BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13981

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010063716.1|  PREDICTED: SCY1-like protein 2                   53.5    6e-05   Eucalyptus grandis [rose gum]
ref|XP_009763333.1|  PREDICTED: SCY1-like protein 2                   52.4    2e-04   Nicotiana sylvestris
ref|XP_009601552.1|  PREDICTED: SCY1-like protein 2                   52.4    2e-04   Nicotiana tomentosiformis
emb|CDP20126.1|  unnamed protein product                              50.1    0.001   Coffea canephora [robusta coffee]



>ref|XP_010063716.1| PREDICTED: SCY1-like protein 2 [Eucalyptus grandis]
 gb|KCW70965.1| hypothetical protein EUGRSUZ_F04075 [Eucalyptus grandis]
Length=916

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 31/46 (67%), Gaps = 7/46 (15%)
 Frame = -2

Query  490  YXKQTQG-------FFXKPXDFGSXXSSNKTEQTAPRLAPPPSTAI  374
            Y KQ+QG          KP D GS  SSNK+EQTAPRLAPPPSTA+
Sbjct  841  YLKQSQGNMSSSFNLDKKPSDIGSIFSSNKSEQTAPRLAPPPSTAV  886



>ref|XP_009763333.1| PREDICTED: SCY1-like protein 2, partial [Nicotiana sylvestris]
Length=723

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = -2

Query  490  YXKQTQG------FFXKPXDFGSXXSSNKTEQTAPRLAPPPSTAIgrgrgrgrGNQGQL  332
            + KQ+QG         +  D GS  SSNK EQTAPRLAPPPSTA+GRGRGRGRGNQGQL
Sbjct  642  FMKQSQGPSAMNASSGRANDIGSIFSSNKGEQTAPRLAPPPSTAVGRGRGRGRGNQGQL  700



>ref|XP_009601552.1| PREDICTED: SCY1-like protein 2 [Nicotiana tomentosiformis]
Length=933

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = -2

Query  490  YXKQTQG------FFXKPXDFGSXXSSNKTEQTAPRLAPPPSTAIgrgrgrgrGNQGQL  332
            + KQ+QG         +  D GS  SSNK EQTAPRLAPPPSTA+GRGRGRGRGNQGQL
Sbjct  852  FMKQSQGPSAMNASSGRANDIGSIFSSNKGEQTAPRLAPPPSTAVGRGRGRGRGNQGQL  910



>emb|CDP20126.1| unnamed protein product [Coffea canephora]
Length=931

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 6/59 (10%)
 Frame = -2

Query  490  YXKQTQGFFX------KPXDFGSXXSSNKTEQTAPRLAPPPSTAIgrgrgrgrGNQGQL  332
            + KQ QG         K  D GS  +S+K+E TAPRLAPPP+TA+GRGRGRGRGNQGQL
Sbjct  849  FMKQNQGVSTYGVSSEKTMDLGSIFASSKSEHTAPRLAPPPATAVGRGRGRGRGNQGQL  907



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1309179430124