttppa---spKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatlla------  414
             ++ T    +   SPK+ SPR PA KR G DPN LNSSAEKV TP+ ++    +      
Sbjct  61   PSAKTKASLSPPISPKLPSPRPPAFKR-GKDPNELNSSAEKVVTPRCTTKFTSSVKKSKK  119

Query  415  -----kkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
                   +          ++++V+ PGSIAAARREQVA MQ QRKM+IAHYGRTKSAK +
Sbjct  120  SSGSVAAAPSAESILKNISSLIVEAPGSIAAARREQVATMQEQRKMRIAHYGRTKSAKNE  179

Query  580  GKVASGDFS  606
            GKV   D S
Sbjct  180  GKVVPLDAS  188



>ref|XP_011008217.1| PREDICTED: uncharacterized protein LOC105113658 [Populus euphratica]
Length=410

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 104/201 (52%), Gaps = 41/201 (20%)
 Frame = +1

Query  118  MCSSETKLQAAPN-------------VLQPNRNRVSLLERRSSLKKpssaavlpl-----  243
            MCS + +L  + N             VLQP  N+V  LERR+SLKK S A          
Sbjct  1    MCSFKFRLHRSANNIATPIAKINGRPVLQPKSNQVPSLERRNSLKKNSPAKSPTQEPAAV  60

Query  244  -----------pppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPk  390
                          ++       + P SPK+KSP  PAVKR GNDP+GLN+SAEKV  P+
Sbjct  61   PPIPLMQPAGNAAGTKTKQPSGLSLPISPKLKSPVPPAVKR-GNDPDGLNTSAEKVWIPR  119

Query  391  pssatllakkskkgggag-----------apaaaVMVDEPGSIAAARREQVAIMQVQRKM  537
             ++    +   K    +               ++++V+ PGSIAAAR+E VA+MQ QRKM
Sbjct  120  STTKVTASLVKKSTKSSTVGVPISVDPFAMKHSSLLVESPGSIAAARKEHVAVMQEQRKM  179

Query  538  KIAHYGRTKSAKYDGKVASGD  600
            +IAHYGRTKS KY GKV   D
Sbjct  180  RIAHYGRTKSMKYQGKVVPAD  200



>ref|XP_011022300.1| PREDICTED: uncharacterized protein LOC105124122 isoform X2 [Populus 
euphratica]
Length=417

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 105/201 (52%), Gaps = 41/201 (20%)
 Frame = +1

Query  118  MCSSETKL-QAAPN------------VLQPNRNRVSLLERRSSLKKps------------  222
            MCSS+++L Q+  N            VLQP  N+   LER +SLKK S            
Sbjct  1    MCSSKSRLSQSTSNIATTIAKINGRPVLQPKSNQFPTLERHNSLKKNSPPKSPTREPAEP  60

Query  223  ---saavlplpppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTP--  387
                         ++       +PP SPK+KSPR PAVKR GNDP  LN+SAEKV TP  
Sbjct  61   PVPLMQPACNAAGTKTRLPSALSPPISPKLKSPRPPAVKR-GNDPGRLNTSAEKVLTPRS  119

Query  388  ----------kpssatllakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKM  537
                      K   +            A   +++++++ PGSIAAARREQVA+MQ QRKM
Sbjct  120  TTKVTTSTVKKSKKSNTAGVPHSVDTFAMKYSSSLLLEAPGSIAAARREQVAVMQEQRKM  179

Query  538  KIAHYGRTKSAKYDGKVASGD  600
            +IAHYGRTKSAKY GK+   +
Sbjct  180  RIAHYGRTKSAKYQGKIVPAN  200



>ref|XP_011022299.1| PREDICTED: uncharacterized protein LOC105124122 isoform X1 [Populus 
euphratica]
Length=417

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 105/201 (52%), Gaps = 41/201 (20%)
 Frame = +1

Query  118  MCSSETKL-QAAPN------------VLQPNRNRVSLLERRSSLKKps------------  222
            MCSS+++L Q+  N            VLQP  N+   LER +SLKK S            
Sbjct  1    MCSSKSRLSQSTSNIATTIAKINGRPVLQPKSNQFPTLERHNSLKKNSPPKSPTREPAEP  60

Query  223  ---saavlplpppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTP--  387
                         ++       +PP SPK+KSPR PAVKR GNDP  LN+SAEKV TP  
Sbjct  61   PVPLMQPACNAAGTKTRLPSALSPPISPKLKSPRPPAVKR-GNDPGRLNTSAEKVLTPRS  119

Query  388  ----------kpssatllakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKM  537
                      K   +            A   +++++++ PGSIAAARREQVA+MQ QRKM
Sbjct  120  TTKVTTSTVKKSKKSNTAGVPHSVDTFAMKYSSSLLLEAPGSIAAARREQVAVMQEQRKM  179

Query  538  KIAHYGRTKSAKYDGKVASGD  600
            +IAHYGRTKSAKY GK+   +
Sbjct  180  RIAHYGRTKSAKYQGKIVPAN  200



>gb|KHN21364.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=396

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 105/179 (59%), Gaps = 27/179 (15%)
 Frame = +1

Query  118  MCSSETKLQAA-----PNV--------LQPNRNRVSLLERRSSLKKpssaavlplpppsr  258
            MCSS+TK+ A      P+V        LQP  NRV  LERR+S+KK +    L  P P  
Sbjct  1    MCSSKTKVTAVVAAAKPSVARINGRPVLQPTCNRVPNLERRNSIKKVAPPKSLSPPSPPL  60

Query  259  aaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatll---------  411
             + +  T P +  K+KSPR PA KR GND NGLNSS EK+  P+ S+ T           
Sbjct  61   PSKTSLTPPVSP-KLKSPRLPATKR-GNDNNGLNSSYEKIVIPRSSTKTPTLERKKSKSF  118

Query  412  ---akkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
               +  S     + + +++++ D PGSIAA RREQ+A+ Q QRKMKIAHYGR+KSAK++
Sbjct  119  KEGSCVSASIEASLSYSSSLITDSPGSIAAVRREQMALQQAQRKMKIAHYGRSKSAKFE  177



>ref|XP_008383248.1| PREDICTED: uncharacterized protein LOC103445971 [Malus domestica]
Length=388

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 103/188 (55%), Gaps = 26/188 (14%)
 Frame = +1

Query  118  MCSSETKLQAAPNV-------------LQPNRNRVSLLERRSSLKKpssaavlplpppsr  258
            MCSS+ KLQ + +V             LQP  N+   LE++ S KK S    +P P PS 
Sbjct  1    MCSSKPKLQRSVSVSAMSAKLINQRPVLQPTGNQFPSLEQKKSPKKSSQETNVPTPLPSP  60

Query  259  aaasltttppa---spKIKSPRQPAVKRSGNDPNGLNSSAEKV---------STPkpssa  402
               + T    +   SPK+ SPRQPA KR G DPN LNSSAEKV         ST     +
Sbjct  61   VPTTKTKASLSPPISPKLPSPRQPAFKR-GKDPNQLNSSAEKVVMTPRCATKSTNFLKKS  119

Query  403  tllakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDG  582
               +  +          ++++V+ PGSIA ARREQVA MQ QRKM+IAHYGR KSAKY+G
Sbjct  120  KKSSGVAPSAESVLKNISSLIVEAPGSIATARREQVATMQEQRKMRIAHYGRIKSAKYEG  179

Query  583  KVASGDFS  606
            KV   D S
Sbjct  180  KVVPLDSS  187



>ref|XP_003531474.1| PREDICTED: uncharacterized protein LOC100791725 [Glycine max]
Length=400

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 105/183 (57%), Gaps = 31/183 (17%)
 Frame = +1

Query  118  MCSSETKLQ---------AAPNV--------LQPNRNRVSLLERRSSLKKpssaavlplp  246
            MCSS+TK+          A P+V        LQP  NRV  LERR+S+KK +    L  P
Sbjct  1    MCSSKTKVTVGLEAVVAAAKPSVARINGRPVLQPTCNRVPNLERRNSIKKVAPPKSLSPP  60

Query  247  ppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatll-----  411
             P   + +  T P +  K+KSPR PA KR GND NGLNSS EK+  P+ S+ T       
Sbjct  61   SPPLPSKTSLTPPVSP-KLKSPRLPATKR-GNDNNGLNSSYEKIVIPRSSTKTPTLERKK  118

Query  412  -------akkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
                   +  S     + + +++++ D PGSIAA RREQ+A+ Q QRKMKIAHYGR+KSA
Sbjct  119  SKSFKEGSCVSASIEASLSYSSSLITDSPGSIAAVRREQMALQQAQRKMKIAHYGRSKSA  178

Query  571  KYD  579
            K++
Sbjct  179  KFE  181



>ref|XP_009368563.1| PREDICTED: titin-like [Pyrus x bretschneideri]
Length=389

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 103/188 (55%), Gaps = 26/188 (14%)
 Frame = +1

Query  118  MCSSETKLQAAPNV-------------LQPNRNRVSLLERRSSLKKpssaavlplpppsr  258
            MCSS+ KLQ + +V             LQP  N+   LE++ S KK S    +P P PS 
Sbjct  1    MCSSKPKLQRSVSVSAMSTKLFNQRPVLQPTGNQFPSLEQKKSPKKSSQEINVPTPLPSP  60

Query  259  aaasltttppa---spKIKSPRQPAVKRSGNDPNGLNSSAEKV---------STPkpssa  402
               + T    +   SPK+ SPRQPA KR G D N LNSSAEKV         ST     +
Sbjct  61   VPTTKTKPSLSPPISPKLPSPRQPAFKR-GKDHNQLNSSAEKVVMTPRCATKSTNLVKKS  119

Query  403  tllakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDG  582
               +  +          ++++V+ PGSIA ARREQVA MQ QRKM+IAHYGRTKSAKY+G
Sbjct  120  KKSSGVAPSAENVLKNVSSLIVEAPGSIATARREQVATMQEQRKMRIAHYGRTKSAKYEG  179

Query  583  KVASGDFS  606
            KV   D S
Sbjct  180  KVVPLDSS  187



>ref|XP_007149154.1| hypothetical protein PHAVU_005G045900g [Phaseolus vulgaris]
 gb|ESW21148.1| hypothetical protein PHAVU_005G045900g [Phaseolus vulgaris]
Length=405

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 93/153 (61%), Gaps = 14/153 (9%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LERR+S+KK      L  P P  ++ +  T P +  K KSPR PAVKR 
Sbjct  37   VLQPTCNRVPNLERRNSIKKVQPPKSLSPPSPPLSSKTSLTPPVSP-KSKSPRLPAVKR-  94

Query  337  GNDPNGLNSSAEKVSTPkpssatll------------akkskkgggagapaaaVMVDEPG  480
            GND NGLN+S EK++ PK SS                +        + + A++++ D PG
Sbjct  95   GNDNNGLNTSYEKIAIPKSSSKAPTLERKKSKSFKEGSCAPASTEASFSYASSLITDSPG  154

Query  481  SIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            SIAA RREQ+A+ Q QRKMKIAHYGR+KSAK++
Sbjct  155  SIAAVRREQMALQQAQRKMKIAHYGRSKSAKFE  187



>ref|XP_009363279.1| PREDICTED: uncharacterized protein LOC103953267 [Pyrus x bretschneideri]
Length=392

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 107/196 (55%), Gaps = 35/196 (18%)
 Frame = +1

Query  118  MCSSETKLQAAPNV-------------LQPNRNRVSLLERRSSLKKpssaavlplpppsr  258
            MCS++ KLQ + +V             LQP  N+   LE++ S KK S    +P P PS 
Sbjct  1    MCSAKPKLQRSVSVSATSGKLINRRPVLQPTGNQFPTLEQKKSPKKSSQETNVPTPLPSP  60

Query  259  aaasltttppasp------KIKSPRQPAVKRSGNDPNGLNSSAEKVS-TPkpssatllak  417
               + T    AS       K+ SPRQPA KR G DPN LNSSAEKV  TP+ ++ +  + 
Sbjct  61   LPTNKTKETKASLSPPISPKLPSPRQPAFKR-GKDPNELNSSAEKVVVTPRCATKSTSSV  119

Query  418  ksk--------kgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAK  573
            K                   ++++V+ PGSIAAARREQVA MQ QRKM+IAHYGR K AK
Sbjct  120  KKSKKSSGVAPSAESVLKNVSSLIVEAPGSIAAARREQVATMQEQRKMRIAHYGRAKFAK  179

Query  574  YDGKV------ASGDF  603
            Y+GKV      A+ DF
Sbjct  180  YEGKVVPLDSSATNDF  195



>ref|XP_004295546.1| PREDICTED: uncharacterized protein LOC101298985 [Fragaria vesca 
subsp. vesca]
Length=410

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 104/197 (53%), Gaps = 43/197 (22%)
 Frame = +1

Query  118  MCSSETK----LQAAP--------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ K    ++  P         VLQP  NRV  L+RR+SLKK S+    PLP  + +
Sbjct  1    MCSSKAKVTMGIEITPLVSRINGRPVLQPTCNRVPSLDRRNSLKKLSTPPPPPLPLSNAS  60

Query  262  aasltttppaspKI---------KSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatlla  414
            + S +        +         KSPR PA+KRSGNDPNGLNSS+EKV TP  ++   + 
Sbjct  61   STSTSPRISTKASLTTPPVSPKSKSPRPPAIKRSGNDPNGLNSSSEKVVTPGGTTRAKVL  120

Query  415  k----------------------kskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQ  528
            +                       S     + + +++++ + PG+IAA RREQ+A+   Q
Sbjct  121  ERKKSKSFKLGVGADNAHDHGRLSSASIEASLSYSSSLITEAPGTIAAGRREQMALQHAQ  180

Query  529  RKMKIAHYGRTKSAKYD  579
            RKM+IAHYGR+ SA ++
Sbjct  181  RKMRIAHYGRSNSANFE  197



>ref|XP_007022761.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY14286.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
Length=409

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 106/193 (55%), Gaps = 37/193 (19%)
 Frame = +1

Query  118  MCSSETKLQAAPN------------VLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS  K+ A               VLQP  NRV  L+RR+SLKK    +    P  +  
Sbjct  1    MCSSNAKVTAGVEITPAVARINGRPVLQPTCNRVPSLDRRNSLKKIPPLSPPTPPSLAST  60

Query  262  aasltttppa------------spKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssat  405
              + + T               SPK KSPR  A+KR G+DPN LN+S+EKV TP+  + T
Sbjct  61   LPATSATVGNGGRAKASLTPPISPKSKSPRPAAIKR-GSDPNALNTSSEKVMTPRNITKT  119

Query  406  llakkskkggg------------agapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAH  549
            L  KKSK                + + +++++V+ PGSIAA RREQ+A+ Q QRKMKIAH
Sbjct  120  LERKKSKSFKEGMGNGLSSWIEPSLSYSSSLIVEAPGSIAAVRREQMALQQAQRKMKIAH  179

Query  550  YGRTKSAKYDGKV  588
            YGR+KSAK++ KV
Sbjct  180  YGRSKSAKFESKV  192



>ref|XP_007022762.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY14287.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
Length=413

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 106/193 (55%), Gaps = 37/193 (19%)
 Frame = +1

Query  118  MCSSETKLQAAPN------------VLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS  K+ A               VLQP  NRV  L+RR+SLKK    +    P  +  
Sbjct  1    MCSSNAKVTAGVEITPAVARINGRPVLQPTCNRVPSLDRRNSLKKIPPLSPPTPPSLAST  60

Query  262  aasltttppa------------spKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssat  405
              + + T               SPK KSPR  A+KR G+DPN LN+S+EKV TP+  + T
Sbjct  61   LPATSATVGNGGRAKASLTPPISPKSKSPRPAAIKR-GSDPNALNTSSEKVMTPRNITKT  119

Query  406  llakkskkggg------------agapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAH  549
            L  KKSK                + + +++++V+ PGSIAA RREQ+A+ Q QRKMKIAH
Sbjct  120  LERKKSKSFKEGMGNGLSSWIEPSLSYSSSLIVEAPGSIAAVRREQMALQQAQRKMKIAH  179

Query  550  YGRTKSAKYDGKV  588
            YGR+KSAK++ KV
Sbjct  180  YGRSKSAKFESKV  192



>ref|XP_003546838.1| PREDICTED: uncharacterized protein LOC100811352 [Glycine max]
Length=400

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 93/153 (61%), Gaps = 14/153 (9%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LERR+S+KK + A  L  P P   + +  T P +  K KSPR PA KR 
Sbjct  36   VLQPTCNRVPNLERRNSIKKVAPAKSLSPPSPPLPSKTSLTPPVSP-KSKSPRLPATKR-  93

Query  337  GNDPNGLNSSAEKVSTPkpssatll------------akkskkgggagapaaaVMVDEPG  480
            GND NGLNSS EK+  P+ S  T              +  S     + + +++++ D PG
Sbjct  94   GNDNNGLNSSYEKIVIPRSSIKTPTLERKKSKSFKEGSCVSASIEASLSYSSSLITDSPG  153

Query  481  SIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            SIAA RREQ+A+ Q QRKMKIAHYGR+KSAK++
Sbjct  154  SIAAVRREQMALQQAQRKMKIAHYGRSKSAKFE  186



>gb|KHN48850.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=400

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 93/153 (61%), Gaps = 14/153 (9%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LERR+S+KK + A  L  P P   + +  T P +  K KSPR PA KR 
Sbjct  36   VLQPTCNRVPNLERRNSIKKVAPAKSLSPPSPPLPSKTSLTPPVSP-KSKSPRLPATKR-  93

Query  337  GNDPNGLNSSAEKVSTPkpssatll------------akkskkgggagapaaaVMVDEPG  480
            GND NGLNSS EK+  P+ S  T              +  S     + + +++++ D PG
Sbjct  94   GNDNNGLNSSYEKIVIPRSSIKTPTLERKKSKSFKEGSCVSASIEASLSYSSSLITDSPG  153

Query  481  SIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            SIAA RREQ+A+ Q QRKMKIAHYGR+KSAK++
Sbjct  154  SIAAVRREQMALQQAQRKMKIAHYGRSKSAKFE  186



>ref|XP_007133461.1| hypothetical protein PHAVU_011G180500g [Phaseolus vulgaris]
 gb|ESW05455.1| hypothetical protein PHAVU_011G180500g [Phaseolus vulgaris]
Length=392

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 98/175 (56%), Gaps = 21/175 (12%)
 Frame = +1

Query  130  ETKLQAAPNVLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKS  309
            E ++   P VLQP  NRV  LERR+S+KK S  +  P  PP     SLT       K +S
Sbjct  22   EARINGRP-VLQPTCNRVPNLERRNSIKKVSPKSPFPPSPPLPIKTSLTPPVSP--KSES  78

Query  310  PRQPAVKRSGNDPNGLNSSAEKVSTPkpss----------------atllakkskkggga  441
            PR P +KR GND NGLNSS+EK+ TP+ +                 +      S     +
Sbjct  79   PRPPPIKR-GNDSNGLNSSSEKIVTPRHTIKTPTLERKKSKSFKEGSCCTLVSSASIEAS  137

Query  442  gapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGDFS  606
             + ++ ++ + PGSIAA RREQ+A+   QRKMKIAHYGR+KSAK++ KV   D S
Sbjct  138  LSYSSTLITESPGSIAAVRREQMALQHAQRKMKIAHYGRSKSAKFE-KVVPLDIS  191



>ref|XP_008364234.1| PREDICTED: uncharacterized protein LOC103427927 [Malus domestica]
Length=389

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 103/188 (55%), Gaps = 26/188 (14%)
 Frame = +1

Query  118  MCSSETKLQAAPNV-------------LQPNRNRVSLLERRSSLKKpssaavlplpppsr  258
            MCS++ +LQ + +V             LQP  N+   LE++ S KK S     P P PS 
Sbjct  1    MCSAKPRLQRSVSVSATSGKLINRRPVLQPTGNQFPSLEQKKSPKKSSQETNXPTPLPSP  60

Query  259  aaasltttppa---spKIKSPRQPAVKRSGNDPNGLNSSAEKVS-TPkpssatllakksk  426
               + T    +   SPK+ SPRQ A K+ G DPN LNSSAEKV  TP+  + +  + K  
Sbjct  61   LPTNKTKASLSPPISPKLPSPRQHAFKQ-GKDPNELNSSAEKVVVTPRCVTKSTSSVKKS  119

Query  427  --------kgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDG  582
                             + ++V+ PGSIAA RREQVA MQ QRKM+IAHYGRTKSAKY+G
Sbjct  120  KKSIGVAPSAESVLKNISPLIVEAPGSIAATRREQVATMQEQRKMRIAHYGRTKSAKYEG  179

Query  583  KVASGDFS  606
            KV   D S
Sbjct  180  KVVPLDSS  187



>ref|XP_009368609.1| PREDICTED: uncharacterized protein LOC103958107 [Pyrus x bretschneideri]
Length=424

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 115/218 (53%), Gaps = 58/218 (27%)
 Frame = +1

Query  118  MCSSETK----LQAAP--------NVLQPNRNRVSLLERRSSLKK-----------pssa  228
            MCSS+ K    ++  P         VLQPN NRV  L+RR S+KK           P+S+
Sbjct  1    MCSSKAKVTLGIEVTPIVARINGRPVLQPNCNRVPSLDRRGSIKKISTPPPPPLPLPTSS  60

Query  229  avlplpppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpss---  399
            A +  P  +  AAS  +TPP SPK KSPR PA+KR GNDPNGLNSS+EKV TP  ++   
Sbjct  61   ASITSPRTTNKAASSLSTPPISPKSKSPRPPAIKR-GNDPNGLNSSSEKVVTPGGTTRAK  119

Query  400  ----------------------------atllakkskkgggagapaaaVMVDEPGSIAAA  495
                                               +     + + +++++ + PGSIAA 
Sbjct  120  ILERKKSKSFKSASVGVDVDAADHNHGGFGNGGFSASNIEASLSYSSSLITEAPGSIAAG  179

Query  496  RREQVAIMQVQRKMKIAHYGRTKSAKYDGKV---ASGD  600
            RREQ+A+   QRKM+IAHYGR+KSA ++G V   ASG+
Sbjct  180  RREQMALQHAQRKMRIAHYGRSKSANFEGVVPVDASGN  217



>ref|XP_009368625.1| PREDICTED: uncharacterized protein LOC103958120 [Pyrus x bretschneideri]
Length=424

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 109/218 (50%), Gaps = 58/218 (27%)
 Frame = +1

Query  118  MCSSETK----LQAAP--------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ K    ++  P         VLQPN NRV  L+RR S+KK S+    PLP P+ +
Sbjct  1    MCSSKAKVTLGIEVTPIVARINGRPVLQPNCNRVPSLDRRGSIKKISTPPPPPLPLPTSS  60

Query  262  aasltttppasp-----------KIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpss---  399
            A+  +                  K KSPR PA+KR GNDPNGLNSS+EKV TP  ++   
Sbjct  61   ASITSPRTTNKAASSLLTPPISPKSKSPRPPAIKR-GNDPNGLNSSSEKVVTPGGTTRAK  119

Query  400  ----------------------------atllakkskkgggagapaaaVMVDEPGSIAAA  495
                                               +     + + +++++ + PGSIAA 
Sbjct  120  ILERKKSKSFKRASVGVDVDAADHNHGGFGNGGFSASNIEASLSYSSSLITEAPGSIAAG  179

Query  496  RREQVAIMQVQRKMKIAHYGRTKSAKYDGKV---ASGD  600
            RREQ+A+   QRKM+IAHYGR+KSA ++G V   ASG+
Sbjct  180  RREQMALQHAQRKMRIAHYGRSKSANFEGVVPVDASGN  217



>ref|XP_012092185.1| PREDICTED: uncharacterized protein LOC105649949 [Jatropha curcas]
 gb|KDP44662.1| hypothetical protein JCGZ_19698 [Jatropha curcas]
Length=381

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 100/188 (53%), Gaps = 37/188 (20%)
 Frame = +1

Query  118  MCSSETKL----QAAPNV--------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ K+    + +P V        LQP  NRV  LER +SLKK  S +  P      +
Sbjct  1    MCSSKAKVTTGVEMSPTVAKINGRPVLQPTCNRVPTLERLNSLKKIPSKSPPPPLTAPSS  60

Query  262  aasltttppaspKIKSPRQPAVKRSGNDPNGLNSSA-EKVSTPkpssat-----------  405
                        K KSPR PA+KR G+DPNGLNSS+ EK+  P+ +              
Sbjct  61   P-----------KSKSPRPPAIKR-GSDPNGLNSSSDEKILIPRNTIKAPSLDRKKSKSF  108

Query  406  -llakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDG  582
               +  S     + +  ++++V+ PGSIAA RREQ+A    QRKM+IAHYGR+KSAK++ 
Sbjct  109  KESSYSSTSVEASLSYPSSLIVEAPGSIAAVRREQMAFQHAQRKMRIAHYGRSKSAKFEP  168

Query  583  KVASGDFS  606
            K A  D S
Sbjct  169  KFAPIDSS  176



>ref|XP_002312220.1| methyladenine glycosylase family protein [Populus trichocarpa]
 gb|ABK95238.1| unknown [Populus trichocarpa]
 gb|EEE89587.1| methyladenine glycosylase family protein [Populus trichocarpa]
Length=403

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 98/166 (59%), Gaps = 19/166 (11%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttpp--aspKIKSPRQPAVK  330
            VLQP  N VS LERR+SLKK +  +  P PPP    ++ T       SP  KSPR PA+K
Sbjct  26   VLQPTCNLVSTLERRNSLKKTAPKSSPPPPPPPPTFSNKTNKASPPLSPMSKSPRLPAIK  85

Query  331  RSGNDPNGLNSSAEKVSTPkpssatllak----------------kskkgggagapaaaV  462
            R G+D N LNSS+EKV  P+ ++ T   +                 S     + + ++++
Sbjct  86   R-GSDANSLNSSSEKVVIPRNTTKTPTLERKKSKSFKESSVGRGVHSSFIEASLSYSSSL  144

Query  463  MVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            +V+ PGSIAA RREQ+A+   QRKM+IAHYGR+KSA+++ +V   D
Sbjct  145  IVEAPGSIAAVRREQMALQHAQRKMRIAHYGRSKSARFEDQVVPND  190



>ref|XP_009785679.1| PREDICTED: uncharacterized protein LOC104233914 [Nicotiana sylvestris]
Length=366

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 81/150 (54%), Gaps = 15/150 (10%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            V QP  NR  LLER +SLKK  S         +  +    +         SP  P +KR 
Sbjct  28   VFQPYSNRDPLLERHNSLKKSPSKTSPIATTHTSPSKIKISATT------SPISPKIKRV  81

Query  337  GNDPNGLNSSAEKVSTPkpssatllakkskkgggagapaaaVMVDEPGSIAAARREQVAI  516
             +D N LN S EK+ TPK ++ +    K+             +++ PGSIAAARREQVA+
Sbjct  82   -SDSNILNISTEKIVTPKSNAKSTKYVKNSSFFS--------ILEVPGSIAAARREQVAM  132

Query  517  MQVQRKMKIAHYGRTKSAKYDGKVASGDFS  606
            MQVQRKMK AHYGRT SAKY+ +V   D S
Sbjct  133  MQVQRKMKTAHYGRTNSAKYENRVTPLDSS  162



>ref|XP_004293832.1| PREDICTED: uncharacterized protein LOC101310385 [Fragaria vesca 
subsp. vesca]
Length=376

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 108/188 (57%), Gaps = 26/188 (14%)
 Frame = +1

Query  118  MCSSETKLQAAPNV------------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ +LQ +P+V            LQP  N+   LE R  LKK +  +++P P  S  
Sbjct  1    MCSSKPRLQQSPSVTPTTPKTNPRLVLQPTDNQFPSLEHRKFLKKANHESLIPPPLLSPL  60

Query  262  aasltt---tppaspKIKSPRQPAVKRSGNDPNGLNSSAEK-VSTPkpssatllakk---  420
             A  T    +PP SPKI SPRQPA+KR G + N LNSS EK V TPK +     + K   
Sbjct  61   PAPKTKPTISPPISPKIPSPRQPALKR-GKEHNELNSSLEKLVLTPKSTIKLTSSVKKSK  119

Query  421  ------skkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDG  582
                  +          ++++V+ PGSIAAARREQVA MQ QRK++IAHYGRT SAK++G
Sbjct  120  RSSVSGAASAENVMKNISSLIVEAPGSIAAARREQVATMQEQRKLRIAHYGRTNSAKFEG  179

Query  583  KVASGDFS  606
            KV   D S
Sbjct  180  KVVPLDSS  187



>ref|XP_011012959.1| PREDICTED: uncharacterized protein LOC105117079 [Populus euphratica]
Length=402

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 96/167 (57%), Gaps = 18/167 (11%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKI-KSPRQPAVKR  333
            VLQP  N VS LERR+SLKK +  +  P PPP   +       P    + KSPR PA+KR
Sbjct  26   VLQPTCNLVSTLERRNSLKKRAPKSPPPPPPPPTFSNKTNKASPPLSPMSKSPRLPAIKR  85

Query  334  SGNDPNGLNSSAEKVSTPkpssatllak----------------kskkgggagapaaaVM  465
             G+D N LNSS+EKV  P+ ++ T   +                 S     + + +++ +
Sbjct  86   -GSDANSLNSSSEKVVIPRNTTKTPTLERKKSKSFKESSVGRGVHSSFIEASLSYSSSSI  144

Query  466  VDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGDFS  606
            V+ PGSIAA RREQ+A+   QRKM+IAHYGR+KSA+++ +V   D S
Sbjct  145  VEAPGSIAAVRREQMALQHAQRKMRIAHYGRSKSARFEDQVVPNDSS  191



>ref|XP_002315089.2| methyladenine glycosylase family protein [Populus trichocarpa]
 gb|EEF01260.2| methyladenine glycosylase family protein [Populus trichocarpa]
Length=411

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 33/195 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPN------------VLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS  K+                 VLQP  NRV  LER +SLKK +  +  P PPP   
Sbjct  1    MCSSNAKVTTGVEITPAVARINGRPVLQPTCNRVPTLERHNSLKKTAPKSPPPPPPPLPP  60

Query  262  aasltttppasp----KIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssat--------  405
              S   T  ASP    K KSPR PA+KR G+D N LNSS++KV  P+ ++ T        
Sbjct  61   PTSANKTNKASPPLSPKSKSPRLPAIKR-GSDANSLNSSSDKVVIPRSTAKTPILERKKS  119

Query  406  --------llakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRT  561
                         S     + + +++++V+ PGSIAA RREQ+A+   QRKM+IAHYGR+
Sbjct  120  KSFKETSVGSGALSSSIEASLSYSSSLIVEAPGSIAAVRREQMALQHAQRKMRIAHYGRS  179

Query  562  KSAKYDGKVASGDFS  606
            KS++++ KV   D S
Sbjct  180  KSSRFEAKVVPVDSS  194



>ref|XP_008383216.1| PREDICTED: uncharacterized protein LOC103445940 [Malus domestica]
Length=424

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 104/208 (50%), Gaps = 55/208 (26%)
 Frame = +1

Query  118  MCSSETK----LQAAP--------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ K    ++ AP         VLQPN NRV  L+RR S+KK S+ +  PLP P+ +
Sbjct  1    MCSSKAKVTLGIEVAPIVAGINGRPVLQPNCNRVPSLDRRGSIKKISTPSPPPLPLPTSS  60

Query  262  aasltttppasp-----------KIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpss---  399
            A+  +                  K KSPR PA+KR GNDPNGLNSS+EKV TP  ++   
Sbjct  61   ASITSPRTTNKAASSLLTPPISPKSKSPRPPAIKR-GNDPNGLNSSSEKVVTPGGTTRAK  119

Query  400  ----------------------------atllakkskkgggagapaaaVMVDEPGSIAAA  495
                                               +     + + +++++ + PGSIAA 
Sbjct  120  ILERKKSKSFKRASVGVDVDAADHNHGGFGNGGFSASNIEASLSYSSSLITEAPGSIAAG  179

Query  496  RREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            RREQ+A+   QRKMKIAHYGR+KSA  +
Sbjct  180  RREQMALQHAQRKMKIAHYGRSKSANLE  207



>ref|XP_002515807.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
 gb|EEF46588.1| DNA-3-methyladenine glycosylase, putative, partial [Ricinus communis]
Length=404

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 101/189 (53%), Gaps = 35/189 (19%)
 Frame = +1

Query  118  MCSSETK----LQAAPNV--------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCS++TK    ++  P V        LQP  N V   ++RSS KK S     P PPPS  
Sbjct  7    MCSTKTKVVIGMEITPAVARINGRPVLQPTCNHVPTPDKRSSFKKMSLNCPPPPPPPSSP  66

Query  262  aasltttppasp---KIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkg  432
             +S       +P   K KSPR PA+KR G+DPNGLN+S+EKV  P  +S T   ++ K  
Sbjct  67   PSSTFDDKTTTPVSPKSKSPRPPAIKR-GSDPNGLNASSEKVVIPSNNSRTPRLERKKSK  125

Query  433  ggagap-------------------aaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYG  555
                                     +++++V+ PGSIAA RREQ+A    QRKM+IAHYG
Sbjct  126  SFKETSAGTGLFSSSASSAEASLHYSSSLIVESPGSIAAVRREQMAFQHAQRKMRIAHYG  185

Query  556  RTKSAKYDG  582
            R+KSAK++ 
Sbjct  186  RSKSAKFEA  194



>gb|KJB14126.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
Length=265

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 21/169 (12%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppas-----pKIKSPRQP  321
            VLQP  NRV  L+RR+SLKK    +  P        ++ +TT  A+       +  P  P
Sbjct  30   VLQPTCNRVPSLDRRNSLKKIPPISPPPPASLPFTPSATSTTTVANGSRARASLTLPLSP  89

Query  322  AVKRS---GNDPNGLNSSAEKVSTPkpssatllakkskkggg-------------agapa  453
            + K +   G+DPN LNSS+EKV+ P+ ++ TL  KKSK                 + + +
Sbjct  90   SSKFTTKRGSDPNALNSSSEKVAIPRNTTKTLDRKKSKSFKEGMGNNGLSSYIEPSLSYS  149

Query  454  aaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            ++++V+ PGSIAA RREQVA+ Q QRKMKIAHYGR+KSAK++ KV   D
Sbjct  150  SSLLVEAPGSIAAVRREQVALQQAQRKMKIAHYGRSKSAKFESKVVPLD  198



>gb|KJB14125.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
Length=326

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 21/169 (12%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppas-----pKIKSPRQP  321
            VLQP  NRV  L+RR+SLKK    +  P        ++ +TT  A+       +  P  P
Sbjct  30   VLQPTCNRVPSLDRRNSLKKIPPISPPPPASLPFTPSATSTTTVANGSRARASLTLPLSP  89

Query  322  AVKRS---GNDPNGLNSSAEKVSTPkpssatllakkskkggg-------------agapa  453
            + K +   G+DPN LNSS+EKV+ P+ ++ TL  KKSK                 + + +
Sbjct  90   SSKFTTKRGSDPNALNSSSEKVAIPRNTTKTLDRKKSKSFKEGMGNNGLSSYIEPSLSYS  149

Query  454  aaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            ++++V+ PGSIAA RREQVA+ Q QRKMKIAHYGR+KSAK++ KV   D
Sbjct  150  SSLLVEAPGSIAAVRREQVALQQAQRKMKIAHYGRSKSAKFESKVVPLD  198



>ref|XP_007040982.1| DNA glycosylase superfamily protein, putative [Theobroma cacao]
 gb|EOX96813.1| DNA glycosylase superfamily protein, putative [Theobroma cacao]
Length=398

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 100/191 (52%), Gaps = 29/191 (15%)
 Frame = +1

Query  118  MCSSETKLQAAPN------------VLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MC S+ KL    N            VLQP  N+++  ++R+SLKK SS +     P   +
Sbjct  1    MCCSKFKLHKDSNIASTVAEINGRPVLQPPSNQITSSDKRNSLKKISSNSPALSAPLQLS  60

Query  262  aasltttppaspKI------KSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakk-  420
             +         P +      KSPR  A+KR G D N LNSS+EKV  P+ +       K 
Sbjct  61   NSRARAVKATMPSLSPPISPKSPRPTALKR-GKDSNELNSSSEKVIAPRCNVKLDSKVKK  119

Query  421  ---------skkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAK  573
                     +     A   ++ ++++ PGSIAAARREQVA++Q QRKM+IAHYGRTKSAK
Sbjct  120  PKNASGGGVALTSVDAKYSSSFMVLEAPGSIAAARREQVAMIQEQRKMRIAHYGRTKSAK  179

Query  574  YDGKVASGDFS  606
            Y+ K+   D S
Sbjct  180  YERKMVGLDSS  190



>ref|XP_009592127.1| PREDICTED: uncharacterized protein LOC104089024 [Nicotiana tomentosiformis]
Length=373

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 90/178 (51%), Gaps = 27/178 (15%)
 Frame = +1

Query  118  MCSSETKLQ-----AAPN---------VLQPNRNRVSLLERRSSLKKpssaavlplppps  255
            MCSS++K Q      +P          V QP  NR  LLER + LK   S         +
Sbjct  1    MCSSKSKQQRGIVDISPQTISHINGRPVFQPYSNRDPLLERHNFLKNSPSKTSPTATTHT  60

Query  256  raaasltttppaspKIKS---PRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakksk  426
                    +     KI +   P  P +KR G D N LN + EK+ TPK ++ +    K+ 
Sbjct  61   YVKIKNNNSIVKV-KISATTPPISPKIKRVG-DSNILNINTEKIVTPKSNAKSTKYVKNS  118

Query  427  kgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
                        +++ PGSIAAARREQVA+MQVQRKMK AHYGRT SAKY+ +V+  D
Sbjct  119  SSFK--------ILEVPGSIAAARREQVAMMQVQRKMKTAHYGRTNSAKYENRVSPLD  168



>gb|KJB14128.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
Length=404

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 21/169 (12%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppas-----pKIKSPRQP  321
            VLQP  NRV  L+RR+SLKK    +  P        ++ +TT  A+       +  P  P
Sbjct  30   VLQPTCNRVPSLDRRNSLKKIPPISPPPPASLPFTPSATSTTTVANGSRARASLTLPLSP  89

Query  322  AVKRS---GNDPNGLNSSAEKVSTPkpssatllakkskkggg-------------agapa  453
            + K +   G+DPN LNSS+EKV+ P+ ++ TL  KKSK                 + + +
Sbjct  90   SSKFTTKRGSDPNALNSSSEKVAIPRNTTKTLDRKKSKSFKEGMGNNGLSSYIEPSLSYS  149

Query  454  aaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            ++++V+ PGSIAA RREQVA+ Q QRKMKIAHYGR+KSAK++ KV   D
Sbjct  150  SSLLVEAPGSIAAVRREQVALQQAQRKMKIAHYGRSKSAKFESKVVPLD  198



>gb|KJB14124.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
 gb|KJB14127.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
 gb|KJB14129.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
Length=406

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 21/169 (12%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppas-----pKIKSPRQP  321
            VLQP  NRV  L+RR+SLKK    +  P        ++ +TT  A+       +  P  P
Sbjct  30   VLQPTCNRVPSLDRRNSLKKIPPISPPPPASLPFTPSATSTTTVANGSRARASLTLPLSP  89

Query  322  AVKRS---GNDPNGLNSSAEKVSTPkpssatllakkskkggg-------------agapa  453
            + K +   G+DPN LNSS+EKV+ P+ ++ TL  KKSK                 + + +
Sbjct  90   SSKFTTKRGSDPNALNSSSEKVAIPRNTTKTLDRKKSKSFKEGMGNNGLSSYIEPSLSYS  149

Query  454  aaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            ++++V+ PGSIAA RREQVA+ Q QRKMKIAHYGR+KSAK++ KV   D
Sbjct  150  SSLLVEAPGSIAAVRREQVALQQAQRKMKIAHYGRSKSAKFESKVVPLD  198



>ref|XP_010670018.1| PREDICTED: uncharacterized protein LOC104887122 [Beta vulgaris 
subsp. vulgaris]
Length=404

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 96/167 (57%), Gaps = 23/167 (14%)
 Frame = +1

Query  157  VLQPNRNRV-SLLERRSSLKKpssaavlplpppsraaas--ltttppaspKIKSPRQPAV  327
            VLQP  NRV + LERR+SLKK +     P  P + A  +  L  T P SPK++SPR PA+
Sbjct  26   VLQPTCNRVPTPLERRNSLKKITPPPPPPPVPRTAAKGAKPLAATSPTSPKLRSPRPPAI  85

Query  328  KRSGNDPNGLNSSAEKVSTPkpssatllakkskkgggagapaaaV---------------  462
            KR GN+ NGLNSS++K++ P P      +  S +   +    A +               
Sbjct  86   KR-GNENNGLNSSSDKINLPNPKIMLTRSVSSLERKKSKNNLAVIDHLAIDPSLLLGYSY  144

Query  463  ----MVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVA  591
                + + PGSIAA RREQ+A+   QRK+KIAHYGR+KSAK+  KV+
Sbjct  145  SSSLITESPGSIAAGRREQMALQNAQRKLKIAHYGRSKSAKFVSKVS  191



>gb|KEH38202.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=316

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 88/153 (58%), Gaps = 13/153 (8%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplp--ppsraaasltttppaspKIKSPRQPAVK  330
            VLQP  N V  LERR+S+KK +  ++ PLP    +  ++      P      S R  A+K
Sbjct  29   VLQPTCNHVPNLERRNSIKKSTPKSLSPLPLPNKTNTSSLTPPISPKPKSPTSTRPLAIK  88

Query  331  RSGNDPNGLNSSAEKVSTPkpssatllakkskkgggag----------apaaaVMVDEPG  480
            R GND NGLN S EK+S PK    T   ++ K                + +++++ D PG
Sbjct  89   R-GNDNNGLNLSCEKISIPKNIMKTPTLERKKSKSFKEGSFGIEAASLSYSSSLITDSPG  147

Query  481  SIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            SIAA RREQVA+ Q QRKMKIAHYGR+KSAK++
Sbjct  148  SIAAVRREQVALQQAQRKMKIAHYGRSKSAKFE  180



>ref|XP_012075493.1| PREDICTED: uncharacterized protein LOC105636759 [Jatropha curcas]
 gb|KDP35084.1| hypothetical protein JCGZ_10993 [Jatropha curcas]
Length=400

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 101/190 (53%), Gaps = 30/190 (16%)
 Frame = +1

Query  118  MCSSET-KLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaas  270
            MCSS++ KLQ            VLQP  N+V  LER++SLKK ++ +  P PP      +
Sbjct  1    MCSSKSSKLQQQATIAKINGRPVLQPKSNQVPSLERKNSLKKTTAKSSPPPPPLLPLPTT  60

Query  271  ltttppasp----------KIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakk  420
               +   +           K+KSPR PA+K+ GN  N L+SS+EKV TP+  +       
Sbjct  61   PKASTIKTKPPSFSPPISPKLKSPRLPALKQ-GNVSNALSSSSEKVLTPRNVTKVSSTSV  119

Query  421  skkggg---------agapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRT-KSA  570
            +K                 +++++++ PGSIAAARREQVA MQ QRK KIAHYGR  KS 
Sbjct  120  NKSKKLPTKPIDQNIVYYYSSSLILEAPGSIAAARREQVATMQEQRKHKIAHYGRVIKST  179

Query  571  KYDGKVASGD  600
            K + KV   D
Sbjct  180  KSEAKVVPLD  189



>ref|XP_011014375.1| PREDICTED: uncharacterized protein LOC105118177 [Populus euphratica]
Length=406

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 102/197 (52%), Gaps = 35/197 (18%)
 Frame = +1

Query  118  MCSSETKL----QAAPNV--------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS  K+    +  P V        LQP  NRV  LER +SLKK +  +  P PPP   
Sbjct  1    MCSSNAKVTTGVETTPAVARINGRPVLQPTCNRVPPLERHNSLKKTALKSPPPPPPPPPL  60

Query  262  aasltttppasp------KIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakks  423
                +             K KSPR PA+KR G+D N LNSS++KV  P+ ++ T + ++ 
Sbjct  61   PLPTSANKTNKASPPLSPKSKSPRLPAIKR-GSDVNSLNSSSDKVVIPRSTTKTPILERK  119

Query  424  kkgggagap----------------aaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYG  555
            K                        +++++V+ PGSIAA RREQ+A+   QRKM+IAHYG
Sbjct  120  KSKSFKETSVGSGALSSSIEASSSYSSSLIVEAPGSIAAVRREQMALQHAQRKMRIAHYG  179

Query  556  RTKSAKYDGKVASGDFS  606
            R+KS++++ K    D S
Sbjct  180  RSKSSRFEAKAVPVDSS  196



>ref|XP_003595924.1| DNA-3-methyladenine glycosylase [Medicago truncatula]
 gb|AES66175.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=390

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 88/153 (58%), Gaps = 13/153 (8%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpp--psraaasltttppaspKIKSPRQPAVK  330
            VLQP  N V  LERR+S+KK +  ++ PLP    +  ++      P      S R  A+K
Sbjct  29   VLQPTCNHVPNLERRNSIKKSTPKSLSPLPLPNKTNTSSLTPPISPKPKSPTSTRPLAIK  88

Query  331  RSGNDPNGLNSSAEKVSTPkpssatllakkskkgggag----------apaaaVMVDEPG  480
            R GND NGLN S EK+S PK    T   ++ K                + +++++ D PG
Sbjct  89   R-GNDNNGLNLSCEKISIPKNIMKTPTLERKKSKSFKEGSFGIEAASLSYSSSLITDSPG  147

Query  481  SIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            SIAA RREQVA+ Q QRKMKIAHYGR+KSAK++
Sbjct  148  SIAAVRREQVALQQAQRKMKIAHYGRSKSAKFE  180



>gb|AFK37052.1| unknown [Medicago truncatula]
Length=390

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 97/181 (54%), Gaps = 28/181 (15%)
 Frame = +1

Query  118  MCSSETK-------LQAAPNV--------LQPNRNRVSLLERRSSLKKpssaavlplpp-  249
            MCSS+ K          AP+V        LQP  N V  LERR+S+KK +  ++ PLP  
Sbjct  1    MCSSKAKEVTVGIESSTAPHVARINGRPVLQPTCNHVPNLERRNSIKKSTPKSLSPLPLP  60

Query  250  -psraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakksk  426
              +  ++      P      S R  A+KR GND NGLN S EK+S PK    T   ++ K
Sbjct  61   NKTNTSSLTPPISPKPKSPTSTRPLAIKR-GNDNNGLNLSCEKISIPKNIMKTPTLERKK  119

Query  427  kgggag----------apaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKY  576
                            + +++++ D PGSIAA RREQVA+ Q QRKMKIAHYGR+KSAK+
Sbjct  120  SKSFKEGSFGIEAASLSYSSSLITDSPGSIAAVRREQVALQQAQRKMKIAHYGRSKSAKF  179

Query  577  D  579
            +
Sbjct  180  E  180



>ref|XP_008465610.1| PREDICTED: uncharacterized protein LOC103503249 [Cucumis melo]
Length=252

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 93/180 (52%), Gaps = 36/180 (20%)
 Frame = +1

Query  118  MCSSETKLQAAP----------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsraaa  267
            MC SE  L+A             VLQP  NRV  L+RR+SLKK   +   P P  + +  
Sbjct  1    MCRSEEALEATSVVVDSKFNSRPVLQPTCNRV--LDRRNSLKKQHPSLKPPSPAAAVSPT  58

Query  268  sltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkggg---  438
            S         K KSPR PA KR+ +  N +NSS+EK+  P  +S        KK      
Sbjct  59   SP--------KSKSPRPPATKRANDGNNPMNSSSEKILIPAAASRPRATLDRKKSKSFKL  110

Query  439  -------------agapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
                           A A++++ + PGSIAA RREQVA+ Q QRKM+IAHYGR+KSA+++
Sbjct  111  GGNGNVICDNGGFEVAYASSLITESPGSIAAVRREQVALQQAQRKMRIAHYGRSKSARFE  170



>ref|XP_002530111.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
 gb|EEF32255.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
Length=403

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 102/185 (55%), Gaps = 25/185 (14%)
 Frame = +1

Query  115  IMCSSETKLQAAPNVLQPNRNRVSLLERRSSLKKps-----------saavlplpppsra  261
            I  S+  K+   P VLQP  ++V  LERR+SLKK S              +LP     + 
Sbjct  21   IPASTIAKINGRP-VLQPKSDQVPTLERRNSLKKNSPKSPIIQPPAAPLPLLPTTTTIKP  79

Query  262  aasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakks------  423
                + +PP SPK+KSPR PA+KR GND N LNSSAEK  TP+ + +T L K        
Sbjct  80   KQPSSLSPPISPKLKSPRPPALKR-GNDLNTLNSSAEKFLTPRKAVSTTLKKSKKSSPAT  138

Query  424  ---kkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKS---AKYDGK  585
                +       +++++V+ PGSIAAARRE VA MQ QRK++ AHYGR  S   +K D K
Sbjct  139  PVVAETCTVLNYSSSLIVEAPGSIAAARREHVATMQEQRKLRTAHYGRVNSGSKSKRDAK  198

Query  586  VASGD  600
            +   D
Sbjct  199  IVPVD  203



>ref|XP_004517238.1| PREDICTED: uncharacterized protein LOC101500749 [Cicer arietinum]
Length=302

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 93/185 (50%), Gaps = 38/185 (21%)
 Frame = +1

Query  118  MCSSETK----LQAAPN-------------VLQPN-RNRVSLLERRSSLKKpssaavlpl  243
            MCSS+TK    ++++ N             VLQPN  N V  LERR+S+KK +       
Sbjct  1    MCSSKTKVTVVIESSINTTTPPISRINGRPVLQPNCNNHVPNLERRNSIKKITPPPKSLS  60

Query  244  pppsraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakks  423
            PPP     + +        +  P  P   + GND N LN S EK+  PK  +        
Sbjct  61   PPPLPNKTTSSI-------LTPPISPIATKRGNDNNALNLSYEKIVIPKNITMKSSPSLE  113

Query  424  kkggga-------------gapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTK  564
            +K   +              +  ++++ + PGSIAA RREQVA+MQ QRKMKIAHYGR+K
Sbjct  114  RKKSKSFKEGSIGVVVEGSLSYCSSLITESPGSIAAGRREQVALMQAQRKMKIAHYGRSK  173

Query  565  SAKYD  579
            SAK++
Sbjct  174  SAKFE  178



>ref|XP_007211731.1| hypothetical protein PRUPE_ppa006139mg [Prunus persica]
 gb|EMJ12930.1| hypothetical protein PRUPE_ppa006139mg [Prunus persica]
Length=426

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 106/210 (50%), Gaps = 57/210 (27%)
 Frame = +1

Query  118  MCSSETKL----QAAPNV--------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ K+    +  P V        LQP  NRV  L+RR+S+KK S+    P PP   +
Sbjct  1    MCSSKAKVTIGVEVTPMVARINGRPVLQPTCNRVPSLDRRNSIKKISTPRAPPPPPLPTS  60

Query  262  aasltttppasp-----------KIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpss---  399
            +AS T+   ++            K KSPR PA+KR GNDPNGLNSS+EKV TP  ++   
Sbjct  61   SASSTSPRISNKASSLLTPPISPKSKSPRPPAIKR-GNDPNGLNSSSEKVVTPGGTTRAK  119

Query  400  ------------------------------atllakkskkgggagapaaaVMVDEPGSIA  489
                                          +      S     + + +++++ + PGSIA
Sbjct  120  ILERKKSKSFKRASVGVDGASADLHHHGDFSAGGFSSSLNIEASLSYSSSLITEAPGSIA  179

Query  490  AARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            A RREQ+A+   QRKM+IAHYGR+KSA ++
Sbjct  180  AVRREQMALQHAQRKMRIAHYGRSKSANFE  209



>gb|KEH19325.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=323

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 86/146 (59%), Gaps = 7/146 (5%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LERR+S+KK    ++     P     + +T P +  K+KSPR PA KR 
Sbjct  30   VLQPTCNRVPNLERRNSIKKLPPKSLSLPSSPPLPTKTSSTPPLSP-KLKSPRPPATKRV  88

Query  337  GNDPNGLNSSAEKV-----STPkpssatllakkskkgggagapaaaVMVDEPGSIAAARR  501
             N+   LN+S+EK+     ST   +     + K      + + ++ ++ D PGSIA  RR
Sbjct  89   -NETYLLNTSSEKIVIPRNSTKISTIKKSKSFKEGSTEASLSYSSNLITDSPGSIAGLRR  147

Query  502  EQVAIMQVQRKMKIAHYGRTKSAKYD  579
            EQ+A+   QRKMKIAHYGR+KSAK++
Sbjct  148  EQMALQNAQRKMKIAHYGRSKSAKFE  173



>gb|KHG21574.1| putative GMP synthase [glutamine-hydrolyzing] [Gossypium arboreum]
Length=360

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 96/166 (58%), Gaps = 22/166 (13%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppa-----spKIKSPRQP  321
            VLQP  NRV  L+RR+SLKK    +  P        ++ +TT  A        +  P  P
Sbjct  30   VLQPTCNRVPSLDRRNSLKKIPPISPPPPASLPFTPSATSTTTVANGSRAKASLTPPLSP  89

Query  322  AVKRS----GNDPNGLNSSAEKVSTPkpssatllakkskkggg-------------agap  450
            + K +     +DPN LNSS+EKV+ P+ ++ TL  KKSK                 + + 
Sbjct  90   SSKFTTTKRWSDPNALNSSSEKVAIPRNTTKTLDRKKSKSFKEGMGNNGLSSYIEPSLSY  149

Query  451  aaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKV  588
            +++++V+ PGSIAA RREQVA+ Q QRKMKIAHYGR+KSAK++ K+
Sbjct  150  SSSLLVEAPGSIAAVRREQVALQQAQRKMKIAHYGRSKSAKFESKL  195



>ref|XP_004139917.2| PREDICTED: uncharacterized protein LOC101218536 [Cucumis sativus]
 gb|KGN46782.1| hypothetical protein Csa_6G134890 [Cucumis sativus]
Length=397

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 89/180 (49%), Gaps = 37/180 (21%)
 Frame = +1

Query  118  MCSSETKLQAAP----------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsraaa  267
            MC SE  L+A             VLQP  NRV  L+RR+SLKK   +   P        +
Sbjct  1    MCRSEETLEATSVVVDSKFNSRPVLQPTGNRV--LDRRNSLKKQHPSLKPPSAAAVSPTS  58

Query  268  sltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkggg---  438
                      K KSPR PA KR+ +  N +NSS+EK+  P   S        KK      
Sbjct  59   P---------KSKSPRPPATKRANDGNNPMNSSSEKILIPAAVSRPRATLDRKKSKSFKL  109

Query  439  -------------agapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
                           A A++++ + PGSIAA RREQVA+ Q QRKM+IAHYGR+KSA+++
Sbjct  110  GGNGNVICDNGGFEVAYASSLITESPGSIAAVRREQVALQQAQRKMRIAHYGRSKSARFE  169



>ref|XP_010092457.1| Putative Glutamine amidotransferase [Morus notabilis]
 gb|EXB51223.1| Putative Glutamine amidotransferase [Morus notabilis]
Length=458

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 108/225 (48%), Gaps = 72/225 (32%)
 Frame = +1

Query  118  MCSSETKLQ-----AAPN---------VLQPNRNRVSLLERRSSLKKpssaavlpl----  243
            MC+SE K+       AP          VLQPN NRV  LERR+S+KK S+ ++       
Sbjct  1    MCTSEAKVTIGVVPMAPTSVAKINGRPVLQPNCNRVPTLERRNSVKKISTPSLTLPPPPP  60

Query  244  --------------------pppsraaasltttppaspKIKSPRQPAVKRSGNDP--NGL  357
                                   SR +   + TPP SPK KSPR PA+KR GND   NGL
Sbjct  61   TSSYSSSFSSSSSSLTSPRITANSRTSNMTSLTPPISPKSKSPRLPAIKR-GNDSAGNGL  119

Query  358  NSSAEKVSTPkpssatll-------------------------------akkskkgggag  444
            NSS+EKV TP  ++ T                                    S     + 
Sbjct  120  NSSSEKVVTPGTTARTAKLLERKKSKSFKGVISTNTTSNGTHDVAKNGVTSSSCSIEASL  179

Query  445  apaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            + +++++ + PGSIAA RREQ+A+ Q QRKM+IAHYGR+KSAK++
Sbjct  180  SYSSSLITESPGSIAAVRREQMALQQAQRKMRIAHYGRSKSAKFE  224



>ref|XP_004509997.1| PREDICTED: uncharacterized protein LOC101508282 isoform X2 [Cicer 
arietinum]
Length=335

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 86/155 (55%), Gaps = 12/155 (8%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LE+R+S+KK    ++ P   P  +  +  T P +  K+KSPR  A KR 
Sbjct  30   VLQPTCNRVPNLEKRNSIKKVQPKSLSPPSSPFPSKINSLTPPISP-KLKSPRPQATKRG  88

Query  337  GNDPNGLNSSAEK-VSTPkpssatllak----------kskkgggagapaaaVMVDEPGS  483
                N LN+S EK V TP    +    +           +     + +  ++++ + PGS
Sbjct  89   NESNNVLNTSCEKIVVTPTTRKSCSSLERKKSKSFKEGSTTCEASSLSYCSSLITESPGS  148

Query  484  IAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKV  588
            IAA RREQ+A+   QRKMKIAHYGR+KSAK++  V
Sbjct  149  IAAVRREQMALQNAQRKMKIAHYGRSKSAKFETVV  183



>gb|KEH19324.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=383

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 86/146 (59%), Gaps = 7/146 (5%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LERR+S+KK    ++     P     + +T P +  K+KSPR PA KR 
Sbjct  30   VLQPTCNRVPNLERRNSIKKLPPKSLSLPSSPPLPTKTSSTPPLSP-KLKSPRPPATKRV  88

Query  337  GNDPNGLNSSAEKV-----STPkpssatllakkskkgggagapaaaVMVDEPGSIAAARR  501
             N+   LN+S+EK+     ST   +     + K      + + ++ ++ D PGSIA  RR
Sbjct  89   -NETYLLNTSSEKIVIPRNSTKISTIKKSKSFKEGSTEASLSYSSNLITDSPGSIAGLRR  147

Query  502  EQVAIMQVQRKMKIAHYGRTKSAKYD  579
            EQ+A+   QRKMKIAHYGR+KSAK++
Sbjct  148  EQMALQNAQRKMKIAHYGRSKSAKFE  173



>gb|ACJ83955.1| unknown [Medicago truncatula]
Length=215

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 85/147 (58%), Gaps = 7/147 (5%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LERR+S+KK    ++     P     + +T P +  K+KSPR PA KR 
Sbjct  30   VLQPTCNRVPNLERRNSIKKLPPKSLSLPSSPPLPTKTSSTPPLSP-KLKSPRPPATKRV  88

Query  337  GNDPNGLNSSAEKV-----STPkpssatllakkskkgggagapaaaVMVDEPGSIAAARR  501
             N+   LN S+EK+     ST   +     + K      + + ++ ++ D PGSIA  RR
Sbjct  89   -NETYLLNISSEKIVIPRNSTKISTIKKSKSFKEGSTEASLSYSSNLITDSPGSIAGLRR  147

Query  502  EQVAIMQVQRKMKIAHYGRTKSAKYDG  582
            EQ+A+   QRKMKIAHYGR+KSAK++ 
Sbjct  148  EQMALQNAQRKMKIAHYGRSKSAKFES  174



>ref|XP_004509996.1| PREDICTED: uncharacterized protein LOC101508282 isoform X1 [Cicer 
arietinum]
Length=388

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 86/155 (55%), Gaps = 12/155 (8%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKIKSPRQPAVKRS  336
            VLQP  NRV  LE+R+S+KK    ++ P   P  +  +  T P +  K+KSPR  A KR 
Sbjct  30   VLQPTCNRVPNLEKRNSIKKVQPKSLSPPSSPFPSKINSLTPPISP-KLKSPRPQATKRG  88

Query  337  GNDPNGLNSSAEK-VSTPkpssatllak----------kskkgggagapaaaVMVDEPGS  483
                N LN+S EK V TP    +    +           +     + +  ++++ + PGS
Sbjct  89   NESNNVLNTSCEKIVVTPTTRKSCSSLERKKSKSFKEGSTTCEASSLSYCSSLITESPGS  148

Query  484  IAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKV  588
            IAA RREQ+A+   QRKMKIAHYGR+KSAK++  V
Sbjct  149  IAAVRREQMALQNAQRKMKIAHYGRSKSAKFETVV  183



>ref|XP_010928808.1| PREDICTED: uncharacterized protein LOC105050470 [Elaeis guineensis]
Length=393

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 88/174 (51%), Gaps = 26/174 (15%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasltttppaspKI-KSPRQP----  321
            VLQP  NR++ LE    LKK    ++      +    +       +  I  SP+ P    
Sbjct  25   VLQPACNRIATLEACRPLKKTLQKSISLPTSFANTNTNSDFDANETKLIASSPKAPKFSP  84

Query  322  -----------AVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkgggagapaaaVMV  468
                        VKRS NDPNGLNSS+EK +TPK S  +    + K    + A    + V
Sbjct  85   PVSPKAKPAKVVVKRS-NDPNGLNSSSEKPATPKSSGKSTPVVRKKSKKTSSAGQGGLSV  143

Query  469  DE--------PGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGDFS  606
            +         PGSIAAA+REQ ++MQ QRKM+IAHYGRT S K +GKV + D S
Sbjct  144  EASLFSSDRAPGSIAAAQREQASLMQAQRKMRIAHYGRTAS-KLEGKVVTVDTS  196



>ref|XP_006422312.1| hypothetical protein CICLE_v10005040mg [Citrus clementina]
 ref|XP_006493734.1| PREDICTED: uncharacterized protein LOC102621461 [Citrus sinensis]
 gb|ESR35552.1| hypothetical protein CICLE_v10005040mg [Citrus clementina]
 gb|KDO61513.1| hypothetical protein CISIN_1g041076mg [Citrus sinensis]
Length=420

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 93/189 (49%), Gaps = 36/189 (19%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------------VLQPNRNRV-SLLERRSSLKKpssaavlplppp  252
            MCSS+ K+    N              VLQP  NRV S L+RR++L K          P 
Sbjct  1    MCSSKDKVTTGMNEATPTMVAKINGRPVLQPTCNRVPSKLDRRNTLNKAPPPPPTLPLPT  60

Query  253  sra--aasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatll-----  411
            S      +         + KSPR  A+KR GND   LNSS+EKV TP+ +  TL      
Sbjct  61   SIKPNKPAAPLVLTCPAESKSPRPQAIKR-GND---LNSSSEKVVTPRSNIRTLERKKSK  116

Query  412  ----------akkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRT  561
                                   ++++++D PGSIAA RREQ+A+   QRKM+IAHYGR+
Sbjct  117  SFKEGGNVERTAALMMSTNTSTYSSSLIMDSPGSIAAVRREQMALQHAQRKMRIAHYGRS  176

Query  562  KSAKYDGKV  588
            KSAK++ KV
Sbjct  177  KSAKFESKV  185



>gb|KHN35318.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=398

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 94/183 (51%), Gaps = 33/183 (18%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------------VLQPNRNRVSLLERRSSLKKpssaavlplppps  255
            MC S+TK+                   VLQP  NRV  LERR+S+KK S  +  P  PP 
Sbjct  1    MCGSKTKVTVGIEATATSLVARINGRPVLQPTCNRVPNLERRNSIKKLSPKSRSPPSPPL  60

Query  256  raaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllak------  417
             +  SLT       K      P +KR GN+ NGLNSS+EK+ TP+ +  T   +      
Sbjct  61   LSKTSLTPPVSPKSKSPR--PPPIKR-GNESNGLNSSSEKIVTPRNTIKTPTLERKKSKS  117

Query  418  ----------kskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKS  567
                       S     + + ++ ++ + PGSIAA RREQ+A+   QRKMKIAHYGR+KS
Sbjct  118  FKEGSCGALGLSASTEASLSYSSTLITESPGSIAAVRREQMALQHAQRKMKIAHYGRSKS  177

Query  568  AKY  576
            AK+
Sbjct  178  AKF  180



>ref|XP_003545728.1| PREDICTED: uncharacterized protein LOC100793449 [Glycine max]
Length=398

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 94/183 (51%), Gaps = 33/183 (18%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------------VLQPNRNRVSLLERRSSLKKpssaavlplppps  255
            MC S+TK+                   VLQP  NRV  LERR+S+KK S  +  P  PP 
Sbjct  1    MCGSKTKVTVGIEATATSLVARINGRPVLQPTCNRVPNLERRNSIKKLSPKSRSPPSPPL  60

Query  256  raaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllak------  417
             +  SLT       K      P +KR GN+ NGLNSS+EK+ TP+ +  T   +      
Sbjct  61   LSKTSLTPPVSPKSKSPR--PPPIKR-GNESNGLNSSSEKIVTPRNTIKTPTLERKKSKS  117

Query  418  ----------kskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKS  567
                       S     + + ++ ++ + PGSIAA RREQ+A+   QRKMKIAHYGR+KS
Sbjct  118  FKEGSCGALGLSASTEASLSYSSTLITESPGSIAAVRREQMALQHAQRKMKIAHYGRSKS  177

Query  568  AKY  576
            AK+
Sbjct  178  AKF  180



>ref|XP_008346069.1| PREDICTED: uncharacterized protein LOC103409028 [Malus domestica]
Length=419

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 100/203 (49%), Gaps = 50/203 (25%)
 Frame = +1

Query  118  MCSSETK----LQAAP--------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS  K    ++  P         VLQPN NRV  L+RR S+K+ S+    PLP P+ +
Sbjct  1    MCSSXAKVTLGIEVTPIVARINGRPVLQPNCNRVPSLDRRGSIKRISTPPPPPLPLPASS  60

Query  262  aasltttppasp---------KIKSPRQPAVKRSGNDPNGLNSSAEK-VSTPkpssatll  411
            A++   T   +          K KSPR PA+KR GNDPN LNSS+EK V+    + A  L
Sbjct  61   ASTSPRTTNKASPLLTPPISPKSKSPRPPAIKR-GNDPNALNSSSEKVVTPGGTTRAKTL  119

Query  412  akkskkgggagapaaaVMVDE---------------------------PGSIAAARREQV  510
             +K  K     +    V  D                            PGSIAA RREQ+
Sbjct  120  ERKKSKSFKRASVGVDVGADHGRFSNGGFSPSNIEASLSYSSSLIIEAPGSIAAGRREQM  179

Query  511  AIMQVQRKMKIAHYGRTKSAKYD  579
            A+   QRKM+IAHYGR+KSA ++
Sbjct  180  ALQHAQRKMRIAHYGRSKSANFE  202



>gb|KHN38170.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=399

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 94/184 (51%), Gaps = 33/184 (18%)
 Frame = +1

Query  118  MCSSETK----LQAAPN----------VLQPNRNRVSLLERRSSLKKpssaavlplppps  255
            MCSS TK    ++AA            VLQP  NR   LERR+S+KK S  +  P  PP 
Sbjct  1    MCSSMTKVTVGIEAATATSLVANRGRPVLQPTCNRFPNLERRNSIKKLSPKSPCPPSPPL  60

Query  256  raaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllak------  417
             +   L        K      P +KR GN+  GLNSS+EK+ TP+ +  T   +      
Sbjct  61   PSKTPLAPLVSPKSKSPR--PPPIKR-GNESTGLNSSSEKIVTPRNTIKTPTLERKKSKS  117

Query  418  ----------kskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKS  567
                       S     + + ++ ++ + PGSIAA RREQ+A+   QRKMKIAHYGR+KS
Sbjct  118  FKERSYDALGLSASTEASLSYSSNLITESPGSIAAVRREQMALQHAQRKMKIAHYGRSKS  177

Query  568  AKYD  579
            AK++
Sbjct  178  AKFE  181



>ref|XP_003531809.1| PREDICTED: uncharacterized protein LOC100793991 [Glycine max]
Length=400

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 95/185 (51%), Gaps = 34/185 (18%)
 Frame = +1

Query  118  MCSSETK----LQAAPN-----------VLQPNRNRVSLLERRSSLKKpssaavlplppp  252
            MCSS TK    ++AA             VLQP  NR   LERR+S+KK S  +  P  PP
Sbjct  1    MCSSMTKVTVGIEAATATSLVARINGRPVLQPTCNRFPNLERRNSIKKLSPKSPCPPSPP  60

Query  253  sraaasltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllak-----  417
              +  SL        K      P +KR GN+  GLNSS+EK+ TP+ +  T   +     
Sbjct  61   LPSKTSLAPLVSPKSKSPR--PPPIKR-GNESTGLNSSSEKIVTPRNTIKTPTLERKKSK  117

Query  418  -----------kskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTK  564
                        S     + + ++ ++ + PGSIAA RREQ+A+   QRKMKIAHYGR+K
Sbjct  118  SFKERSYDALGLSASTEASLSYSSNLITESPGSIAAVRREQMALQHAQRKMKIAHYGRSK  177

Query  565  SAKYD  579
            SAK++
Sbjct  178  SAKFE  182



>ref|XP_009363313.1| PREDICTED: uncharacterized protein LOC103953300 [Pyrus x bretschneideri]
Length=421

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 100/205 (49%), Gaps = 52/205 (25%)
 Frame = +1

Query  118  MCSSETK----LQAAP--------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ K    ++  P         VLQPN NRV  L+RR S+K+ S+    P P P  A
Sbjct  1    MCSSKAKVTLGIEVTPIVARINGRPVLQPNCNRVPSLDRRGSIKRISTPPPPPPPLPLPA  60

Query  262  aasltttppasp-----------KIKSPRQPAVKRSGNDPNGLN-SSAEKVSTPkpssat  405
            +++ T+    +            + KSPR PA+KR GNDPNGLN SS + V+    + A 
Sbjct  61   SSASTSPRTTNKASPLLTPPISPESKSPRPPAIKR-GNDPNGLNSSSEKVVTPGGTTRAK  119

Query  406  llakkskkgggagapaaaVMVDE---------------------------PGSIAAARRE  504
            +L +K  K     +    V  D                            PGSIAA RRE
Sbjct  120  ILERKKSKSFKRASVGVDVGADHGGFSNGGFSASNIEASLSYSSSLIIEAPGSIAAGRRE  179

Query  505  QVAIMQVQRKMKIAHYGRTKSAKYD  579
            Q+A+   QRKM+IAHYGR+KSA ++
Sbjct  180  QMALQHAQRKMRIAHYGRSKSANFE  204



>ref|XP_008798468.1| PREDICTED: uncharacterized protein LOC103713352 [Phoenix dactylifera]
Length=400

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 95/198 (48%), Gaps = 36/198 (18%)
 Frame = +1

Query  118  MCSSETK------LQAAPN-----VLQPNRNRVSLLERRSSLKKpssaavlplpppsraa  264
            MCSS  K      L+A        VLQP  NR++ LE    LKK    +V         +
Sbjct  1    MCSSRIKSGHAVGLEAVAQIDGRAVLQPACNRIATLEACRPLKKTLQKSVSLPTSFPITS  60

Query  265  asltttppaspKIK------------SPR-QPA--VKRSGNDPNGLNSSAEKVSTPkpss  399
            A+       +  +             SP+ +PA  V + GNDPNGLNSS EK +TPK S+
Sbjct  61   ANSDFDADETKLVASSPKPPKFSPPVSPKAKPANVVLKRGNDPNGLNSSGEKPATPKAST  120

Query  400  atllakkskkgggagapaaaVMVDE---------PGSIAAARREQVAIMQVQRKMKIAHY  552
                  + K    + A      V+          PGSIAAA+REQ +++Q QRKM+IAHY
Sbjct  121  KPTPVVRKKSKKTSSAGQGGPPVESSLFSSCDRAPGSIAAAQREQASLIQAQRKMRIAHY  180

Query  553  GRTKSAKYDGKVASGDFS  606
            GRT S K +GKV   D S
Sbjct  181  GRTAS-KLEGKVVPVDSS  197



>ref|XP_010060864.1| PREDICTED: uncharacterized protein LOC104448688 [Eucalyptus grandis]
 gb|KCW67745.1| hypothetical protein EUGRSUZ_F01478 [Eucalyptus grandis]
Length=289

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            ++++ PGSIAA RREQ+A+   QRKM+ AHYGR KSAKYD +V   D
Sbjct  37   LVLESPGSIAAVRREQMALQNAQRKMRTAHYGRCKSAKYDARVVPLD  83



>ref|XP_006352614.1| PREDICTED: uncharacterized protein LOC102598399 [Solanum tuberosum]
Length=340

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASGD  600
            ++V+  GSIAAARREQVA MQVQRK +IAHYGRT SAK++   A+ D
Sbjct  96   MIVEVAGSIAAARREQVANMQVQRKQRIAHYGRTNSAKFNANAAAVD  142



>gb|EYU43616.1| hypothetical protein MIMGU_mgv1a008239mg [Erythranthe guttata]
Length=380

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  463  MVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVASG  597
            +VD PG+IAAARREQVAI Q QRK++I+HYGRT S+ +  + +S 
Sbjct  133  IVDAPGTIAAARREQVAITQEQRKLRISHYGRTSSSDHHHQYSSS  177



>gb|EYU43617.1| hypothetical protein MIMGU_mgv1a008239mg [Erythranthe guttata]
Length=316

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  463  MVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVAS  594
            +VD PG+IAAARREQVAI Q QRK++I+HYGRT S+ +  + +S
Sbjct  69   IVDAPGTIAAARREQVAITQEQRKLRISHYGRTSSSDHHHQYSS  112



>ref|XP_010543112.1| PREDICTED: uncharacterized protein LOC104816138 [Tarenaya hassleriana]
Length=308

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  475  PGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKV  588
            PGSIAA RREQVA  Q  RKMKIAHYGR+KSAK++ KV
Sbjct  62   PGSIAAVRREQVAQEQALRKMKIAHYGRSKSAKFEAKV  99



>gb|KFK31617.1| hypothetical protein AALP_AA6G136400 [Arabis alpina]
Length=350

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 82/165 (50%), Gaps = 23/165 (14%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasl  273
            MCSS++K     N        VLQP  N+V  L+RR+SLKK      L  P  S      
Sbjct  1    MCSSKSKNLTQENISQINGRPVLQPKSNQVPTLDRRNSLKKSPPTKALIHPISS------  54

Query  274  tttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkgggagapa  453
                    KI SPR  ++      PN          +PKP +  +   ++  GGG     
Sbjct  55   --------KIPSPRSISLNSPPLSPNSKPLRKPASESPKPVTKPVKLLETNDGGGYKEVM  106

Query  454  aaVMVD-EPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
            + ++V  +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K D K
Sbjct  107  SMLLVQKQPGSIAAARREEVAMKQEERKKKISHYGRIKSVKSDEK  151



>ref|XP_010481722.1| PREDICTED: uncharacterized protein LOC104760495 [Camelina sativa]
Length=358

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 85/183 (46%), Gaps = 45/183 (25%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasl  273
            MCSS+ K  +  N        VLQP  N+V  L+RR+SLKK  +  +  +          
Sbjct  1    MCSSKLKNLSQENISQINGRPVLQPKSNQVPTLDRRNSLKKSPTKPLTSIAS--------  52

Query  274  tttppaspKIKSPRQPAV-------------KRSGNDPNGLNSSAEK---VSTPkpssat  405
                    KI SPRQ ++             K +G+    L SS+EK   V+ P  S   
Sbjct  53   --------KIPSPRQISLISPPLSPNSKSLRKSAGSCKELLRSSSEKSRPVTKPVKSPEN  104

Query  406  llakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
                  K+          ++  +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K + K
Sbjct  105  NSDGGYKEVISMP-----IVQKQPGSIAAARREEVAMKQEERKKKISHYGRIKSVKSNEK  159

Query  586  VAS  594
              +
Sbjct  160  TVT  162



>ref|XP_010537096.1| PREDICTED: uncharacterized protein LOC104811922 [Tarenaya hassleriana]
Length=373

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 83/167 (50%), Gaps = 26/167 (16%)
 Frame = +1

Query  118  MCSSETK------------LQAAPNVLQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS++K            +   P VLQP  N+V  L+RR+SLKK     +   P    +
Sbjct  1    MCSSKSKPRSDMTQDTIAQINGRP-VLQPKSNQVPTLDRRNSLKKSPQPKLTTRPTRPVS  59

Query  262  aasltttppaspKIKSPRQPAVKRSGND---PNGLNSSAEKVSTPkpssatllakkskkg  432
              S   +P         RQP VK +G D      L+SS++KV+        +   K    
Sbjct  60   LISPPISPKPKSP----RQPVVK-TGKDVVSCKDLSSSSDKVNV-----RLVPKPKPVAK  109

Query  433  ggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAK  573
                  A  ++V +PGSIAAARRE+VA+ Q +RK KIAHYGR KS K
Sbjct  110  TLKMPTADLLIVQKPGSIAAARREEVAMKQEERKKKIAHYGRAKSNK  156



>ref|XP_010441839.1| PREDICTED: uncharacterized protein LOC104724961 [Camelina sativa]
Length=353

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 83/183 (45%), Gaps = 50/183 (27%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasl  273
            MCSS+ K  +  N        VLQP  N+V  L+RR+SLKK  +  +  +          
Sbjct  1    MCSSKLKNLSQENISQINGRPVLQPKSNQVPTLDRRNSLKKSPTKPLTSIAS--------  52

Query  274  tttppaspKIKSPRQPAVKRSGNDPNG-------------LNSSAEK---VSTPkpssat  405
                    KI SPRQ ++      PN              L SS+EK   V +P+ S   
Sbjct  53   --------KIPSPRQISLISPPLSPNSKSLKKPAASCKELLRSSSEKSKPVKSPRNSDGG  104

Query  406  llakkskkgggagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
                 S            ++  +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K + K
Sbjct  105  YKEVISMA----------IVQKQPGSIAAARREEVAMKQEERKKKISHYGRIKSVKSNEK  154

Query  586  VAS  594
              +
Sbjct  155  TIT  157



>ref|XP_009418223.1| PREDICTED: uncharacterized protein LOC103998466 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418224.1| PREDICTED: uncharacterized protein LOC103998466 [Musa acuminata 
subsp. malaccensis]
Length=389

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 86/188 (46%), Gaps = 28/188 (15%)
 Frame = +1

Query  118  MCSSETKLQAAP-------NVLQPNRNRVSLLERRSSLKKpssaavlplpppsraaaslt  276
            MCSS  K   A         VLQP  NRV+L E    LKKP   +V      ++ AA   
Sbjct  1    MCSSNIKSDHAAVAEIDGRPVLQPASNRVTLSEAGWPLKKPLQKSVSLPTWFTKTAACFD  60

Query  277  ttppaspKIKSPR---------QPA--VKRSGNDPNGLNSSAEKVSTPkpssatllakks  423
                       P+         +PA  V   GN+PNGL SS EK   PK    +    + 
Sbjct  61   VDSGDGNLSALPKLSPLPSPTSKPARIVPERGNEPNGLCSSTEKPVVPKVPVKSAAMVRK  120

Query  424  kkgggagapaaaVMVDE---------PGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKY  576
                 AG    AV +D          PGSIAAA+RE  A++Q QRK+++AHYGRT +AK 
Sbjct  121  NPKKSAGGSQVAVSIDFSSAFEFDRVPGSIAAAQREHAALVQAQRKLRVAHYGRT-AAKL  179

Query  577  DGKVASGD  600
            +  V S D
Sbjct  180  EEMVVSVD  187



>ref|XP_008225980.1| PREDICTED: uncharacterized protein LOC103325571 [Prunus mume]
Length=424

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYD  579
            ++ + PGSIAA RREQ+A+   QRKM+IAHYGR+KSA ++
Sbjct  168  LITEAPGSIAAVRREQMALQHAQRKMRIAHYGRSKSANFE  207


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 22/111 (20%)
 Frame = +1

Query  118  MCSSETKL----QAAPNV--------LQPNRNRVSLLERRSSLKKpssaavlplpppsra  261
            MCSS+ K+    +  P V        LQP  NRV  L+RR+S+KK S+    P  P S A
Sbjct  1    MCSSKAKVTIGVEVTPMVARINGRPVLQPTCNRVPSLDRRNSIKKISTPPPPPPLPTSSA  60

Query  262  aasltttppaspKI---------KSPRQPAVKRSGNDPNGLNSSAEKVSTP  387
            +++       +  +         KSPR PA+KR GNDPNGLNSS+EKV TP
Sbjct  61   SSTSPRISSKASSLLTPPISPKSKSPRPPAIKR-GNDPNGLNSSSEKVVTP  110



>ref|XP_010494515.1| PREDICTED: uncharacterized protein LOC104771648 [Camelina sativa]
Length=353

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 82/173 (47%), Gaps = 30/173 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasl  273
            MCSS+ K     N        VLQP  N+V  L+RR+SLKK  +  +  +          
Sbjct  1    MCSSKLKNLTQENISQINGRPVLQPKSNQVPTLDRRNSLKKSPTKPLTSIAS--------  52

Query  274  tttppaspKIKSPRQPAVKRSGNDPNG------LNSSAEKVSTPkpssatllakkskkgg  435
                    KI SPR  ++      PN         S  E + +    S  + + ++  GG
Sbjct  53   --------KIPSPRPISLISPPLSPNSKSLKKPAGSCKELLRSSSEKSKPVKSPRNSDGG  104

Query  436  gagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKVAS  594
                 + A++  +PGSIAAARRE+VAI Q +RK KI+HYGR KS K + K  +
Sbjct  105  YKEVISMAIVQKQPGSIAAARREEVAIKQEERKKKISHYGRIKSVKSNEKTVT  157



>ref|XP_010058073.1| PREDICTED: uncharacterized protein LOC104445842 [Eucalyptus grandis]
 gb|KCW75584.1| hypothetical protein EUGRSUZ_E04327 [Eucalyptus grandis]
Length=388

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  475  PGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGKV  588
            PGSIAAAR+EQ+A +Q QRK KIAHYGR K  K +GKV
Sbjct  148  PGSIAAARKEQIASLQEQRKQKIAHYGRVKPFKREGKV  185



>gb|ACJ84482.1| unknown [Medicago truncatula]
Length=177

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 74/138 (54%), Gaps = 13/138 (9%)
 Frame = +1

Query  157  VLQPNRNRVSLLERRSSLKKpssaavlplp--ppsraaasltttppaspKIKSPRQPAVK  330
            VLQP  N V  LERR+S+KK +  ++ PLP    +  ++      P      S R  A+K
Sbjct  29   VLQPTCNHVPNLERRNSIKKSTPKSLSPLPLPNKTNTSSLTPPISPKPKSPTSTRPLAIK  88

Query  331  RSGNDPNGLNSSAEKVSTPkpssatllakkskkgg----------gagapaaaVMVDEPG  480
            R GND NGLN S EK+S PK    T   ++ K              + + +++++ D PG
Sbjct  89   R-GNDNNGLNLSCEKISIPKNIMKTPTLERKKSKSFKEGSFGIEAASLSYSSSLITDSPG  147

Query  481  SIAAARREQVAIMQVQRK  534
            SIAA RREQVA+ Q QRK
Sbjct  148  SIAAVRREQVALQQAQRK  165



>ref|XP_002863551.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39810.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=354

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 81/170 (48%), Gaps = 29/170 (17%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasl  273
            MCSS+ K     N        VLQP  N+V  L+RR+SLKK     + P+          
Sbjct  1    MCSSKLKNLTQENISQINGRPVLQPKSNQVPTLDRRNSLKKSPPKPLNPIASS-------  53

Query  274  tttppaspKIKSPRQPAVKRSGNDPNGLN------SSAEKVSTPkpssatllakkskkgg  435
                    KI SPR  ++      PN  +      S  E + +    S  + + ++  GG
Sbjct  54   --------KIPSPRLISLNSPPLSPNSKSLRQPPGSCKELLRSSSVKSKPVKSPENSDGG  105

Query  436  gagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
                 +  ++  +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K + K
Sbjct  106  YKEVMSMVIVQKQPGSIAAARREEVAMKQEERKKKISHYGRIKSVKSNEK  155



>ref|XP_011096870.1| PREDICTED: uncharacterized protein LOC105175920 [Sesamum indicum]
Length=374

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  475  PGSIAAARREQVAIMQVQRKMKIAHYGRT  561
            PGSIAAARREQVAI   QRK++IAHYGRT
Sbjct  124  PGSIAAARREQVAIFHEQRKLRIAHYGRT  152



>ref|NP_199281.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 dbj|BAB08821.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO41948.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50465.1| unknown protein [Arabidopsis thaliana]
 gb|AED95146.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
Length=353

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 80/170 (47%), Gaps = 30/170 (18%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasl  273
            MCSS+ K     N        VLQP  N+V  L+RR+SLKK     + P+          
Sbjct  1    MCSSKLKNLTQENISQINGRPVLQPKSNQVPTLDRRNSLKKSPPKPLNPIAS--------  52

Query  274  tttppaspKIKSPRQPAVKRSGNDPNG------LNSSAEKVSTPkpssatllakkskkgg  435
                    KI SPR  ++      PN         S  E + +    S  +++ ++  GG
Sbjct  53   --------KIPSPRPISLISPPLSPNTKSLRKPAGSCKELLRSSSTKSKPVISPENSDGG  104

Query  436  gagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
                    ++  +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K + K
Sbjct  105  YKEVMPMVIVQKQPGSIAAARREEVAMKQEERKKKISHYGRIKSVKSNEK  154



>gb|AAM64486.1| unknown [Arabidopsis thaliana]
Length=353

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 80/170 (47%), Gaps = 30/170 (18%)
 Frame = +1

Query  118  MCSSETKLQAAPN--------VLQPNRNRVSLLERRSSLKKpssaavlplpppsraaasl  273
            MCSS+ K     N        VLQP  N+V  L+RR+SLKK     + P+          
Sbjct  1    MCSSKLKNLTQENISQINGRPVLQPKSNQVPTLDRRNSLKKSPPKPLNPIAS--------  52

Query  274  tttppaspKIKSPRQPAVKRSGNDPNG------LNSSAEKVSTPkpssatllakkskkgg  435
                    KI SPR  ++      PN         S  E + +    S  +++ ++  GG
Sbjct  53   --------KIPSPRPISLISPPLSPNTKSLRKPAGSCKELLRSSSTKSKPVISPENSDGG  104

Query  436  gagapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
                    ++  +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K + K
Sbjct  105  YKEVMPMVIVQKQPGSIAAARREEVAMKQEERKKKISHYGRIKSVKSNEK  154



>emb|CDY08411.1| BnaA05g26470D [Brassica napus]
Length=314

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  102



>ref|XP_009146594.1| PREDICTED: uncharacterized protein LOC103870233 [Brassica rapa]
Length=314

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  102



>ref|XP_010499388.1| PREDICTED: uncharacterized protein LOC104776915 [Camelina sativa]
Length=313

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  102



>ref|XP_006407303.1| hypothetical protein EUTSA_v10021188mg [Eutrema salsugineum]
 gb|ESQ48756.1| hypothetical protein EUTSA_v10021188mg [Eutrema salsugineum]
Length=310

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  102



>emb|CDY42170.1| BnaC05g40490D [Brassica napus]
Length=314

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  102



>ref|XP_002884921.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61180.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=312

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  65   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  101



>ref|NP_566433.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 dbj|BAB02415.1| DNA-3-methyladenine glycosidase I-like protein [Arabidopsis thaliana]
 gb|AEE75238.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
Length=312

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  65   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  101



>ref|XP_010486996.1| PREDICTED: uncharacterized protein LOC104765039 [Camelina sativa]
Length=313

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  102



>gb|AAM61316.1| unknown [Arabidopsis thaliana]
Length=312

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  65   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  101



>ref|XP_010465048.1| PREDICTED: uncharacterized protein LOC104745492 [Camelina sativa]
Length=313

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREQVAAQQALRKLKIAHYGRSKST  102



>ref|NP_001044528.1| Os01g0799500 [Oryza sativa Japonica Group]
 dbj|BAD68277.1| putative DNA-3-methyladenine glycosylase I [Oryza sativa Japonica 
Group]
 dbj|BAF06442.1| Os01g0799500 [Oryza sativa Japonica Group]
 gb|EAZ13838.1| hypothetical protein OsJ_03762 [Oryza sativa Japonica Group]
 dbj|BAG98686.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 2/43 (5%)
 Frame = +1

Query  472  EP-GSIAAARREQVAIMQVQRKMKIAHYGRTKS-AKYDGKVAS  594
            EP GSIAAA+RE VA+ Q QRKM+IAHYGRT S ++ +GKV++
Sbjct  142  EPAGSIAAAQREHVAMAQAQRKMRIAHYGRTASFSRVEGKVSA  184



>gb|EAY76151.1| hypothetical protein OsI_04083 [Oryza sativa Indica Group]
Length=391

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 2/43 (5%)
 Frame = +1

Query  472  EP-GSIAAARREQVAIMQVQRKMKIAHYGRTKS-AKYDGKVAS  594
            EP GSIAAA+RE VA+ Q QRKM+IAHYGRT S ++ +GKV++
Sbjct  142  EPAGSIAAAQREHVAMAQAQRKMRIAHYGRTASFSRVEGKVSA  184



>ref|XP_006280615.1| hypothetical protein CARUB_v10026580mg, partial [Capsella rubella]
 gb|EOA13513.1| hypothetical protein CARUB_v10026580mg, partial [Capsella rubella]
Length=386

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  472  EPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAKYDGK  585
            +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K + K
Sbjct  149  QPGSIAAARREEVAMKQEERKKKISHYGRIKSVKSNEK  186



>emb|CDY52672.1| BnaC01g38620D [Brassica napus]
Length=312

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RRE+VA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREEVAAQQALRKLKIAHYGRSKST  102



>gb|KFK38618.1| hypothetical protein AALP_AA3G137700 [Arabis alpina]
Length=311

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQ+A  Q  RK+KIAHYGR+KS 
Sbjct  64   LITEAPGSIAAVRREQMAAQQALRKLKIAHYGRSKST  100



>ref|XP_009120354.1| PREDICTED: uncharacterized protein LOC103845269 [Brassica rapa]
 emb|CDY50544.1| BnaA01g30360D [Brassica napus]
Length=311

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RRE+VA  Q  RK+KIAHYGR+KS 
Sbjct  66   LITEAPGSIAAVRREEVAAQQALRKLKIAHYGRSKST  102



>ref|XP_006398092.1| hypothetical protein EUTSA_v10000945mg [Eutrema salsugineum]
 gb|ESQ39545.1| hypothetical protein EUTSA_v10000945mg [Eutrema salsugineum]
Length=348

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 79/163 (48%), Gaps = 32/163 (20%)
 Frame = +1

Query  118  MCSSETK---------LQAAPNVLQPNRNRVSLLERRSSLKKpssaavlplpppsraaas  270
            MCSS++K         +   P VLQP  N+V  L+RR+SLKK      +   P       
Sbjct  1    MCSSKSKNMNQEAISQINGRP-VLQPKSNQVPTLDRRNSLKKSPPKPSIHPIPS------  53

Query  271  ltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVSTPkpssatllakkskkgggagap  450
                     KI SPR   +    N P  L+  ++ +  P  S      K S+   G    
Sbjct  54   ---------KIPSPRPTFL----NSP-PLSPKSKSLRNPAGSEKPKPVKLSESTDGGCRE  99

Query  451  aaaVMV--DEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAK  573
              ++++   +PGSIAAARRE+VA+ Q +RK KI+HYGR KS K
Sbjct  100  VMSMVIAQKQPGSIAAARREEVAMKQEERKKKISHYGRIKSVK  142



>ref|XP_006644844.1| PREDICTED: uncharacterized protein LOC102709508 [Oryza brachyantha]
Length=387

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = +1

Query  472  EP-GSIAAARREQVAIMQVQRKMKIAHYGRTKS-AKYDGKVAS  594
            EP GSIAAA+RE  A+ Q QRKM+IAHYGRT S ++ +GKV++
Sbjct  143  EPAGSIAAAQREHAALAQAQRKMRIAHYGRTASFSRVEGKVSA  185



>ref|XP_006298177.1| hypothetical protein CARUB_v10014226mg [Capsella rubella]
 gb|EOA31075.1| hypothetical protein CARUB_v10014226mg [Capsella rubella]
Length=312

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSA  570
            ++ + PGSIAA RREQVA  Q  RK+KI HYGR+KS 
Sbjct  65   LITEAPGSIAAGRREQVAAQQALRKLKIDHYGRSKST  101



>emb|CDY14939.1| BnaA02g22810D [Brassica napus]
Length=349

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 80/162 (49%), Gaps = 30/162 (19%)
 Frame = +1

Query  118  MCSSETK---------LQAAPNVLQPNRNRVSLLERRSSLKKpssaavlplpppsraaas  270
            MCSS++K         +   P VLQP  N+V  L+RR+SLKK    +++           
Sbjct  1    MCSSKSKNMNQEAISQINGRP-VLQPKSNQVPTLDRRNSLKKSPPKSLIHPIAS------  53

Query  271  ltttppaspKIKSPRQPAVKRSGNDPNGLNSSAEKVST---Pkpssatllakkskkggga  441
                     KI SPR  ++      PN  +    K++    PKP++  +   +   GG  
Sbjct  54   ---------KIASPRPISLNSPPLSPN--SKPIRKLAYYEKPKPAAKPVKLSERTDGGCR  102

Query  442  gapaaaVMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKS  567
               +   +  +PGSIAAARRE+VA+ Q +RK KI+HYGR KS
Sbjct  103  EVKSTVTVQKQPGSIAAARREEVAMKQEERKKKISHYGRVKS  144



>ref|XP_004248406.1| PREDICTED: uncharacterized protein LOC101258999 [Solanum lycopersicum]
Length=348

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  460  VMVDEPGSIAAARREQVAIMQVQRKMKIAHYGRTKSAK  573
            +MV+   SIAAA REQVA  QVQRK +IAHYGRT S K
Sbjct  106  MMVEVAASIAAATREQVANRQVQRKQRIAHYGRTNSPK  143



>ref|XP_009123626.1| PREDICTED: uncharacterized protein LOC103848479, partial [Brassica 
rapa]
Length=343

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  472  EPGSIAAARREQVAIMQVQRKMKIAHYGRTKS  567
            +PGSIAAARRE+VA+ Q +RK KI+HYGR KS
Sbjct  107  QPGSIAAARREEVAMKQEERKKKISHYGRVKS  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 984062932160