BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13810

Length=1331
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798027.1|  PREDICTED: uncharacterized protein LOC104244298    300   2e-93   Nicotiana sylvestris
ref|XP_004232605.1|  PREDICTED: uncharacterized protein LOC101246304    299   3e-93   Solanum lycopersicum
ref|XP_009593254.1|  PREDICTED: uncharacterized protein LOC104089941    299   4e-93   Nicotiana tomentosiformis
ref|XP_009629022.1|  PREDICTED: dual specificity protein kinase s...    296   9e-92   Nicotiana tomentosiformis
ref|XP_006364818.1|  PREDICTED: uncharacterized protein LOC102594852    289   2e-89   Solanum tuberosum [potatoes]
ref|XP_009792090.1|  PREDICTED: uncharacterized protein LOC104239210    289   4e-89   Nicotiana sylvestris
ref|XP_009592127.1|  PREDICTED: uncharacterized protein LOC104089024    287   4e-89   Nicotiana tomentosiformis
emb|CDP04102.1|  unnamed protein product                                284   2e-87   Coffea canephora [robusta coffee]
ref|XP_009785679.1|  PREDICTED: uncharacterized protein LOC104233914    282   5e-87   Nicotiana sylvestris
ref|XP_011022300.1|  PREDICTED: uncharacterized protein LOC105124...    280   2e-85   Populus euphratica
ref|XP_006468594.1|  PREDICTED: uncharacterized protein LOC102614205    278   2e-85   Citrus sinensis [apfelsine]
ref|XP_011022299.1|  PREDICTED: uncharacterized protein LOC105124...    279   3e-85   Populus euphratica
ref|XP_002303720.2|  hypothetical protein POPTR_0003s15520g             279   4e-85   Populus trichocarpa [western balsam poplar]
ref|XP_002303719.2|  hypothetical protein POPTR_0003s15520g             278   5e-85   
ref|XP_007040982.1|  DNA glycosylase superfamily protein, putative      278   5e-85   
ref|XP_002530111.1|  DNA-3-methyladenine glycosylase, putative          277   1e-84   Ricinus communis
ref|XP_010100595.1|  Putative Glutamine amidotransferase                275   3e-84   Morus notabilis
ref|XP_004248406.1|  PREDICTED: uncharacterized protein LOC101258999    274   4e-84   Solanum lycopersicum
ref|XP_002299382.2|  hypothetical protein POPTR_0001s12320g             273   1e-83   
gb|KJB14124.1|  hypothetical protein B456_002G111100                    274   1e-83   Gossypium raimondii
ref|XP_002312220.1|  methyladenine glycosylase family protein           273   2e-83   Populus trichocarpa [western balsam poplar]
ref|XP_011008217.1|  PREDICTED: uncharacterized protein LOC105113658    273   5e-83   Populus euphratica
ref|XP_010260812.1|  PREDICTED: uncharacterized protein LOC104599795    273   6e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006448576.1|  hypothetical protein CICLE_v10015639mg             271   8e-83   Citrus clementina [clementine]
ref|XP_006352614.1|  PREDICTED: uncharacterized protein LOC102598399    268   8e-82   Solanum tuberosum [potatoes]
ref|XP_011096870.1|  PREDICTED: uncharacterized protein LOC105175920    268   2e-81   Sesamum indicum [beniseed]
ref|XP_002263612.1|  PREDICTED: uncharacterized protein LOC100256507    268   2e-81   Vitis vinifera
ref|XP_002315089.2|  methyladenine glycosylase family protein           268   4e-81   
emb|CAN68394.1|  hypothetical protein VITISV_042519                     267   6e-81   Vitis vinifera
gb|KHG21574.1|  putative GMP synthase [glutamine-hydrolyzing]           266   8e-81   Gossypium arboreum [tree cotton]
ref|XP_012092185.1|  PREDICTED: uncharacterized protein LOC105649949    266   1e-80   Jatropha curcas
ref|XP_012075493.1|  PREDICTED: uncharacterized protein LOC105636759    266   1e-80   Jatropha curcas
ref|XP_011012959.1|  PREDICTED: uncharacterized protein LOC105117079    266   2e-80   Populus euphratica
ref|XP_002515807.1|  DNA-3-methyladenine glycosylase, putative          265   5e-80   
ref|XP_007022761.1|  DNA glycosylase superfamily protein isoform 1      265   6e-80   
ref|XP_007022762.1|  DNA glycosylase superfamily protein isoform 2      265   7e-80   
ref|XP_011014375.1|  PREDICTED: uncharacterized protein LOC105118177    265   8e-80   Populus euphratica
gb|KJB14128.1|  hypothetical protein B456_002G111100                    264   1e-79   Gossypium raimondii
ref|XP_010060864.1|  PREDICTED: uncharacterized protein LOC104448688    259   4e-79   
ref|XP_004295546.1|  PREDICTED: uncharacterized protein LOC101298985    262   7e-79   Fragaria vesca subsp. vesca
ref|XP_006422312.1|  hypothetical protein CICLE_v10005040mg             262   8e-79   Citrus clementina [clementine]
ref|XP_007149154.1|  hypothetical protein PHAVU_005G045900g             259   1e-77   Phaseolus vulgaris [French bean]
ref|XP_010928808.1|  PREDICTED: uncharacterized protein LOC105050470    258   1e-77   Elaeis guineensis
ref|XP_009363313.1|  PREDICTED: uncharacterized protein LOC103953300    258   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_008346069.1|  PREDICTED: uncharacterized protein LOC103409028    258   6e-77   
ref|XP_008383216.1|  PREDICTED: uncharacterized protein LOC103445940    257   8e-77   Malus domestica [apple tree]
ref|XP_009368609.1|  PREDICTED: uncharacterized protein LOC103958107    256   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_007211731.1|  hypothetical protein PRUPE_ppa006139mg             256   2e-76   Prunus persica
ref|XP_009368625.1|  PREDICTED: uncharacterized protein LOC103958120    256   2e-76   Pyrus x bretschneideri [bai li]
ref|XP_008225980.1|  PREDICTED: uncharacterized protein LOC103325571    256   3e-76   Prunus mume [ume]
ref|XP_003546838.1|  PREDICTED: uncharacterized protein LOC100811352    254   8e-76   Glycine max [soybeans]
ref|XP_008798468.1|  PREDICTED: uncharacterized protein LOC103713352    253   2e-75   Phoenix dactylifera
gb|KHN21364.1|  Putative GMP synthase [glutamine-hydrolyzing]           253   2e-75   Glycine soja [wild soybean]
ref|XP_010494515.1|  PREDICTED: uncharacterized protein LOC104771648    251   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003531474.1|  PREDICTED: uncharacterized protein LOC100791725    252   3e-75   Glycine max [soybeans]
ref|XP_003531809.1|  PREDICTED: uncharacterized protein LOC100793991    252   5e-75   Glycine max [soybeans]
gb|KHN38170.1|  Putative GMP synthase [glutamine-hydrolyzing]           251   5e-75   Glycine soja [wild soybean]
ref|XP_003595924.1|  DNA-3-methyladenine glycosylase                    251   6e-75   Medicago truncatula
gb|AFK37052.1|  unknown                                                 251   7e-75   Medicago truncatula
gb|KHN48850.1|  Putative GMP synthase [glutamine-hydrolyzing]           250   2e-74   Glycine soja [wild soybean]
ref|XP_010441839.1|  PREDICTED: uncharacterized protein LOC104724961    248   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004139917.2|  PREDICTED: uncharacterized protein LOC101218536    250   3e-74   Cucumis sativus [cucumbers]
ref|XP_010481722.1|  PREDICTED: uncharacterized protein LOC104760495    248   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_007212311.1|  hypothetical protein PRUPE_ppa006731mg             249   4e-74   Prunus persica
ref|XP_010537096.1|  PREDICTED: uncharacterized protein LOC104811922    248   5e-74   Tarenaya hassleriana [spider flower]
ref|XP_010058073.1|  PREDICTED: uncharacterized protein LOC104445842    249   6e-74   Eucalyptus grandis [rose gum]
ref|XP_004509996.1|  PREDICTED: uncharacterized protein LOC101508...    248   8e-74   Cicer arietinum [garbanzo]
emb|CDY14939.1|  BnaA02g22810D                                          247   9e-74   Brassica napus [oilseed rape]
ref|XP_002863551.1|  methyladenine glycosylase family protein           246   1e-73   Arabidopsis lyrata subsp. lyrata
ref|NP_199281.1|  putative 3-methyladenine glycosylase I                246   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123626.1|  PREDICTED: uncharacterized protein LOC103848479    246   3e-73   
ref|XP_006398092.1|  hypothetical protein EUTSA_v10000945mg             245   3e-73   Eutrema salsugineum [saltwater cress]
gb|KEH19324.1|  DNA-3-methyladenine glycosylase I                       246   5e-73   Medicago truncatula
ref|XP_010543112.1|  PREDICTED: uncharacterized protein LOC104816138    243   6e-73   Tarenaya hassleriana [spider flower]
ref|XP_010499388.1|  PREDICTED: uncharacterized protein LOC104776915    243   7e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006298177.1|  hypothetical protein CARUB_v10014226mg             243   1e-72   Capsella rubella
ref|XP_010670018.1|  PREDICTED: uncharacterized protein LOC104887122    245   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003545728.1|  PREDICTED: uncharacterized protein LOC100793449    245   2e-72   Glycine max [soybeans]
gb|KHN35318.1|  Putative GMP synthase [glutamine-hydrolyzing]           245   2e-72   Glycine soja [wild soybean]
emb|CDY09506.1|  BnaC02g20480D                                          243   2e-72   Brassica napus [oilseed rape]
emb|CDY42170.1|  BnaC05g40490D                                          242   3e-72   Brassica napus [oilseed rape]
ref|XP_008225940.1|  PREDICTED: uncharacterized protein LOC103325537    244   3e-72   Prunus mume [ume]
ref|XP_002456485.1|  hypothetical protein SORBIDRAFT_03g037150          244   4e-72   
ref|XP_009368563.1|  PREDICTED: titin-like                              244   4e-72   Pyrus x bretschneideri [bai li]
emb|CDX96974.1|  BnaC02g31120D                                          243   5e-72   
ref|XP_010465048.1|  PREDICTED: uncharacterized protein LOC104745492    241   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010092457.1|  Putative Glutamine amidotransferase                245   7e-72   Morus notabilis
ref|XP_006280615.1|  hypothetical protein CARUB_v10026580mg             243   7e-72   
ref|XP_009120354.1|  PREDICTED: uncharacterized protein LOC103845269    241   7e-72   Brassica rapa
ref|XP_009146594.1|  PREDICTED: uncharacterized protein LOC103870233    241   8e-72   Brassica rapa
ref|XP_010486996.1|  PREDICTED: uncharacterized protein LOC104765039    240   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002884921.1|  methyladenine glycosylase family protein           240   1e-71   
ref|XP_007133461.1|  hypothetical protein PHAVU_011G180500g             243   1e-71   Phaseolus vulgaris [French bean]
ref|XP_009363279.1|  PREDICTED: uncharacterized protein LOC103953267    242   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_008364234.1|  PREDICTED: uncharacterized protein LOC103427927    242   2e-71   
gb|AAM64486.1|  unknown                                                 241   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EYU43617.1|  hypothetical protein MIMGU_mgv1a008239mg                239   3e-71   Erythranthe guttata [common monkey flower]
emb|CDM84569.1|  unnamed protein product                                241   3e-71   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ98623.1|  predicted protein                                      241   4e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK38618.1|  hypothetical protein AALP_AA3G137700                    239   4e-71   Arabis alpina [alpine rockcress]
ref|NP_001044528.1|  Os01g0799500                                       241   5e-71   
gb|EAY76151.1|  hypothetical protein OsI_04083                          241   6e-71   Oryza sativa Indica Group [Indian rice]
gb|AGT16257.1|  DNA-3-methyladenine glycosylase                         241   6e-71   Saccharum hybrid cultivar R570
gb|EYU43616.1|  hypothetical protein MIMGU_mgv1a008239mg                241   6e-71   Erythranthe guttata [common monkey flower]
emb|CDY52672.1|  BnaC01g38620D                                          238   7e-71   Brassica napus [oilseed rape]
ref|XP_006644844.1|  PREDICTED: uncharacterized protein LOC102709508    239   2e-70   Oryza brachyantha
gb|ACF86573.1|  unknown                                                 239   2e-70   Zea mays [maize]
emb|CDY08411.1|  BnaA05g26470D                                          237   2e-70   Brassica napus [oilseed rape]
gb|KFK31617.1|  hypothetical protein AALP_AA6G136400                    238   2e-70   Arabis alpina [alpine rockcress]
ref|XP_006407303.1|  hypothetical protein EUTSA_v10021188mg             236   3e-70   Eutrema salsugineum [saltwater cress]
ref|XP_008383248.1|  PREDICTED: uncharacterized protein LOC103445971    239   3e-70   
ref|XP_004970256.1|  PREDICTED: uncharacterized protein LOC101752873    238   7e-70   Setaria italica
ref|NP_566433.1|  putative 3-methyladenine glycosylase I                235   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293832.1|  PREDICTED: uncharacterized protein LOC101310385    236   2e-69   Fragaria vesca subsp. vesca
ref|XP_009418223.1|  PREDICTED: uncharacterized protein LOC103998466    236   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006468655.1|  PREDICTED: uncharacterized protein LOC102630002    228   5e-69   Citrus sinensis [apfelsine]
ref|NP_001150401.1|  DNA-3-methyladenine glycosylase I                  235   7e-69   
gb|AAM61316.1|  unknown                                                 232   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564403.1|  PREDICTED: uncharacterized protein LOC100836431    234   2e-68   Brachypodium distachyon [annual false brome]
ref|XP_003522140.1|  PREDICTED: uncharacterized protein LOC100789505    226   4e-68   
ref|XP_006853486.1|  PREDICTED: uncharacterized protein LOC18443232     228   2e-66   Amborella trichopoda
gb|ACJ83471.1|  unknown                                                 182   5e-52   Medicago truncatula
ref|XP_008456274.1|  PREDICTED: uncharacterized protein LOC103496269    180   7e-51   Cucumis melo [Oriental melon]
ref|XP_008339748.1|  PREDICTED: uncharacterized protein LOC103402771    182   1e-49   
ref|XP_002267123.1|  PREDICTED: uncharacterized protein LOC100249617    182   1e-49   Vitis vinifera
ref|XP_010091642.1|  Putative Glutamine amidotransferase                181   4e-49   
ref|XP_001754346.1|  predicted protein                                  176   8e-49   
ref|XP_009355560.1|  PREDICTED: uncharacterized protein LOC103946559    180   9e-49   Pyrus x bretschneideri [bai li]
ref|XP_009356467.1|  PREDICTED: uncharacterized protein LOC103947296    180   9e-49   Pyrus x bretschneideri [bai li]
ref|XP_004135425.1|  PREDICTED: uncharacterized protein LOC101218195    180   1e-48   Cucumis sativus [cucumbers]
ref|XP_003516830.1|  PREDICTED: uncharacterized protein LOC100810677    180   1e-48   Glycine max [soybeans]
ref|XP_002988078.1|  hypothetical protein SELMODRAFT_46169              176   1e-48   
ref|NP_001240008.1|  uncharacterized protein LOC100813637               179   1e-48   Glycine max [soybeans]
gb|KFK43621.1|  hypothetical protein AALP_AA1G149800                    179   1e-48   Arabis alpina [alpine rockcress]
ref|XP_012080476.1|  PREDICTED: uncharacterized protein LOC105640691    179   4e-48   Jatropha curcas
ref|XP_002972716.1|  hypothetical protein SELMODRAFT_98461              176   4e-48   
ref|XP_008350880.1|  PREDICTED: uncharacterized protein LOC103414261    178   5e-48   
ref|XP_001778877.1|  predicted protein                                  174   6e-48   
gb|EMT03091.1|  hypothetical protein F775_44010                         171   6e-48   
ref|XP_006417105.1|  hypothetical protein EUTSA_v10008250mg             177   9e-48   Eutrema salsugineum [saltwater cress]
ref|XP_011009373.1|  PREDICTED: uncharacterized protein LOC105114510    177   9e-48   Populus euphratica
ref|XP_007153437.1|  hypothetical protein PHAVU_003G035100g             176   2e-47   Phaseolus vulgaris [French bean]
ref|XP_007045734.1|  DNA glycosylase superfamily protein isoform 1      176   2e-47   Theobroma cacao [chocolate]
ref|XP_010476370.1|  PREDICTED: uncharacterized protein LOC104755649    176   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002314913.2|  hypothetical protein POPTR_0010s14710g             176   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009104493.1|  PREDICTED: uncharacterized protein LOC103830461    172   3e-47   Brassica rapa
emb|CDP00487.1|  unnamed protein product                                176   3e-47   Coffea canephora [robusta coffee]
ref|XP_002890014.1|  methyladenine glycosylase family protein           176   3e-47   
ref|XP_006857230.1|  PREDICTED: uncharacterized protein LOC18447066     178   4e-47   Amborella trichopoda
ref|XP_002514580.1|  DNA-3-methyladenine glycosylase, putative          176   6e-47   Ricinus communis
ref|XP_002968680.1|  hypothetical protein SELMODRAFT_90743              172   6e-47   
ref|XP_004490266.1|  PREDICTED: probable GMP synthase [glutamine-...    174   7e-47   Cicer arietinum [garbanzo]
ref|XP_004509952.1|  PREDICTED: probable GMP synthase [glutamine-...    175   1e-46   Cicer arietinum [garbanzo]
gb|KHN19385.1|  Putative GMP synthase [glutamine-hydrolyzing]           174   2e-46   Glycine soja [wild soybean]
ref|XP_010528005.1|  PREDICTED: uncharacterized protein LOC104805218    174   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_008446481.1|  PREDICTED: uncharacterized protein LOC103489204    176   2e-46   
gb|KHN37232.1|  Putative GMP synthase [glutamine-hydrolyzing]           174   2e-46   Glycine soja [wild soybean]
ref|XP_002989930.1|  hypothetical protein SELMODRAFT_130680             171   2e-46   
ref|XP_010458816.1|  PREDICTED: uncharacterized protein LOC104740019    173   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007045735.1|  DNA glycosylase superfamily protein isoform 2      173   3e-46   
ref|XP_006303106.1|  hypothetical protein CARUB_v100220021mg            169   3e-46   
ref|XP_010495464.1|  PREDICTED: uncharacterized protein LOC104772561    173   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006280730.1|  hypothetical protein CARUB_v10026699mg             174   4e-46   Capsella rubella
ref|XP_007223145.1|  hypothetical protein PRUPE_ppa009020mg             173   4e-46   Prunus persica
ref|XP_009123960.1|  PREDICTED: uncharacterized protein LOC103848889    173   5e-46   Brassica rapa
ref|XP_003580082.1|  PREDICTED: uncharacterized protein LOC100824759    175   5e-46   Brachypodium distachyon [annual false brome]
ref|NP_973818.1|  putative 3-methyladenine glycosylase I                172   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243789.1|  PREDICTED: uncharacterized protein LOC103342008    172   5e-46   Prunus mume [ume]
gb|AFK48319.1|  unknown                                                 172   6e-46   Medicago truncatula
gb|KEH17529.1|  DNA-3-methyladenine glycosylase I                       172   6e-46   Medicago truncatula
ref|XP_010428513.1|  PREDICTED: uncharacterized protein LOC104713152    172   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006304034.1|  hypothetical protein CARUB_v10009802mg             172   6e-46   Capsella rubella
gb|KJB50513.1|  hypothetical protein B456_008G174900                    172   7e-46   Gossypium raimondii
ref|XP_010265584.1|  PREDICTED: uncharacterized protein LOC104603287    174   9e-46   Nelumbo nucifera [Indian lotus]
ref|XP_012071504.1|  PREDICTED: uncharacterized protein LOC105633512    174   9e-46   Jatropha curcas
gb|KJB65788.1|  hypothetical protein B456_010G113100                    169   1e-45   Gossypium raimondii
ref|XP_006437842.1|  hypothetical protein CICLE_v10032151mg             172   1e-45   Citrus clementina [clementine]
ref|XP_002864542.1|  methyladenine glycosylase family protein           172   1e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_008669205.1|  PREDICTED: uncharacterized protein LOC100216672    174   1e-45   
emb|CDX67972.1|  BnaA07g20120D                                          170   2e-45   
ref|XP_010416373.1|  PREDICTED: uncharacterized protein LOC104702246    172   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010275821.1|  PREDICTED: uncharacterized protein LOC104610746    173   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_006484265.1|  PREDICTED: uncharacterized protein LOC102627...    171   2e-45   Citrus sinensis [apfelsine]
gb|KDO70261.1|  hypothetical protein CISIN_1g021082mg                   171   2e-45   Citrus sinensis [apfelsine]
gb|KDO70260.1|  hypothetical protein CISIN_1g021082mg                   171   2e-45   Citrus sinensis [apfelsine]
ref|XP_009782048.1|  PREDICTED: uncharacterized protein LOC104230847    171   2e-45   Nicotiana sylvestris
gb|AAG51925.1|AC013258_19  putative DNA-3-methyladenine glycosyla...    167   2e-45   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG91308.1|  unnamed protein product                                172   2e-45   Oryza sativa Japonica Group [Japonica rice]
emb|CAC09513.2|  H0711G06.19                                            172   3e-45   Oryza sativa [red rice]
gb|KJB56529.1|  hypothetical protein B456_009G123900                    172   3e-45   Gossypium raimondii
ref|XP_004297192.1|  PREDICTED: uncharacterized protein LOC101296948    171   3e-45   Fragaria vesca subsp. vesca
ref|XP_010943158.1|  PREDICTED: uncharacterized protein LOC105060...    171   4e-45   Elaeis guineensis
ref|XP_010471611.1|  PREDICTED: uncharacterized protein LOC104751...    171   4e-45   Camelina sativa [gold-of-pleasure]
ref|NP_178200.1|  methyladenine glycosylase-like protein                171   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471610.1|  PREDICTED: uncharacterized protein LOC104751...    171   5e-45   Camelina sativa [gold-of-pleasure]
gb|AFK34294.1|  unknown                                                 170   5e-45   Lotus japonicus
ref|XP_002324538.1|  methyladenine glycosylase family protein           172   6e-45   
ref|XP_004976128.1|  PREDICTED: uncharacterized protein LOC101782624    172   6e-45   Setaria italica
ref|XP_009595131.1|  PREDICTED: uncharacterized protein LOC104091486    170   7e-45   Nicotiana tomentosiformis
gb|KJB65790.1|  hypothetical protein B456_010G113100                    169   7e-45   Gossypium raimondii
gb|EEE66127.1|  hypothetical protein OsJ_22173                          172   7e-45   Oryza sativa Japonica Group [Japonica rice]
emb|CDX79346.1|  BnaC06g19570D                                          168   7e-45   
ref|XP_006453620.1|  hypothetical protein CICLE_v10008612mg             171   7e-45   
ref|XP_007153458.1|  hypothetical protein PHAVU_003G037100g             169   8e-45   Phaseolus vulgaris [French bean]
ref|XP_011033406.1|  PREDICTED: uncharacterized protein LOC105131909    171   8e-45   Populus euphratica
gb|KJB78242.1|  hypothetical protein B456_012G185200                    170   9e-45   Gossypium raimondii
ref|XP_010092198.1|  Putative Glutamine amidotransferase                172   9e-45   
ref|XP_002887808.1|  hypothetical protein ARALYDRAFT_477160             169   9e-45   
ref|NP_200605.1|  putative DNA-3-methyladenine glycosylase I            170   9e-45   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ01894.1|  hypothetical protein OsI_23919                          172   1e-44   Oryza sativa Indica Group [Indian rice]
dbj|BAD38103.1|  methyladenine glycosylase protein-like                 172   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010483357.1|  PREDICTED: uncharacterized protein LOC104761...    169   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009384964.1|  PREDICTED: uncharacterized protein LOC103972369    171   1e-44   
ref|XP_006473998.1|  PREDICTED: uncharacterized protein LOC102607933    171   1e-44   Citrus sinensis [apfelsine]
ref|XP_011018029.1|  PREDICTED: uncharacterized protein LOC105121177    171   1e-44   Populus euphratica
ref|XP_010443507.1|  PREDICTED: uncharacterized protein LOC104726362    169   2e-44   Camelina sativa [gold-of-pleasure]
ref|WP_012376907.1|  DNA-3-methyladenine glycosylase                    165   2e-44   Opitutus terrae
ref|XP_008663363.1|  PREDICTED: uncharacterized protein LOC103641812    171   2e-44   Zea mays [maize]
ref|XP_010429893.1|  PREDICTED: uncharacterized protein LOC104714283    169   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010453026.1|  PREDICTED: uncharacterized protein LOC104735009    169   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009420383.1|  PREDICTED: uncharacterized protein LOC104000141    170   2e-44   
gb|KJB54988.1|  hypothetical protein B456_009G057100                    169   2e-44   Gossypium raimondii
ref|XP_002309346.1|  methyladenine glycosylase family protein           170   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002446748.1|  hypothetical protein SORBIDRAFT_06g021680          170   3e-44   Sorghum bicolor [broomcorn]
ref|XP_010536978.1|  PREDICTED: uncharacterized protein LOC104811...    169   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_012067499.1|  PREDICTED: uncharacterized protein LOC105630313    169   3e-44   Jatropha curcas
gb|ACG46017.1|  DNA-3-methyladenine glycosylase I                       171   3e-44   Zea mays [maize]
ref|XP_008777405.1|  PREDICTED: uncharacterized protein LOC103697341    169   3e-44   Phoenix dactylifera
gb|KHG15995.1|  putative GMP synthase [glutamine-hydrolyzing]           169   4e-44   Gossypium arboreum [tree cotton]
emb|CDX73141.1|  BnaC06g35890D                                          163   4e-44   
ref|XP_010103669.1|  Putative Glutamine amidotransferase                169   4e-44   Morus notabilis
gb|KFK41948.1|  hypothetical protein AALP_AA2G192700                    167   4e-44   Arabis alpina [alpine rockcress]
ref|XP_011070893.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   4e-44   Sesamum indicum [beniseed]
ref|XP_010417657.1|  PREDICTED: uncharacterized protein LOC104703348    168   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_007225526.1|  hypothetical protein PRUPE_ppa026563mg             167   5e-44   
gb|KHG02440.1|  putative GMP synthase [glutamine-hydrolyzing]           169   5e-44   Gossypium arboreum [tree cotton]
ref|XP_008794351.1|  PREDICTED: uncharacterized protein LOC103710431    169   5e-44   Phoenix dactylifera
ref|XP_006302564.1|  hypothetical protein CARUB_v10020671mg             167   6e-44   Capsella rubella
ref|XP_010656606.1|  PREDICTED: uncharacterized protein LOC100267...    169   6e-44   
ref|XP_002276173.1|  PREDICTED: uncharacterized protein LOC100267...    169   6e-44   Vitis vinifera
ref|XP_010472866.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   6e-44   
ref|XP_007011936.1|  DNA glycosylase superfamily protein isoform 1      169   7e-44   
ref|XP_010254938.1|  PREDICTED: uncharacterized protein LOC104595760    168   7e-44   Nelumbo nucifera [Indian lotus]
gb|KDP31413.1|  hypothetical protein JCGZ_11789                         165   7e-44   Jatropha curcas
ref|XP_003610321.1|  Methyladenine glycosylase protein-like protein     169   7e-44   Medicago truncatula
ref|XP_008220761.1|  PREDICTED: uncharacterized protein LOC103320814    167   7e-44   Prunus mume [ume]
ref|XP_011021090.1|  PREDICTED: uncharacterized protein LOC105123272    167   8e-44   Populus euphratica
emb|CAE01637.3|  OSJNBa0029H02.23                                       170   8e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007017467.1|  DNA-3-methyladenine glycosylase, putative          167   9e-44   
ref|NP_565100.1|  putative 3-methyladenine glycosylase I                167   9e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106712.1|  PREDICTED: uncharacterized protein LOC103832451    167   9e-44   Brassica rapa
gb|KJB65787.1|  hypothetical protein B456_010G113100                    168   9e-44   Gossypium raimondii
ref|XP_002529378.1|  DNA-3-methyladenine glycosylase, putative          168   1e-43   Ricinus communis
ref|XP_010908247.1|  PREDICTED: uncharacterized protein LOC105034...    168   1e-43   Elaeis guineensis
ref|XP_006379720.1|  hypothetical protein POPTR_0008s11150g             167   1e-43   Populus trichocarpa [western balsam poplar]
ref|NP_001141717.1|  uncharacterized protein LOC100273848               168   1e-43   
gb|KJB54992.1|  hypothetical protein B456_009G057100                    167   1e-43   Gossypium raimondii
emb|CDX88572.1|  BnaC06g40160D                                          165   2e-43   
ref|XP_004985326.1|  PREDICTED: uncharacterized protein LOC101755140    166   2e-43   
ref|XP_008647568.1|  PREDICTED: uncharacterized protein LOC100273...    168   2e-43   
ref|XP_010047107.1|  PREDICTED: uncharacterized protein LOC104436088    167   2e-43   Eucalyptus grandis [rose gum]
ref|XP_006390353.1|  hypothetical protein EUTSA_v10018831mg             166   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_008788930.1|  PREDICTED: uncharacterized protein LOC103706566    166   2e-43   Phoenix dactylifera
gb|KJB54985.1|  hypothetical protein B456_009G057100                    167   2e-43   Gossypium raimondii
gb|ACN26800.1|  unknown                                                 161   2e-43   Zea mays [maize]
ref|XP_009106167.1|  PREDICTED: uncharacterized protein LOC103831969    165   2e-43   Brassica rapa
ref|XP_010943330.1|  PREDICTED: uncharacterized protein LOC105061078    166   3e-43   Elaeis guineensis
ref|XP_008795670.1|  PREDICTED: uncharacterized protein LOC103711338    166   3e-43   Phoenix dactylifera
ref|XP_003518797.1|  PREDICTED: uncharacterized protein LOC100817116    165   3e-43   Glycine max [soybeans]
gb|KHG05579.1|  guaA                                                    167   3e-43   Gossypium arboreum [tree cotton]
gb|KHG05578.1|  guaA                                                    167   3e-43   Gossypium arboreum [tree cotton]
ref|XP_002438758.1|  hypothetical protein SORBIDRAFT_10g025650          167   3e-43   Sorghum bicolor [broomcorn]
emb|CDY69926.1|  BnaAnng32020D                                          164   3e-43   Brassica napus [oilseed rape]
ref|XP_008803717.1|  PREDICTED: uncharacterized protein LOC103717200    167   3e-43   Phoenix dactylifera
ref|XP_009774528.1|  PREDICTED: uncharacterized protein LOC104224542    164   3e-43   Nicotiana sylvestris
ref|XP_006348789.1|  PREDICTED: uncharacterized protein LOC102599707    165   4e-43   Solanum tuberosum [potatoes]
gb|KJB82834.1|  hypothetical protein B456_013G216100                    167   4e-43   Gossypium raimondii
ref|XP_003549544.1|  PREDICTED: uncharacterized protein LOC100785912    166   4e-43   Glycine max [soybeans]
ref|WP_015053568.1|  DNA-3-methyladenine glycosylase                    161   4e-43   Methanolobus psychrophilus
gb|KFK42472.1|  hypothetical protein AALP_AA2G261400                    165   5e-43   
ref|XP_009617988.1|  PREDICTED: uncharacterized protein LOC104110244    167   5e-43   
ref|XP_008394320.1|  PREDICTED: uncharacterized protein LOC103456385    166   6e-43   
ref|XP_004965722.1|  PREDICTED: uncharacterized protein LOC101779865    167   6e-43   
ref|XP_009802477.1|  PREDICTED: uncharacterized protein LOC104248004    167   6e-43   
ref|XP_006580929.1|  PREDICTED: uncharacterized protein LOC100306...    164   6e-43   
ref|XP_007136575.1|  hypothetical protein PHAVU_009G056500g             164   6e-43   
ref|XP_007154885.1|  hypothetical protein PHAVU_003G156200g             166   7e-43   
ref|XP_003523582.1|  PREDICTED: uncharacterized protein LOC100801163    165   7e-43   
ref|XP_009358441.1|  PREDICTED: uncharacterized protein LOC103949071    166   7e-43   
ref|XP_004235942.1|  PREDICTED: uncharacterized protein LOC101247118    166   8e-43   
ref|XP_002304726.2|  hypothetical protein POPTR_0003s18070g             165   8e-43   
ref|XP_007023432.1|  DNA glycosylase superfamily protein, putative      166   8e-43   
emb|CDX98116.1|  BnaA06g08670D                                          164   9e-43   
ref|XP_011020605.1|  PREDICTED: uncharacterized protein LOC105122922    165   9e-43   
gb|KHN04553.1|  Putative GMP synthase [glutamine-hydrolyzing]           164   9e-43   
ref|XP_011101955.1|  PREDICTED: uncharacterized protein LOC105179994    164   9e-43   
ref|NP_001149132.1|  LOC100282754                                       164   9e-43   
gb|KHN17491.1|  Putative GMP synthase [glutamine-hydrolyzing]           166   1e-42   
ref|WP_002974725.1|  methyladenine glycosylase                          160   1e-42   
ref|XP_006341344.1|  PREDICTED: uncharacterized protein LOC102594169    166   1e-42   
gb|KJB57836.1|  hypothetical protein B456_009G204500                    164   1e-42   
gb|KHG01098.1|  putative GMP synthase [glutamine-hydrolyzing]           164   1e-42   
ref|XP_004239015.1|  PREDICTED: uncharacterized protein LOC101257468    164   1e-42   
ref|XP_004507736.1|  PREDICTED: probable GMP synthase [glutamine-...    165   1e-42   
ref|XP_011083975.1|  PREDICTED: uncharacterized protein LOC105166...    165   1e-42   
gb|ERN05760.1|  hypothetical protein AMTR_s00006p00251960               159   2e-42   
ref|XP_009629741.1|  PREDICTED: uncharacterized protein LOC104119852    163   2e-42   
ref|XP_006389839.1|  hypothetical protein EUTSA_v10018764mg             164   2e-42   
ref|XP_010257905.1|  PREDICTED: uncharacterized protein LOC104597859    163   2e-42   
ref|XP_010063566.1|  PREDICTED: uncharacterized protein LOC104450624    165   2e-42   
emb|CDP10232.1|  unnamed protein product                                165   2e-42   
ref|XP_010044354.1|  PREDICTED: uncharacterized protein LOC104433350    163   2e-42   
ref|XP_003530263.1|  PREDICTED: uncharacterized protein LOC100805836    165   2e-42   
ref|XP_010536975.1|  PREDICTED: uncharacterized protein LOC104811...    164   2e-42   
ref|XP_010483356.1|  PREDICTED: uncharacterized protein LOC104761...    164   2e-42   
ref|XP_007135822.1|  hypothetical protein PHAVU_010G161200g             164   2e-42   
ref|XP_004147795.1|  PREDICTED: uncharacterized protein LOC101206397    163   2e-42   
ref|XP_002977834.1|  hypothetical protein SELMODRAFT_56390              159   2e-42   
ref|XP_003628723.1|  DNA-3-methyladenine glycosylase                    163   2e-42   
ref|XP_008242987.1|  PREDICTED: uncharacterized protein LOC103341...    164   3e-42   
ref|WP_042683665.1|  hypothetical protein                               159   3e-42   
ref|XP_011073325.1|  PREDICTED: uncharacterized protein LOC105158309    164   3e-42   
ref|XP_006350099.1|  PREDICTED: uncharacterized protein LOC102595...    164   3e-42   
ref|XP_003574680.1|  PREDICTED: uncharacterized protein LOC100826261    163   3e-42   
ref|XP_009365606.1|  PREDICTED: uncharacterized protein LOC103955435    163   4e-42   
ref|XP_011102034.1|  PREDICTED: uncharacterized protein LOC105180078    162   4e-42   
ref|XP_004251752.1|  PREDICTED: uncharacterized protein LOC101267...    164   4e-42   
ref|XP_002979491.1|  hypothetical protein SELMODRAFT_56855              158   4e-42   
gb|EYU21733.1|  hypothetical protein MIMGU_mgv1a024334mg                164   4e-42   
ref|XP_004136097.2|  PREDICTED: uncharacterized protein LOC101205558    163   5e-42   
gb|EKD64629.1|  hypothetical protein ACD_50C00334G0002                  158   5e-42   
ref|XP_009391283.1|  PREDICTED: uncharacterized protein LOC103977485    162   5e-42   
ref|XP_002445976.1|  hypothetical protein SORBIDRAFT_07g028890          162   6e-42   
gb|EYU24594.1|  hypothetical protein MIMGU_mgv1a007518mg                164   7e-42   
ref|XP_004287130.1|  PREDICTED: uncharacterized protein LOC101313540    164   7e-42   
ref|XP_007204814.1|  hypothetical protein PRUPE_ppa026720mg             163   8e-42   
gb|AAF81290.1|AC027656_7  Contains similarity to a putative DNA-3...    161   8e-42   
ref|XP_008461179.1|  PREDICTED: uncharacterized protein LOC103499838    163   8e-42   
ref|XP_009617886.1|  PREDICTED: uncharacterized protein LOC104110152    163   8e-42   
ref|XP_006434937.1|  hypothetical protein CICLE_v10001864mg             161   1e-41   
ref|XP_002264482.1|  PREDICTED: uncharacterized protein LOC100258710    162   1e-41   
ref|XP_004507076.1|  PREDICTED: probable GMP synthase [glutamine-...    162   1e-41   
ref|XP_008377431.1|  PREDICTED: uncharacterized protein LOC103440...    161   1e-41   
ref|XP_009410188.1|  PREDICTED: uncharacterized protein LOC103992277    163   1e-41   
gb|EMY71110.1|  methyladenine glycosylase                               157   1e-41   
ref|WP_039926042.1|  DNA-3-methyladenine glycosylase                    157   1e-41   
emb|CAN66338.1|  hypothetical protein VITISV_026086                     163   2e-41   
ref|WP_042356084.1|  DNA-3-methyladenine glycosylase                    157   2e-41   
ref|XP_008377430.1|  PREDICTED: uncharacterized protein LOC103440...    161   2e-41   
ref|XP_003519147.1|  PREDICTED: uncharacterized protein LOC100783263    162   2e-41   
gb|KHN38042.1|  Putative GMP synthase [glutamine-hydrolyzing]           160   2e-41   
gb|KHN22270.1|  Putative GMP synthase [glutamine-hydrolyzing]           160   2e-41   
ref|XP_009418177.1|  PREDICTED: uncharacterized protein LOC103998...    162   2e-41   
ref|XP_009795108.1|  PREDICTED: uncharacterized protein LOC104241850    161   2e-41   
ref|WP_008734372.1|  DNA-3-methyladenine glycosylase                    156   2e-41   
ref|XP_010106031.1|  Putative Glutamine amidotransferase                160   3e-41   
ref|XP_006305230.1|  hypothetical protein CARUB_v10009599mg             161   3e-41   
ref|WP_010520529.1|  DNA-3-methyladenine glycosylase                    155   4e-41   
ref|XP_010681154.1|  PREDICTED: uncharacterized protein LOC104896146    160   4e-41   
ref|XP_012071789.1|  PREDICTED: uncharacterized protein LOC105633753    160   4e-41   
ref|WP_036984518.1|  DNA-3-methyladenine glycosylase                    155   4e-41   
ref|XP_010942091.1|  PREDICTED: uncharacterized protein LOC105060180    161   4e-41   
ref|XP_009418119.1|  PREDICTED: uncharacterized protein LOC103998...    159   5e-41   
ref|XP_009366171.1|  PREDICTED: uncharacterized protein LOC103955980    161   5e-41   
ref|WP_026611058.1|  DNA-3-methyladenine glycosylase                    155   5e-41   
ref|XP_011623316.1|  PREDICTED: uncharacterized protein LOC18433945     159   5e-41   
ref|XP_008652340.1|  PREDICTED: uncharacterized protein LOC103632...    158   5e-41   
ref|XP_006659524.1|  PREDICTED: uncharacterized protein LOC102719138    159   6e-41   
ref|WP_025538433.1|  DNA-3-methyladenine glycosylase                    155   6e-41   
gb|AES86444.2|  DNA-3-methyladenine glycosylase I                       160   6e-41   
ref|XP_008384390.1|  PREDICTED: uncharacterized protein LOC103446994    160   7e-41   
ref|WP_042142301.1|  DNA-3-methyladenine glycosylase                    155   7e-41   
ref|WP_034833445.1|  DNA-3-methyladenine glycosylase                    155   8e-41   
gb|KDO84451.1|  hypothetical protein CISIN_1g020903mg                   159   8e-41   
ref|WP_011418839.1|  DNA-3-methyladenine glycosylase                    155   8e-41   
ref|XP_011083730.1|  PREDICTED: uncharacterized protein LOC105166174    159   8e-41   
ref|XP_008466607.1|  PREDICTED: uncharacterized protein LOC103503975    158   9e-41   
ref|WP_045027175.1|  DNA-3-methyladenine glycosylase                    155   9e-41   
ref|WP_031483650.1|  DNA-3-methyladenine glycosylase                    155   1e-40   
gb|EYU28897.1|  hypothetical protein MIMGU_mgv1a010390mg                158   1e-40   
ref|WP_015852701.1|  DNA-3-methyladenine glycosylase                    154   1e-40   
gb|AJW71278.1|  DNA-3-methyladenine glycosylase I                       154   1e-40   
gb|EEE58512.1|  hypothetical protein OsJ_09793                          158   1e-40   
emb|CDO98228.1|  unnamed protein product                                160   1e-40   
emb|CDY56177.1|  BnaC05g49360D                                          158   1e-40   
gb|KHN29937.1|  Putative GMP synthase [glutamine-hydrolyzing]           158   1e-40   
ref|WP_009253354.1|  DNA-3-methyladenine glycosylase                    154   1e-40   
gb|EEC74693.1|  hypothetical protein OsI_10398                          158   1e-40   
ref|XP_006363574.1|  PREDICTED: uncharacterized protein LOC102604594    157   1e-40   
ref|WP_010177625.1|  DNA-3-methyladenine glycosylase                    154   2e-40   
ref|XP_003527169.1|  PREDICTED: uncharacterized protein LOC100801...    159   2e-40   
ref|WP_009578488.1|  DNA-3-methyladenine glycosylase                    154   2e-40   
ref|WP_040874488.1|  hypothetical protein                               154   2e-40   
ref|WP_028080572.1|  DNA-3-methyladenine glycosylase                    154   2e-40   
emb|CDX83961.1|  BnaC08g16840D                                          158   2e-40   
ref|WP_015679671.1|  methyladenine glycosylase                          154   3e-40   
ref|NP_001175638.1|  Os08g0489300                                       158   3e-40   
ref|XP_009117787.1|  PREDICTED: uncharacterized protein LOC103842870    158   3e-40   
ref|WP_013454273.1|  DNA-3-methyladenine glycosylase                    154   3e-40   
ref|WP_018450221.1|  DNA-3-methyladenine glycosylase                    153   3e-40   
ref|WP_027874076.1|  DNA-3-methyladenine glycosylase                    153   3e-40   
gb|EKD89118.1|  hypothetical protein ACD_34C00188G0002                  154   3e-40   
ref|XP_010319485.1|  PREDICTED: uncharacterized protein LOC101245051    156   4e-40   
ref|WP_014730253.1|  DNA-3-methyladenine glycosylase                    153   4e-40   
ref|XP_006416858.1|  hypothetical protein EUTSA_v10008041mg             157   5e-40   
ref|WP_034874724.1|  DNA-3-methyladenine glycosylase                    153   5e-40   
ref|WP_038559163.1|  DNA-3-methyladenine glycosylase                    153   5e-40   
ref|WP_006492008.1|  DNA-3-methyladenine glycosylase I                  153   5e-40   
ref|WP_015005086.1|  MULTISPECIES: DNA-3-methyladenine glycosylase      152   5e-40   
ref|WP_006001280.1|  DNA-3-methyladenine glycosylase                    153   5e-40   
ref|XP_011083973.1|  PREDICTED: uncharacterized protein LOC105166...    158   5e-40   
gb|ERL25057.1|  putative DNA-3-methyladenine glycosylase 1              152   6e-40   
emb|CDX96826.1|  BnaA08g23690D                                          157   6e-40   
ref|XP_002892889.1|  methyladenine glycosylase family protein           157   6e-40   
ref|WP_012639169.1|  DNA-3-methyladenine glycosylase                    152   8e-40   
ref|WP_018954437.1|  DNA-3-methyladenine glycosylase                    152   8e-40   
ref|WP_014782161.1|  DNA-3-methyladenine glycosylase                    152   8e-40   
ref|XP_010691584.1|  PREDICTED: uncharacterized protein LOC104904...    157   8e-40   
ref|WP_014964775.1|  MULTISPECIES: DNA-3-methyladenine glycosylase      152   8e-40   
ref|XP_010691585.1|  PREDICTED: uncharacterized protein LOC104904...    157   9e-40   
ref|WP_027963757.1|  3-methyladenine DNA glycosylase                    152   9e-40   
ref|WP_039746854.1|  DNA-3-methyladenine glycosylase                    152   1e-39   
ref|WP_017009674.1|  DNA-3-methyladenine glycosylase                    152   1e-39   
ref|WP_017016372.1|  DNA-3-methyladenine glycosylase                    152   1e-39   
ref|WP_004778150.1|  DNA-3-methyladenine glycosylase I                  152   1e-39   
ref|WP_020776258.1|  methyladenine glycosylase                          152   1e-39   
ref|XP_010532083.1|  PREDICTED: uncharacterized protein LOC104808...    157   1e-39   
ref|WP_016560664.1|  DNA-3-methyladenine glycosylase I                  152   1e-39   
ref|WP_004759507.1|  DNA-3-methyladenine glycosylase I                  152   1e-39   
ref|XP_003604247.1|  DNA-3-methyladenine glycosylase I                  159   1e-39   
ref|WP_029944917.1|  DNA-3-methyladenine glycosylase                    150   1e-39   
ref|XP_002510348.1|  DNA-3-methyladenine glycosylase, putative          155   2e-39   
ref|WP_044972201.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
ref|WP_039653281.1|  3-methyladenine DNA glycosylase                    151   2e-39   
ref|NP_001049281.1|  Os03g0198900                                       157   2e-39   
emb|CDX81744.1|  BnaC08g38570D                                          155   2e-39   
ref|WP_027716728.1|  hypothetical protein                               151   2e-39   
ref|WP_045409429.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
ref|WP_028993120.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
ref|WP_017013895.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
ref|XP_003560364.2|  PREDICTED: uncharacterized protein LOC100841...    157   2e-39   
ref|WP_014433176.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
ref|WP_020733462.1|  hypothetical protein                               151   2e-39   
ref|WP_006803769.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
gb|EFK06934.1|  DNA-3-methyladenine glycosylase I                       154   2e-39   
ref|WP_006980201.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
ref|WP_003871546.1|  MULTISPECIES: DNA-3-methyladenine glycosylase      151   2e-39   
ref|XP_004291899.1|  PREDICTED: uncharacterized protein LOC101306008    155   2e-39   
ref|WP_035274538.1|  DNA-3-methyladenine glycosylase                    151   2e-39   
ref|XP_011031492.1|  PREDICTED: uncharacterized protein LOC105130615    155   2e-39   
ref|WP_029037315.1|  DNA-3-methyladenine glycosylase                    151   3e-39   
ref|WP_023348957.1|  hypothetical protein                               150   3e-39   
ref|XP_006375072.1|  hypothetical protein POPTR_0014s04120g             155   3e-39   
ref|WP_021743896.1|  putative DNA-3-methyladenine glycosylase 1         150   3e-39   
ref|WP_008483471.1|  DNA-3-methyladenine glycosylase                    150   3e-39   
ref|WP_004768957.1|  DNA-3-methyladenine glycosylase I                  150   3e-39   
ref|XP_004501037.1|  PREDICTED: probable GMP synthase [glutamine-...    154   4e-39   
ref|XP_010476700.1|  PREDICTED: uncharacterized protein LOC104755913    155   4e-39   
gb|AIA16559.1|  Methyladenine glycosylase                               150   4e-39   
ref|WP_004754999.1|  DNA-3-methyladenine glycosylase                    150   4e-39   
emb|CAN83288.1|  hypothetical protein VITISV_033233                     154   4e-39   
ref|WP_011369364.1|  DNA-3-methyladenine glycosylase                    150   4e-39   
ref|WP_004786942.1|  DNA-3-methyladenine glycosylase                    150   4e-39   
ref|WP_041018770.1|  DNA-3-methyladenine glycosylase                    150   4e-39   
ref|WP_027182633.1|  DNA-3-methyladenine glycosylase                    150   4e-39   
ref|WP_035998464.1|  DNA-3-methyladenine glycosylase                    150   4e-39   
ref|WP_017730117.1|  hypothetical protein                               150   5e-39   
ref|WP_020763572.1|  MULTISPECIES: DNA-3-methyladenine glycosylase I    150   5e-39   
gb|AEE19248.1|  DNA-3-methyladenine glycosylase I                       150   5e-39   
ref|WP_012214953.1|  DNA-3-methyladenine glycosylase                    150   6e-39   
ref|WP_013387661.1|  DNA-3-methyladenine glycosylase                    150   6e-39   
ref|WP_010518071.1|  DNA-3-methyladenine glycosylase                    150   6e-39   
ref|WP_023845280.1|  3-methyladenine DNA glycosylase                    150   6e-39   
ref|XP_010459133.1|  PREDICTED: uncharacterized protein LOC104740283    154   6e-39   
ref|WP_020002033.1|  MULTISPECIES: hypothetical protein                 150   6e-39   
ref|WP_036654441.1|  hypothetical protein                               150   6e-39   
ref|WP_026749115.1|  DNA-3-methyladenine glycosylase                    150   7e-39   
ref|WP_041295644.1|  DNA-3-methyladenine glycosylase                    150   7e-39   
ref|WP_017895034.1|  hypothetical protein                               150   7e-39   
ref|XP_010497556.1|  PREDICTED: uncharacterized protein LOC104774814    154   7e-39   
ref|WP_040933192.1|  DNA-3-methyladenine glycosylase                    150   7e-39   
emb|CDI05511.1|  3-methyl-adenine DNA glycosylase I, constitutive       149   7e-39   
ref|WP_012994258.1|  DNA-3-methyladenine glycosylase                    149   7e-39   
ref|WP_009034891.1|  DNA-3-methyladenine glycosylase                    150   8e-39   
ref|WP_005772402.1|  DNA-3-methyladenine glycosylase                    150   8e-39   
ref|XP_009110465.1|  PREDICTED: uncharacterized protein LOC103836010    154   8e-39   
ref|WP_013149591.1|  MULTISPECIES: DNA-3-methyladenine glycosylase      149   9e-39   
ref|WP_010662830.1|  DNA-3-methyladenine glycosylase                    150   9e-39   
ref|WP_010957540.1|  DNA-3-methyladenine glycosylase I                  150   1e-38   
ref|WP_010579130.1|  DNA-3-methyladenine glycosylase                    149   1e-38   
ref|WP_011682320.1|  DNA-3-methyladenine glycosylase                    149   1e-38   
ref|WP_036577070.1|  DNA-3-methyladenine glycosylase                    149   1e-38   
ref|WP_024093910.1|  DNA-3-methyladenine glycosylase 1                  149   1e-38   
ref|WP_041048714.1|  DNA-3-methyladenine glycosylase                    149   1e-38   
ref|WP_005769088.1|  DNA-3-methyladenine glycosylase                    149   1e-38   
ref|XP_011017296.1|  PREDICTED: uncharacterized protein LOC105120...    153   1e-38   
ref|XP_010532082.1|  PREDICTED: uncharacterized protein LOC104808...    155   1e-38   
ref|XP_009608296.1|  PREDICTED: uncharacterized protein LOC104102318    153   1e-38   
ref|WP_033412230.1|  3-methyladenine DNA glycosylase                    149   1e-38   
ref|WP_004496801.1|  MULTISPECIES: DNA-3-methyladenine glycosylase      149   1e-38   



>ref|XP_009798027.1| PREDICTED: uncharacterized protein LOC104244298 [Nicotiana sylvestris]
Length=403

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLKKRQ+FRDAFSGFD E VSKY EKKITS SAEYGIE
Sbjct  236   DDNLLFELLVLTGAQVGSDWTSVLKKRQEFRDAFSGFDPEFVSKYNEKKITSTSAEYGIE  295

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRGAVDNS RILE+KK FGSFD YLW +VN+KPIATQYK CNKIPVKTSKSE ISKD
Sbjct  296   LSQVRGAVDNSNRILEIKKVFGSFDKYLWGFVNNKPIATQYKACNKIPVKTSKSETISKD  355

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRH  C  LA  Q P T
Sbjct  356   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHVKCVALAT-QPPPT  402



>ref|XP_004232605.1| PREDICTED: uncharacterized protein LOC101246304 [Solanum lycopersicum]
Length=395

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLKKRQ+FRDAFSGFD E VSKY EKKITS S EYGIE
Sbjct  227   DDNLLFELLVLTGAQVGSDWTSVLKKRQEFRDAFSGFDPEIVSKYNEKKITSTSVEYGIE  286

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQ+RGAVDNS RILE+KK FGSFD YLW +VN+KPIATQYK CNKIPVKTSKSE ISKD
Sbjct  287   LSQIRGAVDNSTRILEIKKTFGSFDKYLWGFVNNKPIATQYKACNKIPVKTSKSETISKD  346

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MVKRGFRYVGPTVIHSFMQAAGLTNDHL  CPRH PC  LA    P
Sbjct  347   MVKRGFRYVGPTVIHSFMQAAGLTNDHLIACPRHLPCVALATQPAP  392



>ref|XP_009593254.1| PREDICTED: uncharacterized protein LOC104089941 [Nicotiana tomentosiformis]
Length=403

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNL FELLVLTGAQVGSDWT VLK+RQDFRDAFSGFD E VSKY EKKITS SAEYGIE
Sbjct  236   DDNLHFELLVLTGAQVGSDWTSVLKRRQDFRDAFSGFDPEIVSKYNEKKITSTSAEYGIE  295

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRGAVDNS RILE+KK FGSFD YLW +VN+KPIATQYK CNKIPVKTSKSE ISKD
Sbjct  296   LSQVRGAVDNSNRILEIKKVFGSFDKYLWGFVNNKPIATQYKACNKIPVKTSKSETISKD  355

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRH  C  LA  QRP
Sbjct  356   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHVKCVALAT-QRP  400



>ref|XP_009629022.1| PREDICTED: dual specificity protein kinase splA-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   296 bits (757),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 152/181 (84%), Gaps = 8/181 (4%)
 Frame = -1

Query  1328  FKIHREE-------DNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTE  1170
              K H EE       DNLLFELLVLTGAQVGSDW  VLKKRQDFRDAFSGFD E  SKY E
Sbjct  239   IKYHDEEWGVPVHDDNLLFELLVLTGAQVGSDWASVLKKRQDFRDAFSGFDPEIASKYNE  298

Query  1169  KKITSVSAEYGIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKI  990
             +KITS SA+Y IELSQVRGAVDNS RILE+KK+FGSF+ YLW +VN+KPI+TQYK CNKI
Sbjct  299   RKITSTSADYSIELSQVRGAVDNSNRILEIKKEFGSFNKYLWGFVNNKPISTQYKACNKI  358

Query  989   PVKTSKSEAISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             PVKTSKSE+ISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRH  C  LA  Q PS
Sbjct  359   PVKTSKSESISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHLQCVTLAT-QPPS  417

Query  809   T  807
             T
Sbjct  418   T  418



>ref|XP_006364818.1| PREDICTED: uncharacterized protein LOC102594852 [Solanum tuberosum]
Length=395

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VL+KRQ+FRDAFSGFD E VSKY EKKITS S EYGIE
Sbjct  227   DDNLLFELLVLTGAQVGSDWTSVLRKRQEFRDAFSGFDPEIVSKYNEKKITSTSVEYGIE  286

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQ+RGAVDNS RILE+KK F SF+ YLW +VN+KPIATQYK CNKIPVKTSKSE ISKD
Sbjct  287   LSQIRGAVDNSTRILEIKKTFDSFNKYLWGFVNNKPIATQYKACNKIPVKTSKSETISKD  346

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MVKRGFRYVGPTVIHSFMQAAGLTNDHL  CPRH  C  LA    P
Sbjct  347   MVKRGFRYVGPTVIHSFMQAAGLTNDHLIACPRHLQCMALATQPAP  392



>ref|XP_009792090.1| PREDICTED: uncharacterized protein LOC104239210 [Nicotiana sylvestris]
Length=412

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 152/181 (84%), Gaps = 9/181 (5%)
 Frame = -1

Query  1328  FKIHREE-------DNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTE  1170
              K H EE       DNLLFELLVLTGAQ+GSDW  VLKKRQDFRDAFSGFD E VS+Y E
Sbjct  233   IKYHDEEWGVPVHDDNLLFELLVLTGAQIGSDWASVLKKRQDFRDAFSGFDPEIVSRYNE  292

Query  1169  KKITSVSAEYGIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKI  990
             +KIT  SA+Y IELSQVRGAVDNS RILE+KK+FGSF+ YLW +VN+KPIATQYK CNKI
Sbjct  293   RKITQ-SADYSIELSQVRGAVDNSNRILEIKKEFGSFNKYLWGFVNNKPIATQYKACNKI  351

Query  989   PVKTSKSEAISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             PVKTSKSE+ISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRH  C  LA  Q PS
Sbjct  352   PVKTSKSESISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHLQCVTLAT-QPPS  410

Query  809   T  807
             T
Sbjct  411   T  411



>ref|XP_009592127.1| PREDICTED: uncharacterized protein LOC104089024 [Nicotiana tomentosiformis]
Length=373

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLT AQVGSDWT VLKKRQDFRDAFSGFD E V+KY EKKI S SA+YGIE
Sbjct  206   DDNLLFELLVLTVAQVGSDWTSVLKKRQDFRDAFSGFDPEIVAKYNEKKINSTSADYGIE  265

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNS RILE+KKQFGSFD YLW +VN+KPIATQYK CNKIPVKTSKSE +SKD
Sbjct  266   LSQVRGVVDNSKRILEIKKQFGSFDKYLWGFVNNKPIATQYKACNKIPVKTSKSETMSKD  325

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MVKRGFRYVGP+VI+SFMQAAGLTNDHL TCPRH  CA LA
Sbjct  326   MVKRGFRYVGPSVIYSFMQAAGLTNDHLITCPRHLQCAALA  366



>emb|CDP04102.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLTGAQVGSDWT VLKKRQDFRDAFSGFDAE ++ +TEKKITS+  +YGIE
Sbjct  232   DDKLLFELLVLTGAQVGSDWTTVLKKRQDFRDAFSGFDAEILATFTEKKITSICTDYGIE  291

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRGAVDN+ RILE+KK+FGSFD YLW++VNHKPI+TQYK C KIPVKTSKSE+ISK 
Sbjct  292   LSQVRGAVDNANRILEIKKEFGSFDKYLWSFVNHKPISTQYKSCLKIPVKTSKSESISKA  351

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MV+RG RYVGPTVIHSFMQAAGLTNDHL TCPRH  C  LA+ Q P+  P++
Sbjct  352   MVRRGLRYVGPTVIHSFMQAAGLTNDHLITCPRHLQCLALAS-QGPAVAPAL  402



>ref|XP_009785679.1| PREDICTED: uncharacterized protein LOC104233914 [Nicotiana sylvestris]
Length=366

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLT AQVGSDWT VLKKRQDFRDAFSGFD E V+KY EKKI S SA+YGIE
Sbjct  198   DDNLLFELLVLTVAQVGSDWTSVLKKRQDFRDAFSGFDPEIVAKYNEKKINSTSADYGIE  257

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNS RILE+KKQFGS D YLW +V++K IATQYK CNKIPVKTSKSE +SKD
Sbjct  258   LSQVRGVVDNSKRILEIKKQFGSLDKYLWGFVSNKTIATQYKACNKIPVKTSKSETMSKD  317

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MVKRGFRYVGP+V+HSFMQA GLTNDHL TCPRH  CA LA  Q P
Sbjct  318   MVKRGFRYVGPSVMHSFMQAVGLTNDHLITCPRHLQCAVLAKTQLP  363



>ref|XP_011022300.1| PREDICTED: uncharacterized protein LOC105124122 isoform X2 [Populus 
euphratica]
Length=417

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELL LTGAQVGS+WT VLKKR+ FR+AFSGFDAE V+K+TEKKITS+SAEYG++
Sbjct  239   DDKLLFELLALTGAQVGSEWTSVLKKREAFREAFSGFDAEIVAKFTEKKITSISAEYGLD  298

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVRG VDNS RILEVK++FGSFD YLW +VNHKPI+TQYK C KIPVKTSKSE ISKD
Sbjct  299   ISQVRGVVDNSNRILEVKREFGSFDKYLWGFVNHKPISTQYKSCQKIPVKTSKSETISKD  358

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFR+VGPTVIHSFMQA GL+NDHL TCPRH  C  LA+ Q P T
Sbjct  359   MVKRGFRFVGPTVIHSFMQAGGLSNDHLITCPRHLQCIALAS-QLPRT  405



>ref|XP_006468594.1| PREDICTED: uncharacterized protein LOC102614205 [Citrus sinensis]
 gb|KDO77184.1| hypothetical protein CISIN_1g017244mg [Citrus sinensis]
Length=375

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLT AQVGSDWT VLKKRQ FR+AFSGFDAE V+K+TEKK+TS+SA Y I+
Sbjct  205   DDKLLFELLVLTAAQVGSDWTSVLKKRQAFREAFSGFDAEVVAKFTEKKMTSLSANYAID  264

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNSIRILEVKKQFGSFD YLW +VNHKPI TQY+   KIPVKTSKSEAISKD
Sbjct  265   LSQVRGIVDNSIRILEVKKQFGSFDKYLWGFVNHKPINTQYRSSQKIPVKTSKSEAISKD  324

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MVK+GFR+VGPTVIHSFMQAAGLTNDHL TC RH  C  LA+ Q P+  P++
Sbjct  325   MVKKGFRFVGPTVIHSFMQAAGLTNDHLITCTRHLQCTALASHQ-PAVAPAL  375



>ref|XP_011022299.1| PREDICTED: uncharacterized protein LOC105124122 isoform X1 [Populus 
euphratica]
Length=417

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELL LTGAQVGS+WT VLKKR+ FR+AFSGFDAE V+K+TEKKITS+SAEYG++
Sbjct  239   DDKLLFELLALTGAQVGSEWTSVLKKREAFREAFSGFDAEIVAKFTEKKITSISAEYGLD  298

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVRG VDNS RILEVK++FGSFD YLW +VNHKPI+TQYK C KIPVKTSKSE ISKD
Sbjct  299   ISQVRGVVDNSNRILEVKREFGSFDKYLWGFVNHKPISTQYKSCQKIPVKTSKSETISKD  358

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFR+VGPTVIHSFMQA GL+NDHL TCPRH  C  LA+ Q P T
Sbjct  359   MVKRGFRFVGPTVIHSFMQAGGLSNDHLITCPRHLQCIALAS-QLPRT  405



>ref|XP_002303720.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
 gb|EEE78699.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
Length=417

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELL LTGAQVGS+WT VLKKR+ FR+AFSGFDAE V+K+TEKKI S+SAEYG++
Sbjct  239   DDKLLFELLALTGAQVGSEWTSVLKKREAFREAFSGFDAEIVAKFTEKKIASISAEYGLD  298

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVRG VDNS RILEVK++FGSFD YLW YVNHKPI+TQYK C KIPVKTSKSE ISKD
Sbjct  299   ISQVRGVVDNSNRILEVKREFGSFDEYLWGYVNHKPISTQYKSCQKIPVKTSKSETISKD  358

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFR+VGPTVIHSFMQA GL+NDHL TCPRH  C  LA+ Q P T
Sbjct  359   MVKRGFRFVGPTVIHSFMQAGGLSNDHLITCPRHLQCIALAS-QLPRT  405



>ref|XP_002303719.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
 gb|EEE78698.2| hypothetical protein POPTR_0003s15520g [Populus trichocarpa]
Length=420

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 154/189 (81%), Gaps = 9/189 (5%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELL LTGAQVGS+WT VLKKR+ FR+AFSGFDAE V+K+TEKKI S+SAEYG++
Sbjct  239   DDKLLFELLALTGAQVGSEWTSVLKKREAFREAFSGFDAEIVAKFTEKKIASISAEYGLD  298

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVRG VDNS RILEVK++FGSFD YLW YVNHKPI+TQYK C KIPVKTSKSE ISKD
Sbjct  299   ISQVRGVVDNSNRILEVKREFGSFDEYLWGYVNHKPISTQYKSCQKIPVKTSKSETISKD  358

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTT--PSI*INCLQ  777
             MVKRGFR+VGPTVIHSFMQA GL+NDHL TCPRH  C  LA+ Q P T   PS      Q
Sbjct  359   MVKRGFRFVGPTVIHSFMQAGGLSNDHLITCPRHLQCIALAS-QLPRTVAPPS------Q  411

Query  776   QIIVTYYHD  750
             + ++   HD
Sbjct  412   KKLICKQHD  420



>ref|XP_007040982.1| DNA glycosylase superfamily protein, putative [Theobroma cacao]
 gb|EOX96813.1| DNA glycosylase superfamily protein, putative [Theobroma cacao]
Length=398

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFEL+VL GAQVGSDWT VLKKRQDFR+AFSGFDAE ++ ++EK I S+S++YGI+
Sbjct  228   DDKLLFELVVLIGAQVGSDWTSVLKKRQDFREAFSGFDAEVIAGFSEKNILSISSDYGID  287

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVR AVDN+ RILEV+K+FGSF+NYLW +VNHKPI TQYK C+KIPVKTSKSEAISKD
Sbjct  288   VSQVRAAVDNANRILEVRKEFGSFNNYLWGFVNHKPIVTQYKSCHKIPVKTSKSEAISKD  347

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MV+RGFR+VGPTVIHS MQAAGLTNDHL+TCPRH  C  LA+ Q P+  P++
Sbjct  348   MVRRGFRFVGPTVIHSLMQAAGLTNDHLSTCPRHLQCIALAS-QFPTVAPAL  398



>ref|XP_002530111.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
 gb|EEF32255.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
Length=403

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVLTGAQ+GSDWT VLKKR+ FR+AFSGFDAE V+K++EKK TS+SAEYG+E
Sbjct  242   DDKMLFELLVLTGAQIGSDWTSVLKKREAFREAFSGFDAEIVAKFSEKKTTSISAEYGME  301

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVRG VDNS RIL+VKK+FGSFD YLW +VNHKPI TQY+  NKIPVKTSKSE ISKD
Sbjct  302   ISQVRGVVDNSNRILQVKKEFGSFDKYLWGFVNHKPITTQYRSSNKIPVKTSKSETISKD  361

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MVKRGFRYVGPTV+HSFMQAAGL+NDHL +C RHH C  LA+
Sbjct  362   MVKRGFRYVGPTVMHSFMQAAGLSNDHLISCSRHHQCLALAS  403



>ref|XP_010100595.1| Putative Glutamine amidotransferase [Morus notabilis]
 gb|EXB83232.1| Putative Glutamine amidotransferase [Morus notabilis]
Length=394

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLTGAQVGSDWT VLKKR+ FR+AFSGFDAEAVSKY EKKITS+ A+YGIE
Sbjct  224   DDKLLFELLVLTGAQVGSDWTSVLKKREIFRNAFSGFDAEAVSKYNEKKITSIGADYGIE  283

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LS +RGAVDN+ RILE+KK+FGS + YLW +VN+K I+TQYK C KIPVKTSKSE+ISKD
Sbjct  284   LSLIRGAVDNANRILEIKKEFGSLNKYLWGFVNNKLISTQYKSCQKIPVKTSKSESISKD  343

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MV+RGFR+VGPTVI+SFMQAAGLTNDHL TCPRH  C  LA+ Q PS  P++
Sbjct  344   MVRRGFRFVGPTVIYSFMQAAGLTNDHLITCPRHLQCLALAS-QLPSVAPAL  394



>ref|XP_004248406.1| PREDICTED: uncharacterized protein LOC101258999 [Solanum lycopersicum]
Length=348

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLT AQVGSDWT VLK+RQDFRDAFSGFDAE V+KY EKKI S S EYGIE
Sbjct  184   DDNLLFELLVLTVAQVGSDWTSVLKRRQDFRDAFSGFDAEVVAKYNEKKIYSTSIEYGIE  243

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNS RILE+KKQFGSF  Y+W +V++KPI TQYK CNKIPVKTSKSE +SKD
Sbjct  244   LSQVRGVVDNSKRILEMKKQFGSFHKYVWGFVSNKPIRTQYKACNKIPVKTSKSETMSKD  303

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCA  837
             MVK+GFRYVGPT+IHSFMQA GLTNDH+ TCPRH  CA
Sbjct  304   MVKKGFRYVGPTIIHSFMQAVGLTNDHIITCPRHAQCA  341



>ref|XP_002299382.2| hypothetical protein POPTR_0001s12320g [Populus trichocarpa]
 gb|EEE84187.2| hypothetical protein POPTR_0001s12320g [Populus trichocarpa]
Length=373

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVLTGAQVGSDWT VLKKR+ FR+AFSGFDAE V+K+TEKKI S+SAEYGI+
Sbjct  202   DDKMLFELLVLTGAQVGSDWTSVLKKREAFREAFSGFDAEVVAKFTEKKIASISAEYGID  261

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
              SQVRG VDNS +I+EVK++FGSFD YLW YVNHKPI TQYK C KIPVKTSKSE ISKD
Sbjct  262   TSQVRGVVDNSNKIMEVKREFGSFDKYLWEYVNHKPIFTQYKSCQKIPVKTSKSETISKD  321

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFR+VGPTVIHSFMQA GL NDHL TCPRH     LA+ Q PST
Sbjct  322   MVKRGFRFVGPTVIHSFMQAGGLRNDHLITCPRHLQYTALAS-QHPST  368



>gb|KJB14124.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
 gb|KJB14127.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
 gb|KJB14129.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
Length=406

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D++LFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAE V+ +TEK++T++S+EYGI+
Sbjct  234   DDSMLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAETVANFTEKQMTTISSEYGID  293

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILEVK++FGSFD Y+W +VNHKP++TQYK+ +KIPVKTSKSE+ISKD
Sbjct  294   ISRVRGVVDNSNRILEVKREFGSFDKYIWGFVNHKPMSTQYKFDHKIPVKTSKSESISKD  353

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MV+RGFR+VGPTV++SFMQAAGLTNDHL TC RH PCA LA  QRP
Sbjct  354   MVRRGFRFVGPTVVYSFMQAAGLTNDHLITCHRHLPCALLAI-QRP  398



>ref|XP_002312220.1| methyladenine glycosylase family protein [Populus trichocarpa]
 gb|ABK95238.1| unknown [Populus trichocarpa]
 gb|EEE89587.1| methyladenine glycosylase family protein [Populus trichocarpa]
Length=403

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAE V+  +EK+I S+SAEYGI+
Sbjct  232   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAEIVANISEKQIMSISAEYGID  291

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILE+KK+FGSFD Y+W +VN+KPI+T YK+ +KIPVKTSKSE ISKD
Sbjct  292   MSRVRGVVDNSNRILEIKKEFGSFDRYIWTFVNNKPISTSYKFGHKIPVKTSKSETISKD  351

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPT++HSFMQAAGLTNDHL TC RH PC  +AA +RP+
Sbjct  352   MVRRGFRFVGPTMVHSFMQAAGLTNDHLITCHRHLPCTLMAAARRPT  398



>ref|XP_011008217.1| PREDICTED: uncharacterized protein LOC105113658 [Populus euphratica]
Length=410

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVLTGAQVGSDWT +LKKR+ FR+AFSGFDAE V+K+TEKKI S+S+E+GIE
Sbjct  239   DDKMLFELLVLTGAQVGSDWTSILKKREAFREAFSGFDAEVVAKFTEKKIASISSEHGIE  298

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
              SQVRG VDNS +ILEVK++FGSFD YLW YVNHKPI +QYK C KIPVKTSKSE ISKD
Sbjct  299   TSQVRGVVDNSNKILEVKREFGSFDKYLWGYVNHKPIFSQYKSCQKIPVKTSKSETISKD  358

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFR+VGPTVIHSFMQA GL NDHL TCPRH     LA+ Q PST
Sbjct  359   MVKRGFRFVGPTVIHSFMQAGGLRNDHLITCPRHLQSTALAS-QHPST  405



>ref|XP_010260812.1| PREDICTED: uncharacterized protein LOC104599795 [Nelumbo nucifera]
Length=406

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAE VS +TE++ITS+SA+Y I+
Sbjct  235   DDKLLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAEVVSTFTERQITSISADYSID  294

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS  ILE++++FGSF  Y+W +VNHKPI+TQYK C++IPVKTSKSE+ISKD
Sbjct  295   ISRVRGVVDNSNCILEIRREFGSFAKYIWGFVNHKPISTQYKSCHRIPVKTSKSESISKD  354

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MV+RGFR VGPTVIHSFMQAAGLTNDHL TC RH  C  LA+  +PS  P++
Sbjct  355   MVRRGFRTVGPTVIHSFMQAAGLTNDHLITCTRHLQCVALASSHQPSVAPAL  406



>ref|XP_006448576.1| hypothetical protein CICLE_v10015639mg [Citrus clementina]
 gb|ESR61816.1| hypothetical protein CICLE_v10015639mg [Citrus clementina]
Length=375

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 146/172 (85%), Gaps = 1/172 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLT AQVGSDWT VLKKR+ FR+AFSGFDAE V+K+TEKKITS+SA Y I+
Sbjct  205   DDKLLFELLVLTAAQVGSDWTSVLKKRRAFREAFSGFDAEVVAKFTEKKITSLSANYAID  264

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNSIRILEVKKQFGSFD YLW +VNHK I TQY+   KIP KTSKSEAISKD
Sbjct  265   LSQVRGIVDNSIRILEVKKQFGSFDKYLWGFVNHKTINTQYRSSQKIPAKTSKSEAISKD  324

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MVK+GFR+VGPTVIHSFMQAAGL+NDHL TC RH  C  LA+ Q P+  P++
Sbjct  325   MVKKGFRFVGPTVIHSFMQAAGLSNDHLITCTRHLQCTALASHQ-PAVAPAL  375



>ref|XP_006352614.1| PREDICTED: uncharacterized protein LOC102598399 [Solanum tuberosum]
Length=340

 Score =   268 bits (684),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLT AQVGSDWT VLK+RQDFRDAFSGFDAE V+KY EKKI S S  YGIE
Sbjct  176   DDNLLFELLVLTVAQVGSDWTSVLKRRQDFRDAFSGFDAEIVAKYNEKKINSTSIVYGIE  235

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNS RILE+KKQFGSF  YLW +V++K I TQYK CNKIPVKTSKSE +SKD
Sbjct  236   LSQVRGVVDNSKRILEMKKQFGSFHKYLWGFVSNKTIKTQYKACNKIPVKTSKSETMSKD  295

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCA  837
             MVK+GFRYVGPT+IHSFMQA GLTNDH+ TCPRH  CA
Sbjct  296   MVKKGFRYVGPTIIHSFMQAVGLTNDHIITCPRHVQCA  333



>ref|XP_011096870.1| PREDICTED: uncharacterized protein LOC105175920 [Sesamum indicum]
Length=374

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLTGAQVGSDW+ VL+KRQD+RDAFSGFDAE VSKY+EKK++ +S EYG+E
Sbjct  209   DDKLLFELLVLTGAQVGSDWSSVLRKRQDYRDAFSGFDAEIVSKYSEKKMSWMSGEYGME  268

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LS +RG VDNS RILE+KK+FGSFD YLW +VN KP+ TQYKW +KIP KTSKSE ISKD
Sbjct  269   LSLIRGVVDNSKRILEIKKEFGSFDKYLWGFVNEKPMVTQYKWLHKIPAKTSKSETISKD  328

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAE  834
             MV+RGFR VGPTVIHSFMQAAGLTNDHL TCPRH  C +
Sbjct  329   MVRRGFRLVGPTVIHSFMQAAGLTNDHLITCPRHSQCLD  367



>ref|XP_002263612.1| PREDICTED: uncharacterized protein LOC100256507 [Vitis vinifera]
 emb|CBI27376.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV+TGAQVGSDWT VLKKRQ++RDA SG+DAE V K++EKKITS+SA YGI+
Sbjct  228   DDKRLFELLVMTGAQVGSDWTTVLKKRQEYRDALSGYDAEIVGKFSEKKITSISAYYGID  287

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNS RILE+K++FGSF  Y+W +VNHKPI TQYK C+KIPVKTSKSE+ISKD
Sbjct  288   LSQVRGVVDNSNRILEIKREFGSFHKYIWGFVNHKPITTQYKSCHKIPVKTSKSESISKD  347

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MV+RGFR VGPTVI+SFMQAAGLTNDHL +CPRH  C  L++ Q P+  P++
Sbjct  348   MVRRGFRLVGPTVIYSFMQAAGLTNDHLISCPRHLQCIALSSHQ-PAVAPAL  398



>ref|XP_002315089.2| methyladenine glycosylase family protein [Populus trichocarpa]
 gb|EEF01260.2| methyladenine glycosylase family protein [Populus trichocarpa]
Length=411

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAE V+  TEK++ S+SAEYGIE
Sbjct  240   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAEIVANITEKQMMSISAEYGIE  299

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILE+KK+FGSFD Y+W +VN+KP + QYK+ +KIPVKTSKSE ISKD
Sbjct  300   ISRVRGVVDNSKRILEIKKEFGSFDRYIWTFVNNKPFSNQYKFGHKIPVKTSKSETISKD  359

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPT++HSFMQA GLTNDHL TC RH PC  +AA +RP+
Sbjct  360   MVRRGFRFVGPTMVHSFMQAVGLTNDHLITCHRHLPCTLMAA-RRPT  405



>emb|CAN68394.1| hypothetical protein VITISV_042519 [Vitis vinifera]
Length=398

 Score =   267 bits (683),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV+TGAQVGSDWT VLKKRQ++RDAFSG+DAE V K++EKKITS+SA YGI+
Sbjct  228   DDKRLFELLVMTGAQVGSDWTTVLKKRQEYRDAFSGYDAEIVGKFSEKKITSISAYYGID  287

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQVRG VDNS RILE+K++FGSF  Y+W +VNHKPI TQ K C+KIPVKTSKSE+ISKD
Sbjct  288   LSQVRGVVDNSNRILEIKREFGSFHKYIWGFVNHKPITTQXKSCHKIPVKTSKSESISKD  347

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             MV+RGFR VGPTVI+SFMQAAGLTNDHL +CPRH  C  L++ Q P+  P++
Sbjct  348   MVRRGFRLVGPTVIYSFMQAAGLTNDHLISCPRHLQCIALSSHQ-PAVAPAL  398



>gb|KHG21574.1| putative GMP synthase [glutamine-hydrolyzing] [Gossypium arboreum]
Length=360

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = -1

Query  1292  ELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIELSQVRG  1113
             +LLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAE V+ +TEK++T++S+EYGI++S+VRG
Sbjct  194   KLLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAETVANFTEKQMTTISSEYGIDISRVRG  253

Query  1112  AVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKDMVKRGF  933
              VDN+ RILEVK++FGSFD Y+W +VNHKP++TQYK+ +KIPVKTSKSE+ISKDMV+RGF
Sbjct  254   VVDNANRILEVKREFGSFDKYIWGFVNHKPMSTQYKFDHKIPVKTSKSESISKDMVRRGF  313

Query  932   RYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             R+VGPTV+HSFMQAAGLTNDHL TC RH PCA LA  QRP
Sbjct  314   RFVGPTVVHSFMQAAGLTNDHLITCHRHLPCALLAI-QRP  352



>ref|XP_012092185.1| PREDICTED: uncharacterized protein LOC105649949 [Jatropha curcas]
 gb|KDP44662.1| hypothetical protein JCGZ_19698 [Jatropha curcas]
Length=381

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVL+GAQVGSDWT +LKKRQ FRDAFSGF+AE V+  TEK+I S+S E+GIE
Sbjct  216   DDKLLFELLVLSGAQVGSDWTSILKKRQAFRDAFSGFEAETVANITEKQIISISTEHGIE  275

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ RILE+KKQFGSF+ Y+WA+VN+K I+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  276   ISRVRGVVDNANRILEIKKQFGSFEKYIWAFVNNKAISTQYKFGHKIPVKTSKSESISKD  335

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFRYVGPTV+HSFMQAAGLTNDHL TC RH PC  LAA +RP+
Sbjct  336   MVRRGFRYVGPTVVHSFMQAAGLTNDHLITCHRHLPCTLLAA-RRPT  381



>ref|XP_012075493.1| PREDICTED: uncharacterized protein LOC105636759 [Jatropha curcas]
 gb|KDP35084.1| hypothetical protein JCGZ_10993 [Jatropha curcas]
Length=400

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +L ELLVLTG QVGSDWT VLKKRQ  R+AFS FDAE V+++ EKKI S+S +YGI+
Sbjct  232   DDKMLLELLVLTGTQVGSDWTSVLKKRQSLREAFSWFDAEIVAEFNEKKIISISTQYGID  291

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
              SQVRG VDNS RIL+VK++FGSFD YLW +VN+KPI+TQYK CNKIPVKTSKSE+ISKD
Sbjct  292   NSQVRGIVDNSSRILQVKREFGSFDKYLWRFVNNKPISTQYKSCNKIPVKTSKSESISKD  351

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFR+VGPTVIHSFMQAAGL+NDHL TCPRH     L  P  PS+
Sbjct  352   MVKRGFRFVGPTVIHSFMQAAGLSNDHLITCPRHQQIQLLQNPNSPSS  399



>ref|XP_011012959.1| PREDICTED: uncharacterized protein LOC105117079 [Populus euphratica]
Length=402

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDA  V+  +EK+I S+SAEYGI+
Sbjct  231   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAGIVANISEKQIMSISAEYGID  290

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILE+KK+FGSFD Y+  +VN+KPI+T YK+ +KIPVKTSKSE ISKD
Sbjct  291   MSRVRGVVDNSNRILEIKKEFGSFDRYIRTFVNNKPISTSYKFGHKIPVKTSKSETISKD  350

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPT++HSFMQAAGLTNDHL TC RH PC  +AA +RP+
Sbjct  351   MVRRGFRFVGPTMVHSFMQAAGLTNDHLITCHRHIPCTLMAAARRPT  397



>ref|XP_002515807.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
 gb|EEF46588.1| DNA-3-methyladenine glycosylase, putative, partial [Ricinus communis]
Length=404

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAE V+ +TEK + S+S EYGI+
Sbjct  242   DDKLLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAEIVADFTEKHMISISTEYGID  301

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +++VRG VDNS R+LE+KK+FGSF  Y+WA+VN+KPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  302   INRVRGVVDNSNRVLEIKKEFGSFSKYIWAFVNNKPISTQYKFGHKIPVKTSKSESISKD  361

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPT++HSFMQAAGLTNDHL TC RH PC  L A
Sbjct  362   MVRRGFRFVGPTMVHSFMQAAGLTNDHLITCHRHLPCTLLTA  403



>ref|XP_007022761.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY14286.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
Length=409

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D++LFELLVL+GAQVGSDW  +LKKRQDFRDAFSGFDAE V+K+T+K++T++S+EYGI+
Sbjct  236   DDSMLFELLVLSGAQVGSDWISILKKRQDFRDAFSGFDAETVAKFTDKEMTTISSEYGID  295

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+V G VDNS RILEVK QFGSFD Y+W +VNHK I+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  296   ISRVLGVVDNSNRILEVKGQFGSFDKYIWGFVNHKAISTQYKFGHKIPVKTSKSESISKD  355

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             M++RGFR VGPTV+HSFMQAAGLTNDHL TC RH PC  LAA
Sbjct  356   MLRRGFRCVGPTVVHSFMQAAGLTNDHLITCHRHLPCTLLAA  397



>ref|XP_007022762.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY14287.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
Length=413

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D++LFELLVL+GAQVGSDW  +LKKRQDFRDAFSGFDAE V+K+T+K++T++S+EYGI+
Sbjct  240   DDSMLFELLVLSGAQVGSDWISILKKRQDFRDAFSGFDAETVAKFTDKEMTTISSEYGID  299

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+V G VDNS RILEVK QFGSFD Y+W +VNHK I+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  300   ISRVLGVVDNSNRILEVKGQFGSFDKYIWGFVNHKAISTQYKFGHKIPVKTSKSESISKD  359

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             M++RGFR VGPTV+HSFMQAAGLTNDHL TC RH PC  LAA
Sbjct  360   MLRRGFRCVGPTVVHSFMQAAGLTNDHLITCHRHLPCTLLAA  401



>ref|XP_011014375.1| PREDICTED: uncharacterized protein LOC105118177 [Populus euphratica]
Length=406

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQ+FRDAFSGFDAE V+  TEK++ S+SAEYGIE
Sbjct  235   DDKMLFELLVLSGAQVGSDWTSILKKRQNFRDAFSGFDAEIVANITEKQMMSISAEYGIE  294

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILE+K++FGSFD Y+W +VN+KP + QYK+ +KIPVKTSKSE ISKD
Sbjct  295   ISRVRGVVDNSKRILEIKREFGSFDRYIWKFVNNKPFSNQYKFGHKIPVKTSKSETISKD  354

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPT++HSFMQA GLTNDHL TC RH PC  +AA +RP+
Sbjct  355   MVRRGFRFVGPTMVHSFMQAVGLTNDHLITCHRHLPCTLMAA-RRPT  400



>gb|KJB14128.1| hypothetical protein B456_002G111100 [Gossypium raimondii]
Length=404

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 150/166 (90%), Gaps = 3/166 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D++LFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAE V+ +TEK++T++S+EYGI+
Sbjct  234   DDSMLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAETVANFTEKQMTTISSEYGID  293

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS   L+VK++FGSFD Y+W +VNHKP++TQYK+ +KIPVKTSKSE+ISKD
Sbjct  294   ISRVRGVVDNSN--LQVKREFGSFDKYIWGFVNHKPMSTQYKFDHKIPVKTSKSESISKD  351

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MV+RGFR+VGPTV++SFMQAAGLTNDHL TC RH PCA LA  QRP
Sbjct  352   MVRRGFRFVGPTVVYSFMQAAGLTNDHLITCHRHLPCALLAI-QRP  396



>ref|XP_010060864.1| PREDICTED: uncharacterized protein LOC104448688 [Eucalyptus grandis]
 gb|KCW67745.1| hypothetical protein EUGRSUZ_F01478 [Eucalyptus grandis]
Length=289

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +L+KRQDFR+ FSGF+AE V+ ++EK+IT +S++YGI+
Sbjct  124   DDRVLFELLVLSGAQVGSDWTSILRKRQDFRNVFSGFEAEIVATFSEKQITWISSKYGID  183

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +++VRG VDNS+RILE+K++FGSFD Y+W +VN+KPI+T+YKW +KIPVKTSKSE+ISKD
Sbjct  184   VTRVRGVVDNSLRILEIKREFGSFDKYIWGFVNYKPISTRYKWGHKIPVKTSKSESISKD  243

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR VGPTV+HSFMQAAGLTNDHL TC RH  C ELA
Sbjct  244   MVRRGFRSVGPTVVHSFMQAAGLTNDHLITCHRHLQCTELA  284



>ref|XP_004295546.1| PREDICTED: uncharacterized protein LOC101298985 [Fragaria vesca 
subsp. vesca]
Length=410

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFRDAFSGFDAEAV+  T+K++ S+ +EYGI+
Sbjct  242   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRDAFSGFDAEAVANLTDKQMISICSEYGID  301

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILEVK++FGSF  Y+W +VNHKPI+ QYK   KIPVKTSKSE+ISKD
Sbjct  302   ISRVRGVVDNSNRILEVKREFGSFHKYIWGFVNHKPISPQYKQGYKIPVKTSKSESISKD  361

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTV+HSFMQA+GLTNDHLTTC RH  C  LAA
Sbjct  362   MVRRGFRFVGPTVVHSFMQASGLTNDHLTTCHRHLQCTLLAA  403



>ref|XP_006422312.1| hypothetical protein CICLE_v10005040mg [Citrus clementina]
 ref|XP_006493734.1| PREDICTED: uncharacterized protein LOC102621461 [Citrus sinensis]
 gb|ESR35552.1| hypothetical protein CICLE_v10005040mg [Citrus clementina]
 gb|KDO61513.1| hypothetical protein CISIN_1g041076mg [Citrus sinensis]
Length=420

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  1307  DNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIEL  1128
             DN+LFELLVL+GAQVGSDWT +LKKRQ FRDAFSGF+AE V+K ++K++ S+S EY I++
Sbjct  238   DNMLFELLVLSGAQVGSDWTSILKKRQGFRDAFSGFEAETVAKLSDKQMMSISTEYSIDM  297

Query  1127  SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKDM  948
             S+VRG VDNS RILEVK+ FGSF+ Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKDM
Sbjct  298   SRVRGVVDNSNRILEVKRVFGSFEKYIWGFVNHKPISTQYKFGHKIPVKTSKSESISKDM  357

Query  947   VKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             V+RGFR+VGPTV+HSFMQAAGLTNDHL  C RH PC  LAA
Sbjct  358   VRRGFRFVGPTVVHSFMQAAGLTNDHLIICHRHLPCTLLAA  398



>ref|XP_007149154.1| hypothetical protein PHAVU_005G045900g [Phaseolus vulgaris]
 gb|ESW21148.1| hypothetical protein PHAVU_005G045900g [Phaseolus vulgaris]
Length=405

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT  LKKRQDFR AFS FDAE V+  T+K++ S+S+EYGI+
Sbjct  235   DDKMLFELLVLSGAQVGSDWTSTLKKRQDFRAAFSDFDAETVANLTDKQMMSISSEYGID  294

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +ILE+KK FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  295   ISRVRGVVDNANQILEIKKDFGSFDKYIWGFVNHKPISTQYKFGHKIPVKTSKSESISKD  354

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPS  798
             MV+RG+R+VGPTV+HSFMQAAGLTNDHL TC RH  C  LAA  RP T  S
Sbjct  355   MVRRGYRFVGPTVVHSFMQAAGLTNDHLITCHRHLQCTLLAA--RPHTIES  403



>ref|XP_010928808.1| PREDICTED: uncharacterized protein LOC105050470 [Elaeis guineensis]
Length=393

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVG DWT +L+KR DFR AF+ FDAE VSK TE+++TS+S EYG++
Sbjct  231   DDKMLFELLVLSGAQVGLDWTTILRKRNDFRAAFAEFDAEVVSKLTERQMTSISMEYGLD  290

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L +VRG VDN+ RILEV+K+FGS D YLW +VN KPI+T YK C KIPVKTSKSE+ISKD
Sbjct  291   LGRVRGTVDNANRILEVRKEFGSLDKYLWGFVNSKPISTNYKSCRKIPVKTSKSESISKD  350

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TCPRH  C+  AA
Sbjct  351   MVRRGFRFVGPTVVHSFMQAAGLTNDHLITCPRHLYCSSAAA  392



>ref|XP_009363313.1| PREDICTED: uncharacterized protein LOC103953300 [Pyrus x bretschneideri]
Length=421

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFSGFDAE V+  +EK++ S+++EYGIE
Sbjct  251   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRTAFSGFDAETVANLSEKQMMSIASEYGIE  310

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S++RG VDNS RILE+KK+FGSFD Y+W +VN KPI+ QYK   KIPVKTSKSE+ISKD
Sbjct  311   ISRIRGVVDNSNRILEIKKEFGSFDKYIWGFVNQKPISPQYKLGYKIPVKTSKSESISKD  370

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPTV+HSFMQA+G+TNDHL TC RH  C  LAA +RP+
Sbjct  371   MVRRGFRFVGPTVVHSFMQASGVTNDHLITCHRHLQCTLLAA-RRPA  416



>ref|XP_008346069.1| PREDICTED: uncharacterized protein LOC103409028 [Malus domestica]
Length=419

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR+AFSGFDAE V+  +EK++ S+++EYGIE
Sbjct  249   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRNAFSGFDAETVANLSEKQMMSIASEYGIE  308

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S++RG VDNS RILE+KK+FGSFD Y+W +VN KPI+  YK   KIPVKTSKSE+ISKD
Sbjct  309   ISRIRGVVDNSNRILEIKKEFGSFDKYIWGFVNQKPISPXYKLGYKIPVKTSKSESISKD  368

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPTV+HSFMQA+GLTNDHL TC RH  C  LAA +RP+
Sbjct  369   MVRRGFRFVGPTVVHSFMQASGLTNDHLITCHRHLQCTLLAA-RRPA  414



>ref|XP_008383216.1| PREDICTED: uncharacterized protein LOC103445940 [Malus domestica]
Length=424

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVLTGAQVGSDWT +LKKRQDFRDAFSGFDAE V+  ++K++ S+++EYGIE
Sbjct  254   DDKMLFELLVLTGAQVGSDWTSILKKRQDFRDAFSGFDAETVANLSDKQMMSIASEYGIE  313

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S++RG VDNS RILE+KK+FGSFD Y+W +VN KPI+ QYK   KIPVKTSKSE+IS+D
Sbjct  314   ISRIRGVVDNSNRILEIKKEFGSFDKYIWGFVNEKPISPQYKLGYKIPVKTSKSESISRD  373

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTV+HSFMQA+GLTNDHL TC  H  C  LAA
Sbjct  374   MVRRGFRFVGPTVVHSFMQASGLTNDHLITCHSHLRCTLLAA  415



>ref|XP_009368609.1| PREDICTED: uncharacterized protein LOC103958107 [Pyrus x bretschneideri]
Length=424

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVLTGAQVGSDWT +LKKRQDFRDAFSGFDAE V+  ++K++ S+++EYGIE
Sbjct  254   DDKMLFELLVLTGAQVGSDWTSILKKRQDFRDAFSGFDAETVANLSDKQMMSIASEYGIE  313

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S++RG VDNS RILE+KK FGSFD Y+W +VN KPI+ QYK   KIPVKTSKSE+ISKD
Sbjct  314   ISRIRGVVDNSNRILEIKKAFGSFDKYIWGFVNEKPISPQYKLGYKIPVKTSKSESISKD  373

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTV+HSFMQA+GLTNDHL TC  H  C  LAA
Sbjct  374   MVRRGFRFVGPTVVHSFMQASGLTNDHLITCHSHLRCTLLAA  415



>ref|XP_007211731.1| hypothetical protein PRUPE_ppa006139mg [Prunus persica]
 gb|EMJ12930.1| hypothetical protein PRUPE_ppa006139mg [Prunus persica]
Length=426

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR+AFS FDAE V+ +T+K++ S+ +EYGI+
Sbjct  256   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRNAFSDFDAEIVANFTDKQMVSIGSEYGID  315

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILE+KK+FGSFD Y+W +VN KPI+ QYK   KIPVKTSKSE+ISKD
Sbjct  316   ISRVRGVVDNSNRILEIKKEFGSFDKYIWGFVNQKPISPQYKLGYKIPVKTSKSESISKD  375

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPTV+HSFMQA+GLTNDHL TC RH  C  LAA +RP+
Sbjct  376   MVRRGFRFVGPTVVHSFMQASGLTNDHLITCHRHLQCTLLAA-RRPT  421



>ref|XP_009368625.1| PREDICTED: uncharacterized protein LOC103958120 [Pyrus x bretschneideri]
Length=424

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVLTGAQVGSDWT +LKKRQDFRDAFSGFDAE V+  ++K++ S+++EYGIE
Sbjct  254   DDKMLFELLVLTGAQVGSDWTSILKKRQDFRDAFSGFDAETVANLSDKQMMSIASEYGIE  313

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S++RG VDNS RILE+KK FGSFD Y+W +VN KPI+ QYK   KIPVKTSKSE+IS+D
Sbjct  314   ISRIRGVVDNSNRILEIKKAFGSFDKYIWGFVNEKPISPQYKLGYKIPVKTSKSESISRD  373

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTV+HSFMQA+GLTNDHL TC  H  C  LAA
Sbjct  374   MVRRGFRFVGPTVVHSFMQASGLTNDHLITCHSHLRCTLLAA  415



>ref|XP_008225980.1| PREDICTED: uncharacterized protein LOC103325571 [Prunus mume]
Length=424

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFS FDAE V+ +T+K++ S+ +EYGI+
Sbjct  254   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRSAFSDFDAEIVANFTDKQMVSIGSEYGID  313

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILE+KK+FGSFD Y+W +VN KPI+ QYK   KIPVKTSKSE+ISKD
Sbjct  314   ISRVRGVVDNSNRILEIKKEFGSFDKYIWGFVNQKPISPQYKLGYKIPVKTSKSESISKD  373

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             MV+RGFR+VGPTV+HSFMQA+GLTNDHL TC RH  C  LAA +RP+
Sbjct  374   MVRRGFRFVGPTVVHSFMQASGLTNDHLITCHRHLQCTLLAA-RRPT  419



>ref|XP_003546838.1| PREDICTED: uncharacterized protein LOC100811352 [Glycine max]
Length=400

 Score =   254 bits (648),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT  LKKR DFR AFS FDAE V+  T+K++ S+S+EYGI+
Sbjct  234   DDKMLFELLVLSGAQVGSDWTSTLKKRLDFRAAFSEFDAETVANLTDKQMMSISSEYGID  293

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +ILE+KK FGSFD Y+W +VNHKP++TQYK+ +KIPVKTSKSE+ISKD
Sbjct  294   ISRVRGVVDNANQILEIKKDFGSFDKYIWGFVNHKPLSTQYKFGHKIPVKTSKSESISKD  353

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFRYVGPTV+HSFMQA+GLTNDHL TC RH  C  LAA
Sbjct  354   MVRRGFRYVGPTVVHSFMQASGLTNDHLITCHRHLQCTLLAA  395



>ref|XP_008798468.1| PREDICTED: uncharacterized protein LOC103713352 [Phoenix dactylifera]
Length=400

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVG DWT +L+KR DFR AF+ FDAE VSK+TE++++S+S+EYG++
Sbjct  232   DDKMLFELLVLSGAQVGLDWTTILRKRNDFRAAFAEFDAEVVSKFTERQMSSISSEYGLD  291

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L +VR  VDN+ RILEV+K+FGS D YLW +VN KPI+T YK C KIPVKTSKSE+ISKD
Sbjct  292   LGRVRRTVDNANRILEVRKEFGSLDKYLWGFVNSKPISTNYKTCRKIPVKTSKSESISKD  351

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAEL  831
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TCPRH  C+ +
Sbjct  352   MVRRGFRFVGPTVVHSFMQAAGLTNDHLITCPRHLYCSSI  391



>gb|KHN21364.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=396

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT  LKKR DFR AFS FDAE V+  T+K++ S+S+EYGI+
Sbjct  225   DDKMLFELLVLSGAQVGSDWTSTLKKRLDFRAAFSEFDAETVANLTDKQMMSISSEYGID  284

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +ILE+KK FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  285   ISRVRGVVDNANQILEIKKDFGSFDKYIWGFVNHKPISTQYKFGHKIPVKTSKSESISKD  344

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPS  798
             MV+RGFR+VGPTV+HSFMQ +GLTNDHL TC RH  C  LAA    +  PS
Sbjct  345   MVRRGFRFVGPTVVHSFMQTSGLTNDHLITCHRHLQCTLLAARSLCTIEPS  395



>ref|XP_010494515.1| PREDICTED: uncharacterized protein LOC104771648 [Camelina sativa]
Length=353

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             ED LLFELLVLTGAQVGSDWT VLK+R   R+AFSGF+AE V+ + EKKI S+  +YGI+
Sbjct  191   EDKLLFELLVLTGAQVGSDWTSVLKRRNTLREAFSGFEAELVADFNEKKIQSIVNDYGID  250

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVR  VDNS +IL+VK+  GSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  251   ISQVRAIVDNSKQILKVKRDIGSFNKYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  310

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRHH C  +AA
Sbjct  311   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHHECTAMAA  352



>ref|XP_003531474.1| PREDICTED: uncharacterized protein LOC100791725 [Glycine max]
Length=400

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT  LKKR DFR AFS FDAE V+  T+K++ S+S+EYGI+
Sbjct  229   DDKMLFELLVLSGAQVGSDWTSTLKKRLDFRAAFSEFDAETVANLTDKQMMSISSEYGID  288

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +ILE+KK FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  289   ISRVRGVVDNANQILEIKKDFGSFDKYIWGFVNHKPISTQYKFGHKIPVKTSKSESISKD  348

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPS  798
             MV+RGFR+VGPTV+HSFMQ +GLTNDHL TC RH  C  LAA    +  PS
Sbjct  349   MVRRGFRFVGPTVVHSFMQTSGLTNDHLITCHRHLQCTLLAARSLCTIEPS  399



>ref|XP_003531809.1| PREDICTED: uncharacterized protein LOC100793991 [Glycine max]
Length=400

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFS FD   ++  T+K++ S+S EYGI+
Sbjct  229   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRAAFSEFDVATLANLTDKQMVSISLEYGID  288

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVRG VDN+ RILE+ K FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  289   ISQVRGVVDNANRILEINKDFGSFDKYIWGFVNHKPISTQYKFGHKIPVKTSKSESISKD  348

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             M++RGFR VGPTV+HSFMQAAGLTNDHL TC RH  C  LA+    +T  S+
Sbjct  349   MIRRGFRCVGPTVLHSFMQAAGLTNDHLITCHRHLQCTLLASSPHCTTEHSL  400



>gb|KHN38170.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=399

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFS FD   ++  T+K++ S+S EYGI+
Sbjct  228   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRAAFSEFDVATLANLTDKQMVSISLEYGID  287

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVRG VDN+ RILE+ K FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  288   ISQVRGVVDNANRILEINKDFGSFDKYIWGFVNHKPISTQYKFGHKIPVKTSKSESISKD  347

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             M++RGFR VGPTV+HSFMQAAGLTNDHL TC RH  C  LA+    +T  S+
Sbjct  348   MIRRGFRCVGPTVLHSFMQAAGLTNDHLITCHRHLQCTLLASSPHCTTEHSL  399



>ref|XP_003595924.1| DNA-3-methyladenine glycosylase [Medicago truncatula]
 gb|AES66175.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=390

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELL+L+GAQVGSDWT  LKKR DFR AFS FDAE V+  T+K++ S+S+EYGI+
Sbjct  228   DDKMLFELLILSGAQVGSDWTSTLKKRLDFRAAFSEFDAEIVANLTDKQMMSISSEYGID  287

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +IL+V+K FGSFD Y+W +VNHKPI+ QYK+ +KIPVKTSKSE+ISKD
Sbjct  288   ISKVRGVVDNANQILQVRKGFGSFDKYIWGFVNHKPISNQYKFGHKIPVKTSKSESISKD  347

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             M+KRGFRYVGPTV+HSFMQAAGLTNDHL TC RH  C  LAA
Sbjct  348   MIKRGFRYVGPTVVHSFMQAAGLTNDHLITCHRHLQCTLLAA  389



>gb|AFK37052.1| unknown [Medicago truncatula]
Length=390

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELL+L+GAQVGSDWT  LKKR DFR AFS FDAE V+  T+K++ S+S+EYGI+
Sbjct  228   DDKMLFELLILSGAQVGSDWTSTLKKRLDFRAAFSEFDAEIVANLTDKQMMSISSEYGID  287

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +IL+V+K FGSFD Y+W +VNHKPI+ QYK+ +KIPVKTSKSE+ISKD
Sbjct  288   ISKVRGVVDNANQILQVRKGFGSFDKYIWGFVNHKPISNQYKFGHKIPVKTSKSESISKD  347

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             M+KRGFRYVGPTV+HSFMQAAGLTNDHL TC RH  C  LAA
Sbjct  348   MIKRGFRYVGPTVVHSFMQAAGLTNDHLITCHRHLQCTLLAA  389



>gb|KHN48850.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=400

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT  LKKR DFR AFS FDAE V+  T+K++ S+S+EYGI+
Sbjct  234   DDKMLFELLVLSGAQVGSDWTSTLKKRLDFRAAFSEFDAETVANLTDKQMMSISSEYGID  293

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +ILE+KK FGSFD Y+W +VNHKP++TQYK+ +KI VKTSKSE+ISKD
Sbjct  294   ISRVRGVVDNANQILEIKKDFGSFDKYIWGFVNHKPLSTQYKFGHKISVKTSKSESISKD  353

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFRYVGPTV+HSFMQA+GLTNDHL TC RH  C  LAA
Sbjct  354   MVRRGFRYVGPTVVHSFMQASGLTNDHLITCHRHLQCTLLAA  395



>ref|XP_010441839.1| PREDICTED: uncharacterized protein LOC104724961 [Camelina sativa]
Length=353

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             ED LLFELLVLTGAQVGSDWT VLK+R   R+AFSGF+AE V+ + EKKI  +  +YGI+
Sbjct  191   EDKLLFELLVLTGAQVGSDWTSVLKRRNTLREAFSGFEAELVADFNEKKIQLIVNDYGID  250

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVR  VDNS +IL+VK+  GSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  251   ISQVRAIVDNSKQILKVKRDIGSFNKYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  310

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRHH C  +AA
Sbjct  311   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHHECTAMAA  352



>ref|XP_004139917.2| PREDICTED: uncharacterized protein LOC101218536 [Cucumis sativus]
 gb|KGN46782.1| hypothetical protein Csa_6G134890 [Cucumis sativus]
Length=397

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+ AQVGSDWT +LKKRQDFR+AFS FD+E V+ +++K++ S+S EYGI+
Sbjct  212   DDKMLFELLVLSVAQVGSDWTSILKKRQDFRNAFSSFDSEIVANFSDKQMVSISTEYGID  271

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +++VRG VDN+IRIL++KK+FGSFD Y+W +VN+KP + QYK  +KIPVKTSKSE ISKD
Sbjct  272   INRVRGVVDNAIRILQIKKEFGSFDKYIWGFVNNKPFSPQYKSGHKIPVKTSKSETISKD  331

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQR  816
             MV+RGFR VGPTV+HSFMQAAGLTNDHLTTC RH  C  +AA +R
Sbjct  332   MVRRGFRSVGPTVVHSFMQAAGLTNDHLTTCHRHLHCTLIAAGRR  376



>ref|XP_010481722.1| PREDICTED: uncharacterized protein LOC104760495 [Camelina sativa]
Length=358

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             ED LLFELLVLTGAQVGSDWT VLK+R   R+AFSGF+AE V+ + EKKI  +  +YGI+
Sbjct  196   EDKLLFELLVLTGAQVGSDWTSVLKRRNTLREAFSGFEAELVADFNEKKIQLIVNDYGID  255

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +SQVR  VDNS +IL+VK+  GSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  256   ISQVRAIVDNSKQILKVKRDIGSFNKYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  315

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRHH C  +AA
Sbjct  316   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHHECTAMAA  357



>ref|XP_007212311.1| hypothetical protein PRUPE_ppa006731mg [Prunus persica]
 gb|EMJ13510.1| hypothetical protein PRUPE_ppa006731mg [Prunus persica]
Length=397

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLL ELLVLTGAQVGSDWT VL+KRQ  R++FSGFDA+ V+K++E+KITSVS++ GI+
Sbjct  225   DDNLLLELLVLTGAQVGSDWTSVLRKRQALRESFSGFDADGVAKFSERKITSVSSDSGID  284

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S VRGAVDN+ RIL++K++ GSFD YLW +VNHKPI+TQYK C+KIPVK SKSE+ISKD
Sbjct  285   ISLVRGAVDNAKRILQIKREVGSFDKYLWGFVNHKPISTQYKSCHKIPVKNSKSESISKD  344

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPS  798
             MV+RGFR VGPTVIHSFMQAAGLTNDHL TCPRH  CA   A   P   P+
Sbjct  345   MVRRGFRLVGPTVIHSFMQAAGLTNDHLITCPRHLQCAASLASSPPVAAPA  395



>ref|XP_010537096.1| PREDICTED: uncharacterized protein LOC104811922 [Tarenaya hassleriana]
Length=373

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLKKR  FR+AFSGFDAE V+++ +KKI S++ +YGI+
Sbjct  201   DDNLLFELLVLTGAQVGSDWTSVLKKRNTFREAFSGFDAELVAEFNDKKIRSITTDYGID  260

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L QV  AVDNS +IL+VK++FGSF+ YLW +V +KPI TQY    KIPVKTSKSE++SKD
Sbjct  261   LGQVLAAVDNSKQILKVKREFGSFNKYLWGFVKYKPIITQYTSRQKIPVKTSKSESVSKD  320

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAEL  831
             MV+RGFR+VGP VIHSFMQAAG+TNDHL TCPRH  C  L
Sbjct  321   MVRRGFRFVGPAVIHSFMQAAGMTNDHLVTCPRHLQCTAL  360



>ref|XP_010058073.1| PREDICTED: uncharacterized protein LOC104445842 [Eucalyptus grandis]
 gb|KCW75584.1| hypothetical protein EUGRSUZ_E04327 [Eucalyptus grandis]
Length=388

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GAQVGSDWT VLKKR+  R+AFSGFDAE V++Y+EKKITS+S+ YG+E
Sbjct  229   DDRKLFELLVLSGAQVGSDWTSVLKKREVLREAFSGFDAEIVAQYSEKKITSLSSLYGLE  288

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQ+ G +DNS RILEV+ + GSFD Y+W +VNHKPI T+YK C +IP KTSKSE +SKD
Sbjct  289   LSQILGIIDNSKRILEVRMECGSFDKYVWGFVNHKPITTEYKTCQRIPAKTSKSETMSKD  348

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPR  852
             MV+RGFRYVGPT++HSFMQAAGLTNDHL +CPR
Sbjct  349   MVRRGFRYVGPTIVHSFMQAAGLTNDHLISCPR  381



>ref|XP_004509996.1| PREDICTED: uncharacterized protein LOC101508282 isoform X1 [Cicer 
arietinum]
Length=388

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFS F+A  ++  T+K++ S+S EYGI+
Sbjct  227   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRIAFSEFNASTLANLTDKQMMSISLEYGID  286

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ RILEV K FGSF+ Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  287   ISRVRGVVDNANRILEVNKDFGSFNKYVWGFVNHKPISTQYKFGHKIPVKTSKSESISKD  346

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             M++RGFR+VGPTV+HSFMQAAGLTNDHL TC RH  C  LA 
Sbjct  347   MIRRGFRFVGPTVVHSFMQAAGLTNDHLITCHRHLQCTLLAC  388



>emb|CDY14939.1| BnaA02g22810D [Brassica napus]
Length=349

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+AE V+++ EKKI S+  +YGI 
Sbjct  187   DDNLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEAELVAEFNEKKIQSIVNDYGIG  246

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+VK+ FGSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  247   LSQVLAVVDNSKQILKVKRDFGSFNKYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  306

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C   AA
Sbjct  307   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECMAKAA  348



>ref|XP_002863551.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39810.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=354

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+AE V+ + EKKI S+  +YGI 
Sbjct  192   DDKLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEAELVADFNEKKIQSIVNDYGIN  251

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+VK+ FGSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  252   LSQVLAIVDNSKQILKVKRDFGSFNKYIWGFLKHKPVTTKYTSCQKIPVKTSKSETISKD  311

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C  +AA
Sbjct  312   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECTAMAA  353



>ref|NP_199281.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 dbj|BAB08821.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO41948.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50465.1| unknown protein [Arabidopsis thaliana]
 gb|AED95146.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
Length=353

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+AE V+ + EKKI S+  +YGI 
Sbjct  191   DDNLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEAELVADFNEKKIQSIVNDYGIN  250

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDN+ +IL+VK+  GSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  251   LSQVLAVVDNAKQILKVKRDLGSFNKYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  310

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C  +AA
Sbjct  311   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECTAMAA  352



>ref|XP_009123626.1| PREDICTED: uncharacterized protein LOC103848479, partial [Brassica 
rapa]
Length=343

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+AE V+++ EKKI S+  +YGI 
Sbjct  181   DDNLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEAELVAEFNEKKIQSIVNDYGIG  240

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+VK+ FGSF+ Y W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  241   LSQVLAVVDNSKQILKVKRDFGSFNKYFWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  300

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C   AA
Sbjct  301   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECMAKAA  342



>ref|XP_006398092.1| hypothetical protein EUTSA_v10000945mg [Eutrema salsugineum]
 gb|ESQ39545.1| hypothetical protein EUTSA_v10000945mg [Eutrema salsugineum]
Length=348

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+AE V+++ EKKI S+  +YGI 
Sbjct  186   DDKLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEAELVAEFNEKKIHSIVNDYGIG  245

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+VK+ FGSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  246   LSQVLAIVDNSKQILKVKRDFGSFNKYIWGFLKHKPVTTKYTSCQKIPVKTSKSETISKD  305

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C  +AA
Sbjct  306   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECTAMAA  347



>gb|KEH19324.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=383

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFS F A  ++  T+K++ S+S EYGI+
Sbjct  222   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRTAFSEFHAATLANLTDKQMLSISLEYGID  281

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ RILEV K FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  282   ISRVRGVVDNANRILEVNKDFGSFDKYIWGFVNHKPISTQYKFGHKIPVKTSKSESISKD  341

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             M++RGFR+VGPTV+HSFMQAAGLTNDHL TC  H  C  L+
Sbjct  342   MIRRGFRFVGPTVVHSFMQAAGLTNDHLITCHSHLKCTLLS  382



>ref|XP_010543112.1| PREDICTED: uncharacterized protein LOC104816138 [Tarenaya hassleriana]
Length=308

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+G QVGSDWT +L+KRQDFR+AF  FDAE V+K T+K+++++S +Y I+
Sbjct  141   DDKTLFELLVLSGTQVGSDWTSILRKRQDFRNAFLEFDAEEVAKLTDKQMSAISFDYKID  200

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ +ILE++K+FGS D Y+WA+VNHKPI+T YK+ +KIPVKTSKSE+IS+D
Sbjct  201   MSRVRGVVDNANKILEIRKEFGSLDKYVWAFVNHKPISTSYKFGHKIPVKTSKSESISRD  260

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAEL  831
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  L
Sbjct  261   MVRRGFRFVGPTVVHSFMQAAGLTNDHLITCHRHLPCTLL  300



>ref|XP_010499388.1| PREDICTED: uncharacterized protein LOC104776915 [Camelina sativa]
Length=313

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELL L+GAQVGSDWT  L+KRQD+R AF  F+AEAV+K TEK+++++S EY +E
Sbjct  150   DDKMLFELLTLSGAQVGSDWTSTLRKRQDYRKAFMEFEAEAVAKLTEKEMSAISIEYKLE  209

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK FGS   YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  210   MSKVRGVVENATKIVEIKKAFGSLGKYLWGFVNHKPISTNYKIGHKIPVKTSKSESISKD  269

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH+PC  LA
Sbjct  270   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCCRHNPCNILA  310



>ref|XP_006298177.1| hypothetical protein CARUB_v10014226mg [Capsella rubella]
 gb|EOA31075.1| hypothetical protein CARUB_v10014226mg [Capsella rubella]
Length=312

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELL L+GAQVGSDWT  L+KRQD+R AF  F+AE V+K TEK++ ++S EY IE
Sbjct  149   DDKMLFELLTLSGAQVGSDWTSTLRKRQDYRKAFMEFEAEEVAKLTEKEMNAISIEYKIE  208

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LS+VRG V+N+ +I+E+KK FGS + YLW +VNHKPI+T YK  +K+PVKTSKSE+ISKD
Sbjct  209   LSKVRGVVENATKIVEIKKAFGSLEKYLWGFVNHKPISTNYKIGHKVPVKTSKSESISKD  268

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  LA
Sbjct  269   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCCRHTPCTLLA  309



>ref|XP_010670018.1| PREDICTED: uncharacterized protein LOC104887122 [Beta vulgaris 
subsp. vulgaris]
Length=404

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +L++RQ +RDAFSGFDAE V+  TEK+IT++S +Y  +
Sbjct  237   DDKMLFELLVLSGAQVGSDWTSILRRRQHYRDAFSGFDAENVANLTEKQITTISMQYAFD  296

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S VRG VDN+ RI+E+K++FGS D Y+W +VN+KPI+ QYK+ ++IPVKTSKSE+ISKD
Sbjct  297   ISTVRGVVDNAKRIIEIKREFGSLDKYIWGFVNNKPISPQYKFAHRIPVKTSKSESISKD  356

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPST  807
             MVKRGFR VGP+ +HSFMQAAGLTNDHL TC RH     LA  +RP +
Sbjct  357   MVKRGFRTVGPSAVHSFMQAAGLTNDHLITCYRHLESTALAVARRPKS  404



>ref|XP_003545728.1| PREDICTED: uncharacterized protein LOC100793449 [Glycine max]
Length=398

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFS FDA  ++  T+K++ S+S EY I+
Sbjct  227   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRTAFSEFDAATLANLTDKQMVSISMEYDID  286

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ RIL + K FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  287   ISRVRGVVDNANRILAINKDFGSFDKYIWDFVNHKPISTQYKFGHKIPVKTSKSESISKD  346

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             M++RGFR VGPTV+HSFMQAAGLTNDHL TC RH  C  LA+
Sbjct  347   MIRRGFRCVGPTVLHSFMQAAGLTNDHLITCHRHLQCTLLAS  388



>gb|KHN35318.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=398

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQDFR AFS FDA  ++  T+K++ S+S EY I+
Sbjct  227   DDKMLFELLVLSGAQVGSDWTSILKKRQDFRTAFSEFDAATLANLTDKQMVSISMEYDID  286

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ RIL + K FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKSE+ISKD
Sbjct  287   ISRVRGVVDNANRILAINKDFGSFDKYIWDFVNHKPISTQYKFGHKIPVKTSKSESISKD  346

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             M++RGFR VGPTV+HSFMQAAGLTNDHL TC RH  C  LA+
Sbjct  347   MIRRGFRCVGPTVLHSFMQAAGLTNDHLITCHRHLQCTLLAS  388



>emb|CDY09506.1| BnaC02g20480D [Brassica napus]
Length=349

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+ E V+++ EKKI S+  +YGI 
Sbjct  187   DDNLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEPELVAEFNEKKIQSIVNDYGIG  246

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+VK+ FGSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  247   LSQVLAVVDNSKQILKVKRDFGSFNIYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  306

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C   AA
Sbjct  307   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECMVKAA  348



>emb|CDY42170.1| BnaC05g40490D [Brassica napus]
Length=314

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR DFR AF  F+AEAV+K +EK++  +S EY IE
Sbjct  151   DDKTLFELLTLSGAQVGSDWTSTLRKRHDFRKAFMEFEAEAVAKISEKEMNEISTEYKIE  210

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +ILE+KK FGS + Y+W +VNHKPI+T YK+ +KIPVKTSKSE+ISKD
Sbjct  211   MSKVRGIVENATKILEIKKNFGSLEKYIWGFVNHKPISTNYKFGHKIPVKTSKSESISKD  270

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFRYVGPTV+HSFMQAAGLTNDHL TC RH PC  L+
Sbjct  271   MVRRGFRYVGPTVVHSFMQAAGLTNDHLLTCYRHIPCTLLS  311



>ref|XP_008225940.1| PREDICTED: uncharacterized protein LOC103325537 [Prunus mume]
Length=390

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLL ELLVLTGAQVGSDWT VL+KRQ  R++FSGFDA+ V+K++E+KITSVS++ GI+
Sbjct  225   DDNLLLELLVLTGAQVGSDWTSVLRKRQALRESFSGFDADVVAKFSERKITSVSSDSGID  284

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S VRGAVDN+ RIL++K++ GSFD YLW +VNHKP++TQYK C+KIPVK SKSE+ISKD
Sbjct  285   ISLVRGAVDNAKRILQIKREVGSFDKYLWGFVNHKPVSTQYKSCHKIPVKNSKSESISKD  344

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             MV+RGFR VGPTVIHSFMQAAGLTNDHL TCPRH  C
Sbjct  345   MVRRGFRLVGPTVIHSFMQAAGLTNDHLITCPRHLQC  381



>ref|XP_002456485.1| hypothetical protein SORBIDRAFT_03g037150 [Sorghum bicolor]
 gb|EES01605.1| hypothetical protein SORBIDRAFT_03g037150 [Sorghum bicolor]
Length=382

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LKKR  +R+AFSGF  +AV+KYTEK++ S+SA+YG++
Sbjct  217   DDELLFEMLTLSGVQVGADWTSILKKRHVYREAFSGFSVDAVAKYTEKQMASLSADYGLD  276

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  VRG V+N+ RILE+++ FGS D Y+WA+VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  277   LGTVRGTVNNACRILELRRDFGSLDKYVWAFVNNKPLSPSYKYSRKIPVKTSKSESISKD  336

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQR  816
             MV+RGFR+VGPTVIHSFMQA GLTNDHL +CPRH  C+  AA  R
Sbjct  337   MVRRGFRFVGPTVIHSFMQAVGLTNDHLVSCPRHRVCSSAAAATR  381



>ref|XP_009368563.1| PREDICTED: titin-like [Pyrus x bretschneideri]
Length=389

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN+L ELL+LTGAQVGSDWT VL++R+  R+AFSGFDA+ V+K +E+KI SV ++ GI+
Sbjct  224   DDNMLLELLLLTGAQVGSDWTSVLRRRETLREAFSGFDADVVAKLSERKIISVCSDSGID  283

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S VRGAVDN+ RILE+K++ GSFD YLW +VNHKPI+TQYK C+KIPVK SKSEAISKD
Sbjct  284   ISLVRGAVDNAKRILEIKREVGSFDKYLWGFVNHKPISTQYKSCHKIPVKNSKSEAISKD  343

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MV+RGFR+VGPTVIHSFMQAAGLTNDHL TCPRH  C  + +P  P
Sbjct  344   MVRRGFRHVGPTVIHSFMQAAGLTNDHLITCPRHLHC--IPSPSSP  387



>emb|CDX96974.1| BnaC02g31120D [Brassica napus]
Length=349

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+ E V+++ EKKI S+  +YGI 
Sbjct  187   DDNLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEPELVAEFNEKKIQSIVNDYGIG  246

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+VK+ FGSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  247   LSQVLAIVDNSKQILKVKRDFGSFNIYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  306

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C   AA
Sbjct  307   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECMVKAA  348



>ref|XP_010465048.1| PREDICTED: uncharacterized protein LOC104745492 [Camelina sativa]
Length=313

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELL L+GAQVGSDWT  L+KR D+R AF  F+AEAV+K TEK+++++S EY IE
Sbjct  150   DDKMLFELLTLSGAQVGSDWTSTLRKRHDYRKAFMEFEAEAVAKLTEKEMSAISIEYKIE  209

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK FGS   YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  210   MSKVRGVVENATKIVEIKKAFGSLGKYLWGFVNHKPISTNYKIGHKIPVKTSKSESISKD  269

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  LA
Sbjct  270   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCCRHIPCTILA  310



>ref|XP_010092457.1| Putative Glutamine amidotransferase [Morus notabilis]
 gb|EXB51223.1| Putative Glutamine amidotransferase [Morus notabilis]
Length=458

 Score =   245 bits (626),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVGSDWT +LKKRQ+FR AFS FDA+ V+ +T+K++ S+S+E+G +
Sbjct  274   DDKMLFELLVLSGAQVGSDWTSILKKRQEFRKAFSEFDAQIVASFTDKQMISISSEFGFD  333

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDNS RILE+KK+ GS + Y+W +VN KPI+TQYK   +IPVKTSKSE ISKD
Sbjct  334   ISRVRGVVDNSNRILEIKKELGSLEKYVWGFVNQKPISTQYKSGQRIPVKTSKSETISKD  393

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             +V+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH  C  LA+ +RP+
Sbjct  394   LVRRGFRFVGPTVVHSFMQAAGLTNDHLITCHRHLQCTLLAS-RRPT  439



>ref|XP_006280615.1| hypothetical protein CARUB_v10026580mg, partial [Capsella rubella]
 gb|EOA13513.1| hypothetical protein CARUB_v10026580mg, partial [Capsella rubella]
Length=386

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLTGAQVGSDWT VLK+R   R+AF  F+AE V+ + EKKI S+  +YGI+
Sbjct  224   DDKLLFELLVLTGAQVGSDWTSVLKRRNTLREAFCNFEAELVADFNEKKIQSIVNDYGID  283

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+VK+  GSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  284   LSQVLAIVDNSKQILKVKRDLGSFNKYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  343

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRHH C  +AA
Sbjct  344   MVRRGFRFVGPTVIHSLMQAAGLTNDHLVTCPRHHECTAMAA  385



>ref|XP_009120354.1| PREDICTED: uncharacterized protein LOC103845269 [Brassica rapa]
 emb|CDY50544.1| BnaA01g30360D [Brassica napus]
Length=311

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR  FR AF  F+AEAV+K++EK+I ++S EY ++
Sbjct  148   DDKTLFELLTLSGAQVGSDWTSTLRKRHHFRKAFMEFEAEAVAKFSEKEINAISIEYKVD  207

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+I+ILEVKK FGS + YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  208   ISKVRGVVENAIKILEVKKTFGSLERYLWGFVNHKPISTNYKLGHKIPVKTSKSESISKD  267

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAEL  831
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  L
Sbjct  268   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCYRHTPCTLL  307



>ref|XP_009146594.1| PREDICTED: uncharacterized protein LOC103870233 [Brassica rapa]
Length=314

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR D+R AF  F+AEAV+K +EK++  +S EY IE
Sbjct  151   DDKTLFELLTLSGAQVGSDWTSTLRKRHDYRKAFMEFEAEAVAKISEKEMNEISTEYKIE  210

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +ILE+KK FGS + Y+W +VNHKPI+T YK+ +KIPVKTSKSE+ISKD
Sbjct  211   MSKVRGIVENATKILEIKKNFGSLEKYIWGFVNHKPISTNYKFGHKIPVKTSKSESISKD  270

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFRYVGPTV+HSFMQAAGLTNDHL TC RH PC  L+
Sbjct  271   MVRRGFRYVGPTVVHSFMQAAGLTNDHLLTCYRHIPCTLLS  311



>ref|XP_010486996.1| PREDICTED: uncharacterized protein LOC104765039 [Camelina sativa]
Length=313

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELL L+GAQVGSDWT  L+KR D+R AF  F+AEAV+K TEK+++++S EY IE
Sbjct  150   DDKMLFELLTLSGAQVGSDWTSTLRKRHDYRKAFMEFEAEAVAKLTEKEMSAISIEYKIE  209

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK FGS   YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  210   MSKVRGVVENATKIVEIKKAFGSLGKYLWGFVNHKPISTNYKIGHKIPVKTSKSESISKD  269

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  LA
Sbjct  270   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCCRHIPCNILA  310



>ref|XP_002884921.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61180.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=312

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR D+R AF  F+AEAV+K TEK++ ++S EY I+
Sbjct  149   DDKTLFELLTLSGAQVGSDWTSTLRKRHDYRKAFMEFEAEAVTKLTEKEMNAISIEYKID  208

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK FGS + YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  209   MSKVRGVVENATKIVEIKKAFGSLEKYLWGFVNHKPISTNYKMGHKIPVKTSKSESISKD  268

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  LA
Sbjct  269   MVRRGFRFVGPTVVHSFMQAAGLTNDHLITCCRHTPCTILA  309



>ref|XP_007133461.1| hypothetical protein PHAVU_011G180500g [Phaseolus vulgaris]
 gb|ESW05455.1| hypothetical protein PHAVU_011G180500g [Phaseolus vulgaris]
Length=392

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLV++GAQVGSDWT +LKKRQDFR AFS FDA  ++  T+K++ S+S EYGI+
Sbjct  230   DDKMLFELLVVSGAQVGSDWTSILKKRQDFRTAFSEFDAATLANMTDKQMVSISLEYGID  289

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG VDN+ RI E+ K FGSFD Y+W +VNHKPI+TQYK+ +KIPVKTSKS++ISKD
Sbjct  290   ISRVRGVVDNANRISEINKDFGSFDKYIWGFVNHKPISTQYKFGHKIPVKTSKSDSISKD  349

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             M++RGFR+VGPTV+HSFMQAAGLTNDHL TC RH  C
Sbjct  350   MLRRGFRFVGPTVLHSFMQAAGLTNDHLITCHRHLQC  386



>ref|XP_009363279.1| PREDICTED: uncharacterized protein LOC103953267 [Pyrus x bretschneideri]
Length=392

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN+L ELL+LTGAQVGSDWT VL+KR+  R+AFSGFDA+ V+K++EKKI SVSA+ G++
Sbjct  227   DDNMLLELLLLTGAQVGSDWTSVLRKREALREAFSGFDADVVAKFSEKKIISVSADSGVD  286

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S VRG VDN+ RILEVK++ GSFD YLW +VNHKPI TQYK C+KIPVK SKSEAISKD
Sbjct  287   ISLVRGLVDNAKRILEVKREMGSFDKYLWGFVNHKPICTQYKSCHKIPVKNSKSEAISKD  346

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             MV+RGFR+VGPTVIH FMQAAGLTNDHL TCPRH  C
Sbjct  347   MVRRGFRHVGPTVIHFFMQAAGLTNDHLITCPRHLHC  383



>ref|XP_008364234.1| PREDICTED: uncharacterized protein LOC103427927 [Malus domestica]
Length=389

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN+L ELL+LTGAQVGSDWT VL+KR+  R+AFSGFDA+ V+ ++EKKITS+SA+ G++
Sbjct  224   DDNVLLELLLLTGAQVGSDWTSVLRKREALREAFSGFDADVVAXFSEKKITSLSADSGVD  283

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S VRG VDN+ RIL VK++ GSFD YLW +VNHKPI TQYK C+KIPVK SKSEAISKD
Sbjct  284   ISLVRGVVDNAKRILXVKREVGSFDEYLWGFVNHKPICTQYKSCHKIPVKNSKSEAISKD  343

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MV+RGFR+VGPTVIH FMQAAGLTNDHLTTCPRH  C  + +P  P
Sbjct  344   MVRRGFRHVGPTVIHFFMQAAGLTNDHLTTCPRHPHC--IPSPSSP  387



>gb|AAM64486.1| unknown [Arabidopsis thaliana]
Length=353

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELLVLTGAQVGSDWT VLK+R  FR+AFSGF+AE V+ + EKKI S+  +YGI 
Sbjct  191   DDNLLFELLVLTGAQVGSDWTSVLKRRNTFREAFSGFEAELVADFNEKKIQSIVNDYGIN  250

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDN+ +IL+VK+  GSF+ Y+W ++ HKP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  251   LSQVLAVVDNAKQILKVKRDLGSFNKYIWGFMKHKPVTTKYTSCQKIPVKTSKSETISKD  310

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+V PTVIH  MQAAGLTNDHL TCPRH  C  +AA
Sbjct  311   MVRRGFRFVDPTVIHLLMQAAGLTNDHLITCPRHLECTAMAA  352



>gb|EYU43617.1| hypothetical protein MIMGU_mgv1a008239mg [Erythranthe guttata]
Length=316

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEA-VSKYTE-KKITSVSAEYG  1137
             +D +LFELLVLTGAQVGSDW+ VL++R+DFR AFS FDA+  VSK++E KKI  +++ Y 
Sbjct  155   DDKMLFELLVLTGAQVGSDWSSVLRRREDFRKAFSRFDADIIVSKFSEEKKINLITSHYA  214

Query  1136  IELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             ++L+ VR  VDNS RILE+KK++GSFD Y+W +VN KPI TQYKWC+KIP KTSKSE IS
Sbjct  215   LDLTLVRAVVDNSKRILEIKKEYGSFDKYVWGFVNDKPIVTQYKWCHKIPAKTSKSETIS  274

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHH  846
             KDMV+RGFR+VGPT+IHSFMQAAGLTNDHL TCP HH
Sbjct  275   KDMVRRGFRHVGPTIIHSFMQAAGLTNDHLITCPTHH  311



>emb|CDM84569.1| unnamed protein product [Triticum aestivum]
Length=384

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             ED LLFE+L L+G QVG+DW  +L++R  +R+AFSGFD +AV+KYTEK++ SVSA YG++
Sbjct  221   EDELLFEMLTLSGVQVGADWASILRRRHIYREAFSGFDVDAVAKYTEKQMASVSAGYGLD  280

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  +RGAV+N+ RILEVK+ FGSF  Y+W +VNHKP++  YK+  KIPVKTSKSE+ISKD
Sbjct  281   LGTIRGAVNNACRILEVKRDFGSFGKYVWGFVNHKPLSPGYKYSRKIPVKTSKSESISKD  340

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             MV+RGFR+VGPTV+HSFMQA GLTNDHL +CPRH  C
Sbjct  341   MVRRGFRFVGPTVLHSFMQAVGLTNDHLVSCPRHRVC  377



>dbj|BAJ98623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=387

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             ED LLFE+L L+G QVG+DW  +L++R  +R+AFSGFD +AV+KYTEK++ S+SA YG++
Sbjct  225   EDELLFEMLTLSGVQVGADWASILRRRHIYREAFSGFDVDAVAKYTEKQMASLSAGYGLD  284

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  +RGAV+N+ RILEV++ FGSF  Y+W +VNHKP++  YK+  KIPVKTSKSE+ISKD
Sbjct  285   LGTIRGAVNNACRILEVRRDFGSFGKYVWGFVNHKPLSPGYKYSRKIPVKTSKSESISKD  344

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTV+HSFMQA GLTNDHL +CPRH  C+  A+
Sbjct  345   MVRRGFRFVGPTVLHSFMQAVGLTNDHLVSCPRHRVCSSSAS  386



>gb|KFK38618.1| hypothetical protein AALP_AA3G137700 [Arabis alpina]
Length=311

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR DFR AF  F+AEAV+K TEK++  +S E+ IE
Sbjct  148   DDKTLFELLTLSGAQVGSDWTSTLRKRNDFRKAFMEFEAEAVAKLTEKEMNVISTEHKIE  207

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK FGS + YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  208   MSKVRGVVENATKIVEIKKVFGSLEKYLWGFVNHKPISTNYKLGHKIPVKTSKSESISKD  267

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  L  P  P
Sbjct  268   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCYRHGPCTLL--PTNP  311



>ref|NP_001044528.1| Os01g0799500 [Oryza sativa Japonica Group]
 dbj|BAD68277.1| putative DNA-3-methyladenine glycosylase I [Oryza sativa Japonica 
Group]
 dbj|BAF06442.1| Os01g0799500 [Oryza sativa Japonica Group]
 gb|EAZ13838.1| hypothetical protein OsJ_03762 [Oryza sativa Japonica Group]
 dbj|BAG98686.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LK+R  +R+AFSGF+ +AV+KYTEK++ S+SAE+G++
Sbjct  230   DDELLFEMLTLSGVQVGADWTSILKRRHVYREAFSGFNVDAVAKYTEKQMASLSAEFGLD  289

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  +RGAV+N+ RI EV++ FGSF  Y+WA+VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  290   LGTIRGAVNNACRISEVRRDFGSFSKYVWAFVNNKPLSPSYKYSRKIPVKTSKSESISKD  349

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHSFMQA GLTNDHL +CPRH  C+  +A
Sbjct  350   MVRRGFRFVGPTVIHSFMQAVGLTNDHLVSCPRHRVCSSSSA  391



>gb|EAY76151.1| hypothetical protein OsI_04083 [Oryza sativa Indica Group]
Length=391

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LK+R  +R+AFSGF+ +AV+KYTEK++ S+SAE+G++
Sbjct  230   DDELLFEMLTLSGVQVGADWTSILKRRHVYREAFSGFNVDAVAKYTEKQMASLSAEFGLD  289

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  +RGAV+N+ RI EV++ FGSF  Y+WA+VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  290   LGTIRGAVNNACRISEVRRDFGSFSKYVWAFVNNKPLSPSYKYSRKIPVKTSKSESISKD  349

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHSFMQA GLTNDHL +CPRH  C+  +A
Sbjct  350   MVRRGFRFVGPTVIHSFMQAVGLTNDHLVSCPRHRVCSSSSA  391



>gb|AGT16257.1| DNA-3-methyladenine glycosylase [Saccharum hybrid cultivar R570]
Length=390

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LKKR  +R+AFSGF+ +AV+KYTEK++ S+SA+YG++
Sbjct  222   DDELLFEMLTLSGVQVGADWTSILKKRHVYREAFSGFNVDAVAKYTEKQMASLSADYGLD  281

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  VRG V+N+ RILEV++ FGS D Y+WA+VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  282   LGTVRGTVNNACRILEVRRDFGSLDRYVWAFVNNKPLSPSYKYSRKIPVKTSKSESISKD  341

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCA  837
             MV+RGFR+ GPTVIHSFMQA GLTNDHL +CPRH  C+
Sbjct  342   MVRRGFRFAGPTVIHSFMQAVGLTNDHLVSCPRHRVCS  379



>gb|EYU43616.1| hypothetical protein MIMGU_mgv1a008239mg [Erythranthe guttata]
Length=380

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEA-VSKYTE-KKITSVSAEYG  1137
             +D +LFELLVLTGAQVGSDW+ VL++R+DFR AFS FDA+  VSK++E KKI  +++ Y 
Sbjct  219   DDKMLFELLVLTGAQVGSDWSSVLRRREDFRKAFSRFDADIIVSKFSEEKKINLITSHYA  278

Query  1136  IELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             ++L+ VR  VDNS RILE+KK++GSFD Y+W +VN KPI TQYKWC+KIP KTSKSE IS
Sbjct  279   LDLTLVRAVVDNSKRILEIKKEYGSFDKYVWGFVNDKPIVTQYKWCHKIPAKTSKSETIS  338

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHH  846
             KDMV+RGFR+VGPT+IHSFMQAAGLTNDHL TCP HH
Sbjct  339   KDMVRRGFRHVGPTIIHSFMQAAGLTNDHLITCPTHH  375



>emb|CDY52672.1| BnaC01g38620D [Brassica napus]
Length=312

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR  FR AF  F+AEAV+K++EK+I ++S EY ++
Sbjct  149   DDKTLFELLTLSGAQVGSDWTSTLRKRHHFRKAFMEFEAEAVAKFSEKEINAISIEYKVD  208

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +ILEVKK FGS + YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  209   ISKVRGVVENATKILEVKKTFGSLERYLWGFVNHKPISTNYKLGHKIPVKTSKSESISKD  268

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAEL  831
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  L
Sbjct  269   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCYRHTPCTLL  308



>ref|XP_006644844.1| PREDICTED: uncharacterized protein LOC102709508 [Oryza brachyantha]
Length=387

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LK+R  +R+AFSGFD +AV+KYTEK++ S+SAE+G++
Sbjct  227   DDGLLFEMLTLSGVQVGADWTSILKRRHVYREAFSGFDVDAVAKYTEKQMASLSAEFGLD  286

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  +RGAV+N+ RI EV+K FG+F  Y+WA+VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  287   LGTIRGAVNNACRITEVRKDFGTFGKYVWAFVNNKPLSPSYKYSRKIPVKTSKSESISKD  346

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGP VIHSFMQA GLTNDHL +CPRH  C+  A
Sbjct  347   MVRRGFRFVGPPVIHSFMQAVGLTNDHLVSCPRHRVCSSSA  387



>gb|ACF86573.1| unknown [Zea mays]
 gb|ACG48073.1| DNA-3-methyladenine glycosylase I [Zea mays]
 tpg|DAA57253.1| TPA: DNA-3-methyladenine glycosylase I [Zea mays]
Length=377

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LKKR  +R+AFSGFD +AV+KYTEK++ S+SA+YG++
Sbjct  213   DDELLFEMLTLSGVQVGADWTSILKKRHVYREAFSGFDVDAVAKYTEKQMASLSADYGLD  272

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  VRG V+N+ RILEV++ F S D Y+WA+VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  273   LGTVRGTVNNACRILEVRRDFCSLDKYVWAFVNNKPLSPSYKYSRKIPVKTSKSESISKD  332

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTVIHSFM+A GLTNDHL +CPRH  C+  A
Sbjct  333   MVRRGFRFVGPTVIHSFMEAVGLTNDHLVSCPRHRVCSAAA  373



>emb|CDY08411.1| BnaA05g26470D [Brassica napus]
Length=314

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR DFR AF  F+AEAV+  +EK++  +S EY IE
Sbjct  151   DDKTLFELLTLSGAQVGSDWTSTLRKRHDFRKAFMEFEAEAVANISEKEMNEISTEYKIE  210

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +ILE+KK F S + Y+W +VNHKPI+T YK+ +KIPVKTSKSE+ISKD
Sbjct  211   MSKVRGIVENATKILEIKKNFESLEKYIWGFVNHKPISTNYKFGHKIPVKTSKSESISKD  270

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFRYVGPTV+HSFMQAAGLTNDHL TC RH PC  L+
Sbjct  271   MVRRGFRYVGPTVVHSFMQAAGLTNDHLLTCYRHIPCTLLS  311



>gb|KFK31617.1| hypothetical protein AALP_AA6G136400 [Arabis alpina]
Length=350

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFELLVLTGAQVGSDWT VLK+R  FR+AF GF+AE V+ + EKKI S+   YGI 
Sbjct  188   DDKLLFELLVLTGAQVGSDWTSVLKRRNSFREAFFGFEAELVADFNEKKIQSIVNNYGIG  247

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             LSQV   VDNS +IL+ K+ FGSF+ Y+W ++ +KP+ T+Y  C KIPVKTSKSE ISKD
Sbjct  248   LSQVLAIVDNSKQILKAKRDFGSFNQYIWGFMKNKPVTTKYTSCQKIPVKTSKSETISKD  307

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHS MQAAGLTNDHL TCPRH  C  +AA
Sbjct  308   MVRRGFRFVGPTVIHSLMQAAGLTNDHLITCPRHLECTAIAA  349



>ref|XP_006407303.1| hypothetical protein EUTSA_v10021188mg [Eutrema salsugineum]
 gb|ESQ48756.1| hypothetical protein EUTSA_v10021188mg [Eutrema salsugineum]
Length=310

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDW+  L+KR DFR AF  F+AEAV+K +EK++ ++S E+ IE
Sbjct  147   DDKTLFELLTLSGAQVGSDWSSTLRKRHDFRKAFMEFEAEAVAKLSEKEMNAISIEHKIE  206

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK FGS + YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  207   MSKVRGVVENATKIVEIKKDFGSLEKYLWGFVNHKPISTNYKLGHKIPVKTSKSESISKD  266

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAEL  831
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  L
Sbjct  267   MVRRGFRFVGPTVVHSFMQAAGLTNDHLLTCYRHLPCTLL  306



>ref|XP_008383248.1| PREDICTED: uncharacterized protein LOC103445971 [Malus domestica]
Length=388

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN+L ELL+LTGAQVGSDWT VL++R+  R+AFSGFDA+ V+K++EKKI  + ++ GI+
Sbjct  224   DDNMLLELLLLTGAQVGSDWTSVLRRRETLREAFSGFDADVVAKFSEKKII-LCSDSGID  282

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S VRGAVDN+ RILE+K++ GSFD YLW +VNHKPI+TQYK C+KIPVK SKSEAISKD
Sbjct  283   ISLVRGAVDNAKRILEIKREVGSFDKYLWGFVNHKPISTQYKSCHKIPVKNSKSEAISKD  342

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             MV+RGFR+VGPTVIHSFMQAAGLTNDHL TCPRH  C  + +P  P
Sbjct  343   MVRRGFRHVGPTVIHSFMQAAGLTNDHLITCPRHLHC--IPSPSSP  386



>ref|XP_004970256.1| PREDICTED: uncharacterized protein LOC101752873 [Setaria italica]
Length=373

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LKKR  +R+AFSGF+ +AV+KYTEK++  +S ++G++
Sbjct  206   DDELLFEMLTLSGVQVGADWTSILKKRHVYREAFSGFNVDAVAKYTEKQMALLSTDFGLD  265

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  VRG V+N+ RILEV++ FGS D Y+WA+VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  266   LGTVRGTVNNACRILEVRRDFGSLDKYVWAFVNNKPLSPGYKYSRKIPVKTSKSESISKD  325

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTVIHSFMQA GLTNDHL +CPRH  C+  AA
Sbjct  326   MVRRGFRFVGPTVIHSFMQAVGLTNDHLVSCPRHRACSTSAA  367



>ref|NP_566433.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 dbj|BAB02415.1| DNA-3-methyladenine glycosidase I-like protein [Arabidopsis thaliana]
 gb|AEE75238.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
Length=312

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR D+R AF  F+AE V+K TEK++ ++S EY IE
Sbjct  149   DDKTLFELLTLSGAQVGSDWTSTLRKRHDYRKAFMEFEAEVVAKLTEKEMNAISIEYKIE  208

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK F S + YLW +VNHKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  209   MSKVRGVVENAKKIVEIKKAFVSLEKYLWGFVNHKPISTNYKLGHKIPVKTSKSESISKD  268

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  LA
Sbjct  269   MVRRGFRFVGPTVVHSFMQAAGLTNDHLITCCRHAPCTLLA  309



>ref|XP_004293832.1| PREDICTED: uncharacterized protein LOC101310385 [Fragaria vesca 
subsp. vesca]
Length=376

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLL ELL+LT AQVGSDW+ VL+KRQ  R+AFSGFDAEAV+K+ EKKITSVSA+ G +
Sbjct  221   DDNLLLELLLLTSAQVGSDWSSVLRKRQALREAFSGFDAEAVAKFNEKKITSVSADTGTD  280

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S +RG VDN+ RILE+K++ GSFD YLW +VNHKPI+TQYK C+KIPVKTSKSE ISK 
Sbjct  281   ISLIRGVVDNAKRILEIKRETGSFDKYLWGFVNHKPISTQYKSCHKIPVKTSKSEFISKA  340

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHH  846
             MVK+GFR+VGPTVIHSFMQAAGLTNDHL TC RH 
Sbjct  341   MVKKGFRFVGPTVIHSFMQAAGLTNDHLITCSRHQ  375



>ref|XP_009418223.1| PREDICTED: uncharacterized protein LOC103998466 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418224.1| PREDICTED: uncharacterized protein LOC103998466 [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVLTGAQ G DWT +LKKR  FR AF+ FDA  VSK+TE+++ S+S E+G++
Sbjct  226   DDRMLFELLVLTGAQAGMDWTAILKKRNGFRAAFAEFDARTVSKFTERQMASISVEHGLD  285

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L +VRG V N+ RI+EV+++F S D YLW +VNHKPI+T Y+   KIP KTSKSE+ISKD
Sbjct  286   LGRVRGVVANANRIIEVRREFESLDKYLWGFVNHKPISTSYRSRRKIPAKTSKSESISKD  345

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             MV+RGFR+VGPTV+HSFMQAAGLTNDH+ +CPRH  C+ L+A
Sbjct  346   MVRRGFRFVGPTVVHSFMQAAGLTNDHIVSCPRHRHCSTLSA  387



>ref|XP_006468655.1| PREDICTED: uncharacterized protein LOC102630002 [Citrus sinensis]
Length=145

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = -1

Query  1217  DAFSGFDAEAVSKYTEKKITSVSAEYGIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAY  1038
             +AFSGFDAE V+K+TEKK+TS+SA Y I+LSQVRG VDNSIRILEVKKQFGSFD YLW +
Sbjct  6     EAFSGFDAEVVAKFTEKKMTSLSANYAIDLSQVRGIVDNSIRILEVKKQFGSFDKYLWGF  65

Query  1037  VNHKPIATQYKWCNKIPVKTSKSEAISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTC  858
             VNHKPI TQY+   KIPVKTSKSEAISKDMVK+GFR+VGPTVIHSFMQAAGLTNDHL TC
Sbjct  66    VNHKPINTQYRSSQKIPVKTSKSEAISKDMVKKGFRFVGPTVIHSFMQAAGLTNDHLITC  125

Query  857   PRHHPCAELAAPQRPSTTPSI  795
              RH  C  LA+ Q P+  P++
Sbjct  126   TRHLQCTALASHQ-PAVAPAL  145



>ref|NP_001150401.1| DNA-3-methyladenine glycosylase I [Zea mays]
 gb|ACG38950.1| DNA-3-methyladenine glycosylase I [Zea mays]
Length=373

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DWT +LKKR  +R+AFSGF+ +AV+KYTEK++ S+SA+YG++
Sbjct  211   DDELLFEMLTLSGVQVGADWTSILKKRHVYREAFSGFNVDAVAKYTEKQMASLSADYGLD  270

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  VRG V+N+ RI+EV++ FGS D Y+WA+VN++P++  Y++  KIP KTSKSE ISKD
Sbjct  271   LGTVRGTVNNACRIIEVRRDFGSLDRYVWAFVNNRPLSPSYRYSRKIPAKTSKSECISKD  330

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+R FR+VGPTV+HSFMQA GLTNDHL +CPRH  C+  A
Sbjct  331   MVRRRFRFVGPTVVHSFMQAVGLTNDHLVSCPRHRACSAAA  371



>gb|AAM61316.1| unknown [Arabidopsis thaliana]
Length=312

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GAQVGSDWT  L+KR D+R AF  F+AE V+K TEK++ ++S EY IE
Sbjct  149   DDKTLFELLTLSGAQVGSDWTSTLRKRHDYRKAFMEFEAEVVAKLTEKEMNAISIEYKIE  208

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             +S+VRG V+N+ +I+E+KK F S + YLW +V HKPI+T YK  +KIPVKTSKSE+ISKD
Sbjct  209   MSKVRGVVENAKKIVEIKKAFVSLEKYLWGFVXHKPISTNYKLGHKIPVKTSKSESISKD  268

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             MV+RGFR+VGPTV+HSFMQAAGLTNDHL TC RH PC  LA
Sbjct  269   MVRRGFRFVGPTVVHSFMQAAGLTNDHLITCCRHAPCTLLA  309



>ref|XP_003564403.1| PREDICTED: uncharacterized protein LOC100836431 [Brachypodium 
distachyon]
Length=380

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFE+L L+G QVG+DW  +L++R  +R+AFSGF+ + V+KYTEK++ SVSA +G++
Sbjct  216   DDELLFEMLTLSGVQVGADWASILRRRHIYREAFSGFNVDVVAKYTEKQMASVSAGFGLD  275

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L  +RGAV+N+ RILEV++ FGS D Y+W +VN+KP++  YK+  KIPVKTSKSE+ISKD
Sbjct  276   LGTIRGAVNNACRILEVRRDFGSLDKYVWGFVNNKPLSPGYKYSRKIPVKTSKSESISKD  335

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCA  837
             MV+RGFR+VGPTV+HSFMQA GLTNDHL +CPRH  C+
Sbjct  336   MVRRGFRFVGPTVLHSFMQAVGLTNDHLVSCPRHRVCS  373



>ref|XP_003522140.1| PREDICTED: uncharacterized protein LOC100789505 [Glycine max]
 gb|KHN42839.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=155

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  1271  AQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIELSQVRGAVDNSIR  1092
             A+VGSDWT  LKKR DFR AFS FDAE V+  T+K++ S+S+EYGI++S+VRGAVDN+ +
Sbjct  2     AKVGSDWTSTLKKRLDFRAAFSEFDAETVANLTDKQMMSISSEYGIDISRVRGAVDNANQ  61

Query  1091  ILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKDMVKRGFRYVGPTV  912
             ILE+KK FGSFD Y+W +VNHKP++TQYK+ +KI VKTSKSE+ISKDMV+RGFRYVGPTV
Sbjct  62    ILEIKKDFGSFDKYIWGFVNHKPLSTQYKFGHKISVKTSKSESISKDMVRRGFRYVGPTV  121

Query  911   IHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             +HSFMQA+GLTNDHL TC  H  C  LAA
Sbjct  122   VHSFMQASGLTNDHLITCHWHLQCTLLAA  150



>ref|XP_006853486.1| PREDICTED: uncharacterized protein LOC18443232 [Amborella trichopoda]
 gb|ERN14953.1| hypothetical protein AMTR_s00032p00209300 [Amborella trichopoda]
Length=374

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GAQVG DWT +LKKR+ FR  F  F+AEAVS+ +E+++ S+SA+ G++
Sbjct  211   DDRMLFELLVLSGAQVGLDWTTMLKKRETFRATFCAFEAEAVSQLSERQMASISAQCGLD  270

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L++VRGAVDN+  IL++K++FGS + Y+W +V+ KPI T+YK   KIPVKTSKSE++SKD
Sbjct  271   LTKVRGAVDNAKVILQIKREFGSLEQYIWGFVSKKPIITEYKSARKIPVKTSKSESVSKD  330

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRH  849
             MVKRGFR VGPTVIHSFMQAAGLTNDHL +CPRH
Sbjct  331   MVKRGFRSVGPTVIHSFMQAAGLTNDHLLSCPRH  364



>gb|ACJ83471.1| unknown [Medicago truncatula]
Length=114

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  1163  ITSVSAEYGIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPV  984
             + S+S+EYGI++S+VRG VDN+ +IL+V+K FGSFD Y+W +VNHKPI+ QYK+ +KIPV
Sbjct  1     MMSISSEYGIDISKVRGVVDNANQILQVRKGFGSFDKYIWGFVNHKPISNQYKFGHKIPV  60

Query  983   KTSKSEAISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             KTSKSE+ISKDM+KRGFRYVGPTV+HSFMQAAGLTNDHL TC RH  C  LAA
Sbjct  61    KTSKSESISKDMIKRGFRYVGPTVVHSFMQAAGLTNDHLITCHRHLQCTLLAA  113



>ref|XP_008456274.1| PREDICTED: uncharacterized protein LOC103496269 [Cucumis melo]
Length=138

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -1

Query  1163  ITSVSAEYGIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPV  984
             + S+S EYGI++++VRG VDNSIRIL++KK+FGSFD Y+W +VN+KP + QYK  +KIPV
Sbjct  1     MVSISTEYGIDINRVRGVVDNSIRILQIKKEFGSFDKYIWGFVNNKPFSPQYKSGHKIPV  60

Query  983   KTSKSEAISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQR  816
             KTSKSE ISKDMV+RGFR VGPTV+HSFMQAAGLTNDHLTTC RH  C  +AA +R
Sbjct  61    KTSKSETISKDMVRRGFRSVGPTVVHSFMQAAGLTNDHLTTCHRHLHCTLIAAGRR  116



>ref|XP_008339748.1| PREDICTED: uncharacterized protein LOC103402771 [Malus domestica]
Length=315

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 124/168 (74%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AFSGFD   V+K  EK+I  +++   I 
Sbjct  146   DDNQLFELLALSGMLMDHNWTEIVKRRELFREAFSGFDPNKVAKMEEKEIAEITSNKEIM  205

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L   +VR  ++N+  IL++ ++FGSF +Y+W+YVNHKP+  ++++   +P++T K+E++S
Sbjct  206   LVDCRVRCIINNAKCILKIVREFGSFSSYIWSYVNHKPVINRFRYPRNVPLRTPKAESMS  265

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRYVGP +++SFMQAAGLTNDHL  C R+  C  LA  +RP
Sbjct  266   KDLIKRGFRYVGPVIVYSFMQAAGLTNDHLVDCYRYSECVNLA--ERP  311



>ref|XP_002267123.1| PREDICTED: uncharacterized protein LOC100249617 [Vitis vinifera]
Length=318

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 122/179 (68%), Gaps = 2/179 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             EDN LFELL ++G  +  +WT +LK+++  RDAFSGFD   V++  EK+IT  ++   + 
Sbjct  139   EDNQLFELLAMSGMLMDYNWTEILKRKELLRDAFSGFDPNTVAQMGEKEITETASNKALM  198

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I ++ +QFGSF +Y+W YVNHKP+  + ++   +P++T KSEAIS
Sbjct  199   LAESRVRCIVDNAKCIQKIVRQFGSFSSYIWGYVNHKPMIIRCRYPRSVPLRTPKSEAIS  258

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI*INCL  780
             +D++KRGFR VGP +++SFMQAAG+TNDHL  C R+  C  LA        P I IN L
Sbjct  259   RDLIKRGFRLVGPVIVYSFMQAAGMTNDHLIDCFRYRECLNLAHRPYMDAIPDININVL  317



>ref|XP_010091642.1| Putative Glutamine amidotransferase [Morus notabilis]
 gb|EXB44908.1| Putative Glutamine amidotransferase [Morus notabilis]
Length=298

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 118/166 (71%), Gaps = 13/166 (8%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL ++G  +  +WT +LK+R+ FR+AFSGFD   V+K  EK+IT +S+   I 
Sbjct  142   DDNQLFELLAMSGMLMDYNWTEILKRRELFREAFSGFDPSKVAKMGEKEITEISSNKAIM  201

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L++ R           V ++FGSF NY+W+YV+HKP+  +Y++   +P+++ K+EAISKD
Sbjct  202   LAESR-----------VVREFGSFSNYMWSYVDHKPVINRYRYPRNVPLRSPKAEAISKD  250

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             ++KRGFR+VGP ++HSFMQAAGLT DHL  C RH+ C  LA  +RP
Sbjct  251   LLKRGFRFVGPVIVHSFMQAAGLTIDHLVNCYRHYECVSLA--ERP  294



>ref|XP_001754346.1| predicted protein [Physcomitrella patens]
 gb|EDQ80796.1| predicted protein, partial [Physcomitrella patens]
Length=175

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFEL+VL GAQ    W  +L +R +FR AF+ FD   V+K+ EKK  S+ A+  I 
Sbjct  18    DDKLLFELIVLQGAQAELSWPTILARRNNFRAAFANFDPAIVAKFDEKKKLSLIADSSIC  77

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
                ++VRGAVDN+  +L++ +++GS   +LW+YVNHKP+ +QYK   ++PVKT KSEA+S
Sbjct  78    FPEAKVRGAVDNAAHVLKIIEEYGSLSKFLWSYVNHKPVVSQYKLAKQVPVKTPKSEALS  137

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRH  849
             K++++RGFR+VGPT ++S MQAAGL  DHL TC ++
Sbjct  138   KELIRRGFRFVGPTTMYSVMQAAGLVCDHLVTCYKY  173



>ref|XP_009355560.1| PREDICTED: uncharacterized protein LOC103946559 [Pyrus x bretschneideri]
Length=315

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 123/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AFSGFD   V+K  EK+I  +++   I 
Sbjct  146   DDNQLFELLALSGMLMDHNWTEIVKRRELFREAFSGFDPNKVAKMEEKEIAEITSNKEIM  205

Query  1130  LSQVRGA--VDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L   R +  ++N+  IL++ ++FGSF +Y+W+YVNHKP+  ++++   +P++T K+E++S
Sbjct  206   LVDCRVSCIINNAKCILKIVREFGSFSSYIWSYVNHKPVINRFRYPRNVPLRTPKAESMS  265

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRYVGP +++SFMQAAGLTNDHL  C R+  C  LA  +RP
Sbjct  266   KDLIKRGFRYVGPVIVYSFMQAAGLTNDHLVDCYRYSECVNLA--ERP  311



>ref|XP_009356467.1| PREDICTED: uncharacterized protein LOC103947296 [Pyrus x bretschneideri]
Length=313

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 123/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AFSGFD   V+K  EK+I  +++   I 
Sbjct  144   DDNQLFELLALSGMLMDHNWTEIVKRRELFREAFSGFDPNKVAKMGEKEIAEITSNKEIM  203

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L   +VR  +DN+  IL++ ++FGSF +Y+W+ VNHKP+  ++++   +P++T K+E++S
Sbjct  204   LVDCKVRCIIDNAKCILKIVREFGSFSSYVWSSVNHKPVINRFRYPRNVPLRTPKAESMS  263

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRYVGP +++SFMQAAGLTNDHL  C R+  C  LA  +RP
Sbjct  264   KDLIKRGFRYVGPVIVYSFMQAAGLTNDHLVDCYRYSECVNLA--ERP  309



>ref|XP_004135425.1| PREDICTED: uncharacterized protein LOC101218195 [Cucumis sativus]
 gb|KGN52002.1| hypothetical protein Csa_5G606920 [Cucumis sativus]
Length=308

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AF+GF+   V+   EK+IT V+++  I 
Sbjct  139   DDNRLFELLALSGMLMDYNWTEIVKRRELFREAFAGFEPSVVANMGEKEITDVASDKAIM  198

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  IL++ + FGSF NY+W+YVN KP   +++    +P+++ K+EAIS
Sbjct  199   LVESRVRCIVDNAKCILKIARDFGSFSNYMWSYVNFKPTINRFRHPRNVPLRSPKAEAIS  258

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDMVKRGFR+VGP +++SFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  259   KDMVKRGFRFVGPVIVYSFMQAAGLTIDHLIDCFRHGECVNLA--ERP  304



>ref|XP_003516830.1| PREDICTED: uncharacterized protein LOC100810677 [Glycine max]
Length=314

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++  R+ F+GFDA  V+K  EK+I   ++   + 
Sbjct  145   DDNKLFELLALSGLLMDYNWTEILKRKETLREVFAGFDANTVAKMEEKEIMETASNKALS  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+V   VDN+  I+++ K+ GSF +Y+W YVNHKPI  +Y++   +P+++ K+EA+S
Sbjct  205   LADSRVMCVVDNAKCIMKIVKECGSFSSYIWGYVNHKPIINRYRYPRNVPLRSPKAEALS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD+VKRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDLVKRGFRFVGPVIVHSFMQAAGLTIDHLVDCYRHSECVSLA--ERP  310



>ref|XP_002988078.1| hypothetical protein SELMODRAFT_46169, partial [Selaginella moellendorffii]
 gb|EFJ10870.1| hypothetical protein SELMODRAFT_46169, partial [Selaginella moellendorffii]
Length=190

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 118/159 (74%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGI-  1134
             +D  LFELLV  GAQ    W+ +L KR+ +R AF+GFDAE VSK+ E KI+S+SA+  I 
Sbjct  32    DDKKLFELLVFAGAQAELSWSALLSKREHYRAAFAGFDAEVVSKFDEAKISSLSADPEIL  91

Query  1133  -ELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
                 ++R  VDN+  I+EV ++FGS D ++W +++HKPI  +Y+   ++P+K++KS+ +S
Sbjct  92    QHEGKIRQIVDNAKCIVEVVQEFGSLDKFVWNFLSHKPIVNRYRTPQQVPIKSAKSDLMS  151

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +D++KRGFR+VGPT+++SFMQAAG+TNDH+  C RH  C
Sbjct  152   RDLMKRGFRFVGPTIMYSFMQAAGMTNDHVLHCFRHQEC  190



>ref|NP_001240008.1| uncharacterized protein LOC100813637 [Glycine max]
 gb|ACU23388.1| unknown [Glycine max]
Length=314

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL ++G  +  +WT +LK+++  R+ F+GFDA  V+K  EK+I  +++   + 
Sbjct  145   DDNKLFELLAMSGLLMDYNWTEILKRKETLREVFAGFDANTVAKMKEKEIMEIASNKALS  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+V   VDN+  ++++ K+ GSF +Y+W YVNHKPI ++Y++   +P+++ K+EA+S
Sbjct  205   LADSRVMCIVDNAKCVMKIVKECGSFSSYIWGYVNHKPIISRYRYPRNVPLRSPKAEALS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD+VKRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDLVKRGFRFVGPVIVHSFMQAAGLTIDHLVDCYRHSECVSLA--ERP  310



>gb|KFK43621.1| hypothetical protein AALP_AA1G149800 [Arabis alpina]
Length=314

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT +LK+++ FR+AF  FD   V+K  +K+IT +++   I 
Sbjct  145   DDNLLFEFLAMSGMLMDYNWTEILKRKELFREAFCEFDPNLVAKMGDKEITEIASNKSIM  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I++V K+FGSF++++W +++HKPI  ++K+   +P+++ K+E IS
Sbjct  205   LQESRVRCIVDNAKCIIKVVKEFGSFNSFVWGFMDHKPIINKFKYSRNVPLRSPKAEIIS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHEDCVSLA--ERP  310



>ref|XP_012080476.1| PREDICTED: uncharacterized protein LOC105640691 [Jatropha curcas]
Length=322

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 125/168 (74%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFE+L L+G  +  +WT +LK+R+ FR+AF+GFD + V+K  EK+IT ++++  I 
Sbjct  153   DDNKLFEVLTLSGMLMDYNWTEILKRRELFREAFAGFDPKIVAKMGEKEITEIASDKTIM  212

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR   DN+  I++++++FGSF +Y+W YVN+KP+  +YK+   +P++T K+E IS
Sbjct  213   LAETRVRCIADNAKCIVKIEREFGSFSSYMWGYVNYKPMINRYKYPRNVPLRTPKAEIIS  272

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  273   KDLLKRGFRFVGPVIVYSFMQAAGLTIDHLVDCFRYGECVSLA--ERP  318



>ref|XP_002972716.1| hypothetical protein SELMODRAFT_98461 [Selaginella moellendorffii]
 gb|EFJ25937.1| hypothetical protein SELMODRAFT_98461 [Selaginella moellendorffii]
Length=252

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 118/159 (74%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGI-  1134
             +D  LFELLV  GAQ    W+ +L KR+ +R AF+GFDAE VSK+ E KI+S+SA+  I 
Sbjct  65    DDKKLFELLVFAGAQAELSWSALLSKREHYRAAFAGFDAEVVSKFDEAKISSLSADPEIL  124

Query  1133  -ELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
                 ++R  VDN+  I+EV ++FGS D ++W +++HKPI  +Y+   ++P+K++KS+ +S
Sbjct  125   QHEGKIRQIVDNAKCIVEVVQEFGSLDKFVWNFLSHKPIVNRYRTPQQVPIKSAKSDLMS  184

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +D++KRGFR+VGPT+++SFMQAAG+TNDH+  C RH  C
Sbjct  185   RDLMKRGFRFVGPTIMYSFMQAAGMTNDHVLHCFRHQEC  223



>ref|XP_008350880.1| PREDICTED: uncharacterized protein LOC103414261 [Malus domestica]
Length=313

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AFSGFD   V+K  EK+I  +++   I 
Sbjct  144   DDNQLFELLALSGMLMDHNWTEIVKRRELFREAFSGFDPNKVAKMGEKEIAEITSNKEIM  203

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L   +VR  +DN+  IL++ ++FGSF +Y+W+ VNHKP+  ++++   +P++T K+E++S
Sbjct  204   LVDCKVRCIIDNAKCILKIVREFGSFSSYVWSSVNHKPVINRFRYPRNVPLRTPKAESMS  263

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++ RGFRYVGP +++SFMQAAGLTNDHL  C R+  C  LA  +RP
Sbjct  264   KDLIXRGFRYVGPVIVYSFMQAAGLTNDHLVDCYRYSECVNLA--ERP  309



>ref|XP_001778877.1| predicted protein [Physcomitrella patens]
 gb|EDQ56327.1| predicted protein, partial [Physcomitrella patens]
Length=180

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D LLFEL+VL GAQ    W  +L +R +FR AF+ FD   V+K+ EKK  S+ A+  I 
Sbjct  19    DDKLLFELIVLQGAQAELSWPTILARRNNFRAAFANFDPAIVAKFDEKKKLSLIADSSIC  78

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
                ++VRGAVDN+  +L++ + +GS   +LW+YVNHKPI++QYK   ++PVKT KSEA+S
Sbjct  79    FPEAKVRGAVDNASHVLKIIEDYGSLSKFLWSYVNHKPISSQYKLAKQVPVKTPKSEALS  138

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHH  846
             K++++RGFR+VGPT ++S MQAAGL  DH+ TC ++ 
Sbjct  139   KELLRRGFRFVGPTTMYSVMQAAGLVCDHIVTCYKYQ  175



>gb|EMT03091.1| hypothetical protein F775_44010 [Aegilops tauschii]
Length=115

 Score =   171 bits (434),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 73/108 (68%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -1

Query  1163  ITSVSAEYGIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPV  984
             + SVSA YG++L  +RGAV+N+ RILEV++ FGSF  Y+W +VNHKP++  YK+  KIPV
Sbjct  1     MASVSAGYGLDLGTIRGAVNNACRILEVRRDFGSFGKYVWGFVNHKPLSPGYKYSRKIPV  60

Query  983   KTSKSEAISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KTSKSE+ISKDMV+RGFR+VGPTV+HSFMQA GLTNDHL +CPRH  C
Sbjct  61    KTSKSESISKDMVRRGFRFVGPTVLHSFMQAVGLTNDHLVSCPRHRVC  108



>ref|XP_006417105.1| hypothetical protein EUTSA_v10008250mg [Eutrema salsugineum]
 gb|ESQ35458.1| hypothetical protein EUTSA_v10008250mg [Eutrema salsugineum]
Length=314

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT +LK+++ FR+AF  FD   V+K  EK+IT +++   I 
Sbjct  145   DDNLLFEFLAMSGMLMDYNWTEILKRKELFREAFCEFDPNLVAKMGEKEITEIASNKAIM  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  V+N+   ++V K+FGSF +++W ++++KPI  ++K+   +P+++ K+E IS
Sbjct  205   LQESRVRCIVENAKCTMKVVKEFGSFSSFIWGFMDYKPIINKFKYSRNVPLRSPKAEIIS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLTNDHL  C RH  C  LA  +RP
Sbjct  265   KDMIKRGFRFVGPVIVHSFMQAAGLTNDHLVDCFRHGDCVSLA--ERP  310



>ref|XP_011009373.1| PREDICTED: uncharacterized protein LOC105114510 [Populus euphratica]
Length=317

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++ FR+AF GFD   V+K  EK+I  +++   I 
Sbjct  148   DDNQLFELLALSGMLMDYNWTEILKRKELFREAFEGFDPNIVAKMGEKEIMEIASNKAII  207

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDNS  IL++ ++FGSF NY+W  VN KP   +YK+   +P+++ K+EAIS
Sbjct  208   LAESRVRCIVDNSKCILKIAREFGSFSNYMWGNVNFKPTINRYKYPRNVPLRSPKAEAIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  268   KDLLKRGFRFVGPVIVYSFMQAAGLTIDHLVDCFRYSECVSLA--ERP  313



>ref|XP_007153437.1| hypothetical protein PHAVU_003G035100g [Phaseolus vulgaris]
 gb|ESW25431.1| hypothetical protein PHAVU_003G035100g [Phaseolus vulgaris]
Length=314

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL ++G  +  +WT +LK+++  R+ F+GFDA  V+K  EK+I  +++   + 
Sbjct  145   DDNKLFELLAMSGLLMDYNWTEILKRKETLREVFAGFDANTVAKMEEKEIVEIASNKALS  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+V   VDN+  I ++ K+ GSF +Y+W YVNHKPI  +YK+   +P+++ K+E +S
Sbjct  205   LADSRVMCIVDNAKCITKIVKECGSFSSYIWGYVNHKPIINRYKYPRNVPLRSPKAEILS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD+VKRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDLVKRGFRFVGPVIVHSFMQAAGLTIDHLVDCYRHSECVSLA--ERP  310



>ref|XP_007045734.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY01566.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
Length=323

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 123/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++ +R+AFSGFD E V+K  +K+I  +S++  I 
Sbjct  154   DDNQLFELLALSGMLMDYNWTEILKRKELYREAFSGFDPEIVAKMGDKEINEISSDKAIM  213

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  IL++ +++GSF +++W YVN+KP   +YK+   +P++T K+EAIS
Sbjct  214   LAESRVRCIVDNAKCILKIVREYGSFSSFMWGYVNYKPTINRYKYPRNVPLRTPKAEAIS  273

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             +D++KRGFR+VGP ++ SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  274   RDLLKRGFRFVGPVIVCSFMQAAGLTIDHLVDCFRYSECVGLA--ERP  319



>ref|XP_010476370.1| PREDICTED: uncharacterized protein LOC104755649 [Camelina sativa]
Length=314

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT +LK+++ FR+AF  FD   V+K  EK+IT +++   I 
Sbjct  145   DDNLLFEFLAMSGMLMDYNWTEILKRKELFREAFCEFDPNLVAKMGEKEITEIASNKAIM  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I +V K+FGSF +++W ++++KPI +++K+   +P+++ K+E IS
Sbjct  205   LQESRVRCIVDNAKCITKVVKEFGSFSSFMWGFMDYKPIISKFKYPRNVPLRSPKAEIIS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHGDCVSLA--ERP  310



>ref|XP_002314913.2| hypothetical protein POPTR_0010s14710g [Populus trichocarpa]
 gb|EEF01084.2| hypothetical protein POPTR_0010s14710g [Populus trichocarpa]
Length=317

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++ FR+AF GFD   V+K  EK+I  +++   I 
Sbjct  148   DDNQLFELLALSGMLMDYNWTEILKRKELFREAFEGFDPNIVAKMGEKEIMEIASNKAIM  207

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDNS  IL++ ++FGSF NY+W  VN KP   +YK+   +P+++ K+EAIS
Sbjct  208   LAESRVRCIVDNSKCILKIAREFGSFSNYMWGNVNFKPTINRYKYPRNVPLRSPKAEAIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+ GP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  268   KDLLKRGFRFAGPVIVYSFMQAAGLTIDHLVDCFRYSECVSLA--ERP  313



>ref|XP_009104493.1| PREDICTED: uncharacterized protein LOC103830461 [Brassica rapa]
Length=182

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+ T KKITS   +  + 
Sbjct  22    DDKKLFELLSLSGALAELSWKDILSKRQSFREVFMDFDPVAISELTNKKITS--PDSLLS  79

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
               ++R  ++N+ ++ ++  +FGSFD Y+W +VNHKP  +Q+++  ++P KTSK+E ISKD
Sbjct  80    EQKLRSILENANQVRKIIVEFGSFDKYIWNFVNHKPTQSQFRYQRQVPAKTSKAELISKD  139

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +V+RGFR V PTVI+SFMQ AGLTNDHLT+C RHH C
Sbjct  140   LVRRGFRSVSPTVIYSFMQTAGLTNDHLTSCFRHHEC  176



>emb|CDP00487.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D+ LFELL L+G  +  +WT +LK+++ FR+ F+GFDA  V+K  EK+IT + +   + 
Sbjct  148   DDHQLFELLALSGMLMDFNWTEILKRKELFREVFAGFDANNVAKMGEKEITDIVSNKALM  207

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR  VDN+  IL++ K+FGSF +Y+W YV++KPI  +YK    +P+++ K+EAIS
Sbjct  208   LAECRVRCIVDNANCILKIVKEFGSFSSYMWNYVSYKPIINRYKHPRNVPLRSPKAEAIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP ++HSFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  268   KDLLKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRYSECVNLA--ERP  313



>ref|XP_002890014.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66273.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=310

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFELL ++G  +  +WT ++K+++ FR+AF  FD   V+K  EK IT +++   I 
Sbjct  141   DDNLLFELLAMSGMLMDYNWTEIIKRKELFREAFCEFDPNLVAKMGEKDITEIASNKAIM  200

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I +V K+FGSF +++W ++++KPI  ++K+   +P+++ K+E IS
Sbjct  201   LQESRVRCIVDNAKCITKVVKEFGSFSSFIWGFMDYKPIINKFKYSRNVPLRSPKAEIIS  260

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  261   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHGDCVSLA--ERP  306



>ref|XP_006857230.1| PREDICTED: uncharacterized protein LOC18447066 [Amborella trichopoda]
 gb|ERN18697.1| hypothetical protein AMTR_s00065p00208780 [Amborella trichopoda]
Length=397

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F  FD  +V+K +EKKI S++   G++
Sbjct  181   DDKKLFELLVLSGALAELTWPSILSKRHTFREVFLDFDPASVAKLSEKKIISIANNAGLQ  240

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+  I ++  +FGSFD Y W++VN+KPI  ++++  K+PVKT K++ IS
Sbjct  241   LSEPKLRAVIENARLISKIITEFGSFDRYCWSFVNNKPIVNKFRYPRKVPVKTPKADVIS  300

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+VKRGFRYVGPTV++SFMQAAG+TNDHL +C R   C
Sbjct  301   KDLVKRGFRYVGPTVVYSFMQAAGITNDHLVSCFRFEEC  339



>ref|XP_002514580.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
 gb|EEF47686.1| DNA-3-methyladenine glycosylase, putative [Ricinus communis]
Length=319

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK++Q FR+AF+GFD   V+   EK+I  +++   I 
Sbjct  150   DDNQLFELLALSGMLMDYNWTEILKRKQLFREAFAGFDPNIVANMGEKEILDIASNKAIM  209

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I ++ ++FGSF +++W +VN+KP   +YK+   +P++T K+EAIS
Sbjct  210   LADSRVRCIVDNAKCIAKIAREFGSFSSFMWGHVNYKPTINKYKYPRNVPLRTPKAEAIS  269

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  270   KDLLKRGFRFVGPVIVYSFMQAAGLTIDHLVDCFRHGECVGLA--ERP  315



>ref|XP_002968680.1| hypothetical protein SELMODRAFT_90743, partial [Selaginella moellendorffii]
 gb|EFJ29796.1| hypothetical protein SELMODRAFT_90743, partial [Selaginella moellendorffii]
Length=218

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGI-  1134
             +DNLLFELLVL GAQ    W+++L KR  +R AF GFD  AV+ + +KK+ ++ +E  I 
Sbjct  20    DDNLLFELLVLAGAQSEMGWSLILSKRDCYRRAFQGFDPAAVAAFDKKKVAALKSEVDIY  79

Query  1133  -ELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
              +  +++  ++N+ R+L++ ++ GS  NYLW ++NHKP+   ++   ++P+KTSKSE IS
Sbjct  80    QQEGKLQAVIENAGRVLQIVQECGSLSNYLWGFLNHKPVTPNFRMPAQVPIKTSKSEFIS  139

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +D+V+RGF  VGPT ++S MQAAG+TNDH T C RH  C
Sbjct  140   RDLVRRGFSCVGPTTVYSLMQAAGMTNDHTTQCFRHKEC  178



>ref|XP_004490266.1| PREDICTED: probable GMP synthase [glutamine-hydrolyzing]-like 
[Cicer arietinum]
Length=297

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL ++G  +  +WT +LK++Q  R AF+GFD   V+K  EK+I  +++   + 
Sbjct  128   DDKKLFELLAMSGLLIDYNWTEILKRKQVLRQAFAGFDPNIVAKMEEKEIMEIASNKELV  187

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L+  +V+  VDN+  I+++ +++GSF +Y+W YVNHKP+  +YK+   +P++T K+EAIS
Sbjct  188   LADCRVKCIVDNAKCIIKIMREYGSFSSYIWGYVNHKPVINKYKYPRDVPLRTPKAEAIS  247

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR++GP +++SFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  248   KDLIKRGFRFLGPVIVYSFMQAAGLTIDHLVDCYRHKECVSLA--ERP  293



>ref|XP_004509952.1| PREDICTED: probable GMP synthase [glutamine-hydrolyzing]-like 
[Cicer arietinum]
Length=317

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL ++G  +  +WT ++K+++  R+ F+GFD   V+K  EK+I  +++   + 
Sbjct  148   DDNKLFELLAMSGLLMDYNWTEIIKRKETLREVFAGFDPYTVAKMEEKEIIEIASNKALS  207

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+V   VDN+  I+++ ++ GSF +Y+W +VNHKPI  +YK+   +P+++ K+EA+S
Sbjct  208   LADSRVMCIVDNAKCIMKIVRECGSFSSYIWGFVNHKPIINKYKYPRSVPLRSPKAEALS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDMVKRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  268   KDMVKRGFRFVGPVIVHSFMQAAGLTIDHLVDCYRHCECVSLA--ERP  313



>gb|KHN19385.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=311

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL ++G  +  +WT +LK+++  R+ F+GFDA  V+K  EK+I  +++   + 
Sbjct  145   DDNKLFELLAMSGLLMDYNWTEILKRKETLREVFAGFDANTVAKMKEKEIMEIASNKALS  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+V   VDN+  I+   K+ GSF +Y+W YVNHKPI ++Y++   +P+++ K+EA+S
Sbjct  205   LADSRVMCIVDNAKCIV---KECGSFSSYIWGYVNHKPIISRYRYPRNVPLRSPKAEALS  261

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD+VKRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  262   KDLVKRGFRFVGPVIVHSFMQAAGLTIDHLVDCYRHSECVSLA--ERP  307



>ref|XP_010528005.1| PREDICTED: uncharacterized protein LOC104805218 [Tarenaya hassleriana]
Length=317

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL ++G  +  +WT +LK+++ FR+AF GFD   V+K  EK+IT +++   I 
Sbjct  148   DDNQLFELLAMSGMLMDFNWTEILKRKELFREAFVGFDPNLVAKMGEKEITEIASNKAIT  207

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L +  VR  VDN+  I++V K+FGSF +++W ++++KP+  ++K+   +P++T K+E IS
Sbjct  208   LQECRVRCIVDNAKCIVKVAKEFGSFSSFMWGFMDYKPVINRFKYPRNVPLRTPKAEIIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  268   KDLIKRGFRFVGPVIVYSFMQAAGLTIDHLVDCFRHGECVSLA--ERP  313



>ref|XP_008446481.1| PREDICTED: uncharacterized protein LOC103489204 [Cucumis melo]
Length=370

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AF+GF+   V+   EK+IT ++++  I 
Sbjct  201   DDNRLFELLALSGMLMDYNWTEIVKRRELFREAFAGFEPSIVANMGEKEITDIASDKAIM  260

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  IL++ + FGSF NY+W+ VN KP   +++    +P+++ K+EAIS
Sbjct  261   LVESRVRCIVDNAKCILKIARDFGSFSNYMWSSVNFKPTINRFRHPRNVPLRSPKAEAIS  320

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDMVKRGFR+VGP +++SFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  321   KDMVKRGFRFVGPVIVYSFMQAAGLTIDHLIDCFRHGECVNLA--ERP  366



>gb|KHN37232.1| Putative GMP synthase [glutamine-hydrolyzing] [Glycine soja]
Length=318

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 119/172 (69%), Gaps = 8/172 (5%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++  R+ F+GFDA  V+K  EK+I   ++   + 
Sbjct  145   DDNKLFELLALSGLLMDYNWTEILKRKETLREVFAGFDANTVAKMEEKEIMETASNKALS  204

Query  1130  L--SQVRGAVDNSIRILE----VKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKS  969
             L  S+V   VDN+  I++    + K+ GSF +Y+W YVNHKPI  +Y++   +P+++ K+
Sbjct  205   LADSRVMCVVDNAKCIMKASTHIVKECGSFSSYIWGYVNHKPIINRYRYPRNVPLRSPKA  264

Query  968   EAISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             EA+SKD+VKRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   EALSKDLVKRGFRFVGPVIVHSFMQAAGLTIDHLVDCYRHSECVSLA--ERP  314



>ref|XP_002989930.1| hypothetical protein SELMODRAFT_130680, partial [Selaginella 
moellendorffii]
 gb|EFJ08943.1| hypothetical protein SELMODRAFT_130680, partial [Selaginella 
moellendorffii]
Length=216

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGI-  1134
             +DNLLFELLVL GAQ    W+++L KR  +R AF GFD  AV+ + +KK+ ++ ++  I 
Sbjct  18    DDNLLFELLVLAGAQSEMGWSLILSKRDCYRRAFQGFDPAAVAAFDKKKVAALKSDVDIY  77

Query  1133  -ELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
              +  +++  ++N+ R+L++ ++ GS  NYLW ++NHKP+   ++   ++P+KTSKSE IS
Sbjct  78    QQEGKLQAVIENAGRVLQIVQECGSLSNYLWGFLNHKPVTPNFRMPAQVPIKTSKSEFIS  137

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +D+V+RGF  VGPT ++S MQAAG+TNDH T C RH  C
Sbjct  138   RDLVRRGFSCVGPTTVYSLMQAAGMTNDHTTQCFRHKEC  176



>ref|XP_010458816.1| PREDICTED: uncharacterized protein LOC104740019 [Camelina sativa]
Length=314

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT +LK+++ FR+AF  FD   V+K  EK+IT +++   I 
Sbjct  145   DDNLLFEFLAMSGMLMDYNWTEILKRKELFREAFCEFDPNLVAKMGEKEITEIASNKAIM  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I +V K+FGS  +++W ++++KPI  ++K+   +P+++ K+E IS
Sbjct  205   LQESRVRCIVDNAKCITKVVKEFGSLSSFMWGFMDYKPIINKFKYPRNVPLRSPKAEIIS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHGDCVSLA--ERP  310



>ref|XP_007045735.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY01567.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
Length=303

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 123/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +++ LFELL L+G  +  +WT +LK+++ +R+AFSGFD E V+K  +K+I  +S++  I 
Sbjct  134   KNSQLFELLALSGMLMDYNWTEILKRKELYREAFSGFDPEIVAKMGDKEINEISSDKAIM  193

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  IL++ +++GSF +++W YVN+KP   +YK+   +P++T K+EAIS
Sbjct  194   LAESRVRCIVDNAKCILKIVREYGSFSSFMWGYVNYKPTINRYKYPRNVPLRTPKAEAIS  253

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             +D++KRGFR+VGP ++ SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  254   RDLLKRGFRFVGPVIVCSFMQAAGLTIDHLVDCFRYSECVGLA--ERP  299



>ref|XP_006303106.1| hypothetical protein CARUB_v100220021mg, partial [Capsella rubella]
 gb|EOA36004.1| hypothetical protein CARUB_v100220021mg, partial [Capsella rubella]
Length=198

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  1316  REEDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYG  1137
             R++D  LFELLV + A     W  +L KR DFR  F  FD  A+S++TEK++ S+     
Sbjct  16    RDDDKKLFELLVFSQALAELSWPSILLKRNDFRKLFEEFDPLAISQFTEKRLMSLRVNGC  75

Query  1136  IELSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEA  963
             + LS+  +R  V+N+  +L+VK++FGSF NY W +VNH+P+   Y++  ++PVK+ K+E 
Sbjct  76    LILSEQKLRAIVENAKSVLKVKQEFGSFSNYCWRFVNHEPLRNGYRYGRQVPVKSPKAEY  135

Query  962   ISKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             ISKDM++RGFR VGPTVI+SF+QA+G+ NDHLT C R+  C
Sbjct  136   ISKDMMQRGFRCVGPTVIYSFLQASGIVNDHLTACFRYQEC  176



>ref|XP_010495464.1| PREDICTED: uncharacterized protein LOC104772561 [Camelina sativa]
Length=314

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT + K+++ FR+AF  FD   V+K  EK+IT +++   I 
Sbjct  145   DDNLLFEFLAMSGMLMDYNWTEIQKRKELFREAFCEFDPNLVAKMGEKEITEIASNKAIM  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I +V K+FGSF +++W ++++KPI  ++K+   +P+++ K+E IS
Sbjct  205   LQESRVRCIVDNAKCITKVVKEFGSFSSFMWGFMDYKPIINKFKYPRNVPLRSPKAEIIS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHGDCVSLA--ERP  310



>ref|XP_006280730.1| hypothetical protein CARUB_v10026699mg [Capsella rubella]
 gb|EOA13628.1| hypothetical protein CARUB_v10026699mg [Capsella rubella]
Length=348

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KRQDFR+ F+ FD  A+ K  EKK+T         
Sbjct  182   DDKRLFELLVLSGALAEHTWPTILSKRQDFREVFADFDPNAIVKINEKKLTGPGTTASTL  241

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS  ++R  ++N+ +IL+V +++GSFD Y+W++V +K I +++++  ++P KT K+E IS
Sbjct  242   LSDLKLRAVIENARQILKVIEEYGSFDKYIWSFVKNKAIVSKFRYQRQVPAKTPKAEVIS  301

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTV++SFMQAAG+TNDHLT+C R H C
Sbjct  302   KDLVRRGFRSVGPTVVYSFMQAAGITNDHLTSCFRFHHC  340



>ref|XP_007223145.1| hypothetical protein PRUPE_ppa009020mg [Prunus persica]
 gb|EMJ24344.1| hypothetical protein PRUPE_ppa009020mg [Prunus persica]
Length=310

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AF GFD   V+K  EK+I  +++   I 
Sbjct  141   DDNQLFELLALSGMLMDHNWTEIVKRRELFREAFFGFDPNKVAKMGEKEIAEIASNKAIM  200

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR  +DN+  IL++ ++ GSF +Y+W  VNHKP+  ++++   +P+++ K+EA+S
Sbjct  201   LAECKVRCIIDNAKCILKIVRECGSFSSYMWGSVNHKPVINRFRYPRNVPLRSPKAEAMS  260

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRYVGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  261   KDLIKRGFRYVGPVIVYSFMQAAGLTIDHLVDCYRYSECVSLA--ERP  306



>ref|XP_009123960.1| PREDICTED: uncharacterized protein LOC103848889 [Brassica rapa]
Length=314

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT +LK+++ FR++F  FD   V+   EK+IT +++   I 
Sbjct  145   DDNLLFEYLAMSGMLMDYNWTEILKRKELFRESFCEFDPNLVANMGEKEITEIASNKAIM  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  ++VR  VDN+  I +V K+FGSF +Y+W ++++KPI  ++K+   +P+++ K+E IS
Sbjct  205   LQETRVRCIVDNARCITKVVKEFGSFSSYMWGFMDYKPIINRFKYSRNVPLRSPKAEIIS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHGDCVSLA--ERP  310



>ref|XP_003580082.1| PREDICTED: uncharacterized protein LOC100824759 [Brachypodium 
distachyon]
Length=387

 Score =   175 bits (443),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+G+     W  +L KR  FR+ F  FD   VSK +EKKI +  +     
Sbjct  178   DDKKLFELLVLSGSLAELTWPTILNKRSIFREVFMDFDPVLVSKLSEKKIIAPGSPSSSL  237

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +IL++K++FGSFD Y W++VNHKPI +++++  ++PVKTSK++AIS
Sbjct  238   LSEQKLRGVLENARQILKIKEEFGSFDKYCWSFVNHKPIFSRFRYPRQVPVKTSKADAIS  297

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             KD+V+RGFR VGPTV+++FMQ +G+TNDHLT+C R   CA  A    P+
Sbjct  298   KDLVRRGFRSVGPTVVYTFMQVSGMTNDHLTSCYRFAECASPATGANPT  346



>ref|NP_973818.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 ref|NP_001184988.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 gb|AEE29051.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 gb|AEE29052.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
Length=311

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT +LK+++ FR+AF  FD   V+K  EK+I  +++   I 
Sbjct  142   DDNLLFEFLAMSGMLMDYNWTEILKRKEHFREAFCEFDPNRVAKMGEKEIAEIASNKAIM  201

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I +V  +FGSF +++W ++++KPI  ++K+   +P+++ K+E IS
Sbjct  202   LQESRVRCIVDNAKCITKVVNEFGSFSSFVWGFMDYKPIINKFKYSRNVPLRSPKAEIIS  261

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  262   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHGDCVSLA--ERP  307



>ref|XP_008243789.1| PREDICTED: uncharacterized protein LOC103342008 [Prunus mume]
Length=310

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AF GFD   V+K  EK+I  +++   I 
Sbjct  141   DDNQLFELLALSGMLMDHNWTEIVKRRELFREAFFGFDPNKVAKMGEKEIAEIASNKAIM  200

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR  +DN+  IL++ ++ GSF +Y+W  VNHKP+  ++++   +P+++ K+EA+S
Sbjct  201   LAECKVRCIIDNAKCILKIVRECGSFSSYMWGSVNHKPVINRFRYPRNVPLRSPKAEAMS  260

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRYVGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  261   KDLIKRGFRYVGPVIVYSFMQAAGLTIDHLVDCYRYSECVSLA--ERP  306



>gb|AFK48319.1| unknown [Medicago truncatula]
 gb|KEH17530.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=307

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+G  +  +WT +LK+++  R  F+GFD   VSK  EK++  +++   + 
Sbjct  138   DDKKLFELLALSGLLIDYNWTEILKRKEVLRQVFAGFDPYTVSKMEEKEVIDIASATELV  197

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  V+  VDN+  +++++++FGSF +Y+W+YVNHKP+  +Y++   +P++T K++AIS
Sbjct  198   LAECRVKCIVDNAKCMMKIRREFGSFSSYIWSYVNHKPVINKYRYSRDVPLRTPKADAIS  257

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRY+GP +++SFMQ AGLT DHL  C RH  C  LA  +RP
Sbjct  258   KDLLKRGFRYLGPVIVYSFMQVAGLTIDHLVGCYRHKECVNLA--ERP  303



>gb|KEH17529.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=308

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+G  +  +WT +LK+++  R  F+GFD   VSK  EK++  +++   + 
Sbjct  139   DDKKLFELLALSGLLIDYNWTEILKRKEVLRQVFAGFDPYTVSKMEEKEVIDIASATELV  198

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  V+  VDN+  +++++++FGSF +Y+W+YVNHKP+  +Y++   +P++T K++AIS
Sbjct  199   LAECRVKCIVDNAKCMMKIRREFGSFSSYIWSYVNHKPVINKYRYSRDVPLRTPKADAIS  258

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRY+GP +++SFMQ AGLT DHL  C RH  C  LA  +RP
Sbjct  259   KDLLKRGFRYLGPVIVYSFMQVAGLTIDHLVGCYRHKECVNLA--ERP  304



>ref|XP_010428513.1| PREDICTED: uncharacterized protein LOC104713152 [Camelina sativa]
Length=316

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELLV + A     W  +L KR+DFR  F  FD  A+S++TEK++TS+     + 
Sbjct  147   DDNKLFELLVFSQALAEFSWPSILHKREDFRKLFEEFDPSAISQFTEKRLTSLRVNGCLI  206

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+  +L+VK+++GSF NY W +VNHKP+   Y++  ++PVK+ K+E IS
Sbjct  207   LSEQKLRAIVENAKSVLKVKQEYGSFSNYCWRFVNHKPLRNGYRYGRQVPVKSPKAEYIS  266

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTVI+SF+QA+G+ NDHLT C R+  C
Sbjct  267   KDMMQRGFRCVGPTVIYSFLQASGILNDHLTACFRYQEC  305



>ref|XP_006304034.1| hypothetical protein CARUB_v10009802mg [Capsella rubella]
 gb|EOA36932.1| hypothetical protein CARUB_v10009802mg [Capsella rubella]
Length=314

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DNLLFE L ++G  +  +WT +LK+++ FR+ F  FD   V+   EK+IT +++   I 
Sbjct  145   DDNLLFEFLAMSGMLMDYNWTEILKRKELFREVFCEFDPNVVANMGEKEITEIASNKAIM  204

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I++V  +FGSF +++W ++++KPI  ++K+   +P+++ K+E IS
Sbjct  205   LQESRVRCVVDNAKCIIKVVNEFGSFSSFMWGFMDYKPIINKFKYPRNVPLRSPKAEIIS  264

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDM+KRGFR+VGP ++HSFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  265   KDMIKRGFRFVGPVIVHSFMQAAGLTIDHLVDCFRHGDCVSLA--ERP  310



>gb|KJB50513.1| hypothetical protein B456_008G174900 [Gossypium raimondii]
Length=320

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK++  +R++F GFD E V+K  +K+I  +S+   + 
Sbjct  151   DDNKLFELLALSGMLMDYNWTEILKRKDLYRESFLGFDPEIVAKMGDKEIHEISSNKAMM  210

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  IL++ +Q+GSF +++W YVN+KP   +YK+   +P++T K+EAIS
Sbjct  211   LAESRVRCIVDNAKCILKIVRQYGSFSSFMWGYVNYKPTINKYKYPRNVPLRTPKAEAIS  270

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD+VK GFR+VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  271   KDLVKHGFRFVGPVIVYSFMQAAGLTIDHLVDCFRYSECVSLA--ERP  316



>ref|XP_010265584.1| PREDICTED: uncharacterized protein LOC104603287 [Nelumbo nucifera]
Length=380

 Score =   174 bits (440),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFE LVL+GA     W ++L KR  FR+ F+ FD  AVSK  EKKIT+        
Sbjct  176   DDKKLFEFLVLSGALAELPWPVILSKRHIFREVFADFDPVAVSKLNEKKITTPGGTAISL  235

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +I +V  +FGSF+NY+W++VNHKPI +++++  ++PVKT K++ IS
Sbjct  236   LSELKLRAIIENARQICKVIDEFGSFNNYIWSFVNHKPIISKFRYPRQVPVKTPKADVIS  295

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             KD+V+RGFR VGPTVI+SFMQ AG+TNDHL  C R+  C +  A
Sbjct  296   KDLVRRGFRSVGPTVIYSFMQVAGITNDHLINCFRYQECIDATA  339



>ref|XP_012071504.1| PREDICTED: uncharacterized protein LOC105633512 [Jatropha curcas]
 ref|XP_012071505.1| PREDICTED: uncharacterized protein LOC105633512 [Jatropha curcas]
 gb|KDP38677.1| hypothetical protein JCGZ_04030 [Jatropha curcas]
Length=382

 Score =   174 bits (440),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AVSK+ EKKI +  +     
Sbjct  183   DDKKLFELLVLSGALAELTWPAILSKRHIFREVFADFDPVAVSKFNEKKIIAPGSTANSL  242

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+V  R  ++N+ +I +V  +FGSFD Y+W++VN+KPI +++++  +IPVKT K++ IS
Sbjct  243   LSEVKLRAVIENARQISKVIDEFGSFDKYIWSFVNYKPIVSRFRYPRQIPVKTPKADVIS  302

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             KD+V+RGFR VGPTV++SFMQAAGLTNDHL  C R   C   AA
Sbjct  303   KDLVRRGFRSVGPTVVYSFMQAAGLTNDHLIGCFRFQECMNNAA  346



>gb|KJB65788.1| hypothetical protein B456_010G113100 [Gossypium raimondii]
Length=214

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1298  LFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIELSQV  1119
             LFELLVL GA     W  +L KR  FR+ F+ FD  AVSK  EKK+ +  +     LS++
Sbjct  20    LFELLVLAGALSELTWPAILSKRHIFREVFADFDPLAVSKLNEKKLIAPGSTASSLLSEL  79

Query  1118  --RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKDMV  945
               R  V+N+ +I +V  +FGSFD Y+W++VNHKPI +++++  ++PVKT K++ ISKD+V
Sbjct  80    KLRAIVENAHQISKVIDEFGSFDKYIWSFVNHKPIVSRFRYPRQVPVKTPKADVISKDLV  139

Query  944   KRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             +RGFR VGPTVI+SFMQ +G+TNDHLT+C R   C   A
Sbjct  140   RRGFRSVGPTVIYSFMQVSGITNDHLTSCFRFQDCITAA  178



>ref|XP_006437842.1| hypothetical protein CICLE_v10032151mg [Citrus clementina]
 gb|ESR51082.1| hypothetical protein CICLE_v10032151mg [Citrus clementina]
Length=317

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++ FR+AF GFD ++V+K  EK+I  +S+   I 
Sbjct  148   DDNQLFELLALSGMLMDYNWTEILKRKELFREAFGGFDPKSVAKMGEKEILEISSNTAIM  207

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR  VDN+  I+++  +FGSF +++W YVN KP+  ++++   +P+++ K+EAIS
Sbjct  208   LAECRVRCIVDNAKCIMKILNEFGSFSSFMWGYVNFKPMINKFRYPRNVPLRSPKAEAIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             +D++KRGFR VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  268   RDLLKRGFRLVGPVIVYSFMQAAGLTIDHLVDCFRYSECVSLA--ERP  313



>ref|XP_002864542.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40801.1| methyladenine glycosylase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=349

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W ++L KRQ FR+ F+ FD  A+ K  EKK+    +     
Sbjct  183   DDKRLFELLVLSGALAEHTWPMILSKRQTFREVFADFDPNAIVKINEKKLIGPGSPASTL  242

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS  ++RG ++N+ +IL+V +++GSFD Y+W++V +K I +++++  ++P KT K+E IS
Sbjct  243   LSDLKLRGVIENARQILKVIEEYGSFDKYIWSFVKNKAIVSKFRYQRQVPAKTPKAEVIS  302

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTV++SFMQAAG+TNDHLT+C R H C
Sbjct  303   KDLVRRGFRSVGPTVVYSFMQAAGVTNDHLTSCFRFHHC  341



>ref|XP_008669205.1| PREDICTED: uncharacterized protein LOC100216672 [Zea mays]
 tpg|DAA37081.1| TPA: hypothetical protein ZEAMMB73_719011 [Zea mays]
Length=389

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F  FD   VSK +EKKI +  +     
Sbjct  179   DDKKLFELLVLSGALAELTWPAILNKRDIFREVFMDFDPVLVSKLSEKKIIAPGSPSCSL  238

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +IL++ ++FGSFD Y W++VNHKPI +++++  ++PVKTSK++AIS
Sbjct  239   LSEQKLRGVIENARQILKIIEEFGSFDKYCWSFVNHKPILSRFRYSRQVPVKTSKADAIS  298

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             KD+V+RGFR VGPTV+++FMQ +G+TNDHL +C R   CA  +A
Sbjct  299   KDLVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECAASSA  342



>emb|CDX67972.1| BnaA07g20120D [Brassica napus]
Length=259

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+ T KKITS   +  + 
Sbjct  99    DDKKLFELLSLSGALAELSWKDILSKRQSFREVFMDFDPVAISELTNKKITS--PDSLLS  156

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
               ++R  ++N+ ++ ++  +FGSFD Y+W +VNHKP  +++++  ++P KTSK+E ISKD
Sbjct  157   EQKLRSILENANQVRKIIVEFGSFDKYIWNFVNHKPTQSRFRYQRQVPAKTSKAELISKD  216

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +V+RGFR V PTVI+SFMQ AGLTNDHLT+C RHH C
Sbjct  217   LVRRGFRSVSPTVIYSFMQTAGLTNDHLTSCFRHHEC  253



>ref|XP_010416373.1| PREDICTED: uncharacterized protein LOC104702246 [Camelina sativa]
Length=331

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV T A     W  +L KR+DFR  F  FD  A+S++TEK++TS+     + 
Sbjct  148   DDKKLFELLVFTQALAEFSWPSILHKREDFRKLFEEFDPSAISQFTEKRLTSLRVNGCLI  207

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+  +L+VK+++GSF NY W +VNHKP+   Y++  ++PVK+ K+E IS
Sbjct  208   LSEQKLRAIVENAKSVLKVKQEYGSFSNYCWRFVNHKPLRNGYRYGRQVPVKSPKAEYIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTVI+SF+QA+G+ NDHLT C R+  C
Sbjct  268   KDMMQRGFRCVGPTVIYSFLQASGIVNDHLTACFRYQEC  306



>ref|XP_010275821.1| PREDICTED: uncharacterized protein LOC104610746 [Nelumbo nucifera]
Length=387

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ FS FD  AVSK  EKKIT+  +     
Sbjct  176   DDKKLFELLVLSGALAELTWPTILSKRHIFREVFSDFDPVAVSKLNEKKITAPGSTASSL  235

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +I +V  +FGSFDNY+W++VNHKPI +++++  ++PVK  K++ IS
Sbjct  236   LSELKLRAIIENARQICKVIDEFGSFDNYIWSFVNHKPIISKFRYPRQVPVKIPKADVIS  295

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAE  834
             KD+V+RGFR VGPTV++SFMQ AG+TNDHL  C R   C +
Sbjct  296   KDLVRRGFRSVGPTVVYSFMQVAGITNDHLINCFRFQVCMD  336



>ref|XP_006484265.1| PREDICTED: uncharacterized protein LOC102627575 isoform X1 [Citrus 
sinensis]
Length=317

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++ FR+AF GFD ++V+K  EK+I  +S+   I 
Sbjct  148   DDNQLFELLALSGMLMDYNWTEILKRKELFREAFGGFDPKSVAKMGEKEILEISSNTAIM  207

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR  VDN+  I+++  +FGSF +++W YVN KP+  ++++   +P+++ K+EAIS
Sbjct  208   LAECRVRCIVDNAKCIVKILNEFGSFSSFMWGYVNFKPMINKFRYPRNVPLRSPKAEAIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             +D++KRGFR VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  268   RDLLKRGFRLVGPVIVYSFMQAAGLTIDHLVDCFRYSECVSLA--ERP  313



>gb|KDO70261.1| hypothetical protein CISIN_1g021082mg [Citrus sinensis]
Length=316

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++ FR+AF GFD ++V+K  EK+I  +S+   I 
Sbjct  147   DDNQLFELLALSGMLMDYNWTEILKRKELFREAFGGFDPKSVAKMGEKEILEISSNTAIM  206

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR  VDN+  I+++  +FGSF +++W YVN KP+  ++++   +P+++ K+EAIS
Sbjct  207   LAECRVRCIVDNAKCIVKILNEFGSFSSFMWGYVNFKPMINKFRYPRNVPLRSPKAEAIS  266

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             +D++KRGFR VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  267   RDLLKRGFRLVGPVIVYSFMQAAGLTIDHLVDCFRYSECVSLA--ERP  312



>gb|KDO70260.1| hypothetical protein CISIN_1g021082mg [Citrus sinensis]
Length=317

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +LK+++ FR+AF GFD ++V+K  EK+I  +S+   I 
Sbjct  148   DDNQLFELLALSGMLMDYNWTEILKRKELFREAFGGFDPKSVAKMGEKEILEISSNTAIM  207

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L++  VR  VDN+  I+++  +FGSF +++W YVN KP+  ++++   +P+++ K+EAIS
Sbjct  208   LAECRVRCIVDNAKCIVKILNEFGSFSSFMWGYVNFKPMINKFRYPRNVPLRSPKAEAIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             +D++KRGFR VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  268   RDLLKRGFRLVGPVIVYSFMQAAGLTIDHLVDCFRYSECVSLA--ERP  313



>ref|XP_009782048.1| PREDICTED: uncharacterized protein LOC104230847 [Nicotiana sylvestris]
Length=318

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSV--SAEYG  1137
             +D+ LFELL L G  +  +WT +LK+R+  R+AF+GF+A  V+K  E++I  +  + E  
Sbjct  149   DDHQLFELLALCGMLMDFNWTEILKRREQIREAFAGFNANHVAKMGEREIEELISNTELN  208

Query  1136  IELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             +  S+VR  VDN+  I+++ ++FGSF +Y+W YVN+KPI  ++++   +P++T K+E IS
Sbjct  209   LAESRVRCIVDNAKCIVKIVREFGSFSSYMWNYVNYKPIINRFRYPRNVPLRTPKAETIS  268

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQAAG+T DHL  C RH  C  LA  +RP
Sbjct  269   KDLLKRGFRFVGPVIVYSFMQAAGMTIDHLVDCFRHKDCVNLA--ERP  314



>gb|AAG51925.1|AC013258_19 putative DNA-3-methyladenine glycosylase I; 14940-15720 [Arabidopsis 
thaliana]
Length=207

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV + A     W  +L++R DFR  F  FD  A++++TEK++ S+     + 
Sbjct  24    DDKKLFELLVFSQALAEFSWPSILRRRDDFRKLFEEFDPSAIAQFTEKRLMSLRVNGCLI  83

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+  +L+VK++FGSF NY W +VNHKP+   Y++  ++PVK+ K+E IS
Sbjct  84    LSEQKLRAIVENAKSVLKVKQEFGSFSNYCWRFVNHKPLRNGYRYGRQVPVKSPKAEYIS  143

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTV++SF+QA+G+ NDHLT C R+  C
Sbjct  144   KDMMQRGFRCVGPTVMYSFLQASGIVNDHLTACFRYQEC  182



>dbj|BAG91308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61274.1| hypothetical protein OsJ_15351 [Oryza sativa Japonica Group]
Length=383

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GA     W  +L KR  FR+ F  FD   VSK +EKKI +  +     
Sbjct  177   DDKVLFELLVLSGALAELTWPTILNKRPIFREVFMDFDPVLVSKLSEKKIIAPGSPSSTL  236

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +IL++ ++FG+FD Y W++VN+KPI +++++  ++PVKTSK++AIS
Sbjct  237   LSEQKLRGVIENARQILKIVEEFGTFDKYCWSFVNNKPILSRFRYPRQVPVKTSKADAIS  296

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTV+++FMQ +G+TNDHL +C R   CA  A
Sbjct  297   KDLVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECAAAA  339



>emb|CAC09513.2| H0711G06.19 [Oryza sativa Indica Group]
 emb|CAH67550.1| H0311C03.4 [Oryza sativa Indica Group]
Length=383

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D +LFELLVL+GA     W  +L KR  FR+ F  FD   VSK +EKKI +  +     
Sbjct  177   DDKVLFELLVLSGALAELTWPTILNKRPIFREVFMDFDPLLVSKLSEKKIIAPGSPSSTL  236

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +IL++ ++FG+FD Y W++VN+KPI +++++  ++PVKTSK++AIS
Sbjct  237   LSEQKLRGVIENARQILKIVEEFGTFDKYCWSFVNNKPILSRFRYPRQVPVKTSKADAIS  296

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTV+++FMQ +G+TNDHL +C R   CA  A
Sbjct  297   KDLVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECAAAA  339



>gb|KJB56529.1| hypothetical protein B456_009G123900 [Gossypium raimondii]
Length=371

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KR  FRD F  FD  AVSK +EKKI +        
Sbjct  184   DDKKLFELLSLSGALAELTWPTILSKRHLFRDTFLEFDPRAVSKLSEKKIGAPGGPASSL  243

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +I +V  +FGSFD Y+W++VNHKPI  Q+++  ++PVK+ KSE IS
Sbjct  244   LSELKIRGIIENARQICKVIDEFGSFDKYIWSFVNHKPIVGQFRYPRQVPVKSPKSEVIS  303

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+++RGFR VGPTV++SFMQ AGLTNDH  +C R   C
Sbjct  304   KDLIRRGFRSVGPTVVYSFMQVAGLTNDHFMSCFRFQEC  342



>ref|XP_004297192.1| PREDICTED: uncharacterized protein LOC101296948 [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT ++K+R+ FR+AFSGFD   V+K  E++I  +++   + 
Sbjct  150   DDNQLFELLALSGMLMDHNWTEIVKRRELFREAFSGFDPNIVAKMGEEEIEEIASNKALM  209

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L   +VR  V+N+  IL++ ++ GSF +Y+W  VNHKP+  ++++   +P+++ K+EA+S
Sbjct  210   LPDCKVRCIVENAKCILKIVRECGSFSSYMWGSVNHKPVINRFRYPRNVPLRSPKAEAMS  269

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFRYVGP +++SFMQAAGLT DHL  C R++ C  LA  +RP
Sbjct  270   KDLIKRGFRYVGPVIVYSFMQAAGLTIDHLVDCYRYNECVSLA--ERP  315



>ref|XP_010943158.1| PREDICTED: uncharacterized protein LOC105060960 isoform X1 [Elaeis 
guineensis]
Length=326

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 120/174 (69%), Gaps = 2/174 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+ A     W  +L KR   R  F  FD+ +++++TEKKI SV +  G  
Sbjct  139   DDQKLFELLVLSEALAEFSWPAILNKRDLLRKLFDNFDSSSIAQFTEKKILSVKSSGGTL  198

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ ++L+V ++ GSF+NY W++VNHKPI    ++  ++PVKT K+EA+S
Sbjct  199   LSEQKMRAVIENARQMLKVIEELGSFNNYCWSFVNHKPIINGSRYARQVPVKTPKAEAMS  258

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTTPSI  795
             KDM++RGFR VGPTVI+SFMQAAG+ NDHL++C R   C    + +  ++T S+
Sbjct  259   KDMMQRGFRCVGPTVIYSFMQAAGMVNDHLSSCFRFEECIGSHSKESRTSTESM  312



>ref|XP_010471611.1| PREDICTED: uncharacterized protein LOC104751380 isoform X2 [Camelina 
sativa]
 ref|XP_010471612.1| PREDICTED: uncharacterized protein LOC104751380 isoform X3 [Camelina 
sativa]
Length=328

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV + A     W  +L KR+DFR  F  FD  A+S++TEK++TS+     + 
Sbjct  147   DDKKLFELLVFSQALAEFSWPSILHKREDFRKLFEEFDPSAISQFTEKRLTSLRVNGCLI  206

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+  +L+VK+++GSF NY W +VNHKP+   Y++  ++PVK+ K+E IS
Sbjct  207   LSEQKLRAIVENAKSVLKVKQEYGSFSNYCWRFVNHKPLRNGYRYGRQVPVKSPKAEYIS  266

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTVI+SF+QA+G+ NDHLT C R+  C
Sbjct  267   KDMMQRGFRCVGPTVIYSFLQASGIVNDHLTACFRYQEC  305



>ref|NP_178200.1| methyladenine glycosylase-like protein [Arabidopsis thaliana]
 gb|AAF14672.1|AC011713_20 Contains similarity to gi|1168217 DNA-3-methyladenine glycosidase 
(TAG) protein from Haemophilus influenzae [Arabidopsis 
thaliana]
 gb|ACE98542.1| At1g80850 [Arabidopsis thaliana]
 gb|AEE36458.1| methyladenine glycosylase-like protein [Arabidopsis thaliana]
Length=327

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITS--VSAEYG  1137
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+ T KKITS  ++A   
Sbjct  161   DDKRLFELLSLSGALAELSWKDILSKRQLFREVFMDFDPIAISELTNKKITSPEIAATTL  220

Query  1136  IELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             +   ++R  ++N+ ++ ++   FGSFD Y+W +VN KP  +Q+++  ++PVKTSK+E IS
Sbjct  221   LSEQKLRSILENANQVCKIIGAFGSFDKYIWNFVNQKPTQSQFRYPRQVPVKTSKAELIS  280

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR V PTVI+SFMQ AGLTNDHLT C RHH C
Sbjct  281   KDLVRRGFRSVSPTVIYSFMQTAGLTNDHLTCCFRHHDC  319



>ref|XP_010471610.1| PREDICTED: uncharacterized protein LOC104751380 isoform X1 [Camelina 
sativa]
Length=330

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV + A     W  +L KR+DFR  F  FD  A+S++TEK++TS+     + 
Sbjct  147   DDKKLFELLVFSQALAEFSWPSILHKREDFRKLFEEFDPSAISQFTEKRLTSLRVNGCLI  206

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+  +L+VK+++GSF NY W +VNHKP+   Y++  ++PVK+ K+E IS
Sbjct  207   LSEQKLRAIVENAKSVLKVKQEYGSFSNYCWRFVNHKPLRNGYRYGRQVPVKSPKAEYIS  266

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTVI+SF+QA+G+ NDHLT C R+  C
Sbjct  267   KDMMQRGFRCVGPTVIYSFLQASGIVNDHLTACFRYQEC  305



>gb|AFK34294.1| unknown [Lotus japonicus]
Length=308

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 117/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL L+G  +  +WT +L++++  R+ F+ FD   V+K  EK+I  +++   + 
Sbjct  139   DDNKLFELLALSGLLMDYNWTEILRRKETLREVFAEFDPYTVAKMEEKEIMEIASNKALS  198

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+V    DN+  I+++ ++ GSF +Y+W +VNHKPI  +YK+   +P+++ K+EA+S
Sbjct  199   LAESRVMCIADNAKCIMKIIRECGSFSSYIWGFVNHKPIINRYKYPRNVPLRSPKAEALS  258

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KDMVKRGFR+VGP ++HSF+QAAGLT DHL  C RH  C  LA  +RP
Sbjct  259   KDMVKRGFRFVGPVIVHSFIQAAGLTIDHLVDCYRHDECVSLA--ERP  304



>ref|XP_002324538.1| methyladenine glycosylase family protein [Populus trichocarpa]
 gb|EEF03103.1| methyladenine glycosylase family protein [Populus trichocarpa]
Length=380

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AVSK+ EKKI +  +     
Sbjct  183   DDRKLFELLVLSGALAELTWPAILSKRHIFREVFADFDPIAVSKFNEKKILAPGSTATSL  242

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  V+N+ +I +V  +FGSFD Y+W++VN+KPI +++++  ++PVKT K++AIS
Sbjct  243   LSELKLRAIVENARQISKVIDEFGSFDKYIWSFVNYKPIVSRFRYPRQVPVKTPKADAIS  302

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTVI+SFMQ AG+TNDHL +C R   C + A
Sbjct  303   KDLVRRGFRSVGPTVIYSFMQVAGITNDHLISCFRFQECLDAA  345



>ref|XP_004976128.1| PREDICTED: uncharacterized protein LOC101782624 [Setaria italica]
Length=389

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F  FD   VSK +EKKI +  +     
Sbjct  179   DDKKLFELLVLSGALAELTWPAILNKRAIFREVFMDFDPVLVSKLSEKKIIAPGSPSSSL  238

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +IL++ ++FGSFD Y W++VNHKPI +++++  ++PVKTSK++AIS
Sbjct  239   LSEQKLRGVIENARQILKIVEEFGSFDKYCWSFVNHKPILSRFRYPRQVPVKTSKADAIS  298

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPS  810
             KD+V+RGFR VGPTV+++FMQ +G+TNDHL +C R   CA  A+P  P+
Sbjct  299   KDLVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECA--ASPASPA  345



>ref|XP_009595131.1| PREDICTED: uncharacterized protein LOC104091486 [Nicotiana tomentosiformis]
Length=319

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSV--SAEYG  1137
             +D+ LFELL L G  +  +WT +LK+R+  R+AF+GF+A  V+K  E++I  +  + E  
Sbjct  150   DDHQLFELLALCGMLMDFNWTEILKRREQIREAFAGFNANHVAKMGEREIEELFSNTELN  209

Query  1136  IELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             +  S+VR  VDN+  I+++ ++FGSF +Y+W YVN+KPI  ++++   +P++T K+E IS
Sbjct  210   LAESRVRCIVDNAKCIVKIVREFGSFSSYMWNYVNYKPIINRFRYPRNVPLRTPKAETIS  269

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQA+G+T DHL  C RH  C  LA  +RP
Sbjct  270   KDLLKRGFRFVGPVIVYSFMQASGMTIDHLVDCFRHKDCVNLA--ERP  315



>gb|KJB65790.1| hypothetical protein B456_010G113100 [Gossypium raimondii]
Length=280

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL GA     W  +L KR  FR+ F+ FD  AVSK  EKK+ +  +     
Sbjct  82    DDKKLFELLVLAGALSELTWPAILSKRHIFREVFADFDPLAVSKLNEKKLIAPGSTASSL  141

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  V+N+ +I +V  +FGSFD Y+W++VNHKPI +++++  ++PVKT K++ IS
Sbjct  142   LSELKLRAIVENAHQISKVIDEFGSFDKYIWSFVNHKPIVSRFRYPRQVPVKTPKADVIS  201

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTVI+SFMQ +G+TNDHLT+C R   C   A
Sbjct  202   KDLVRRGFRSVGPTVIYSFMQVSGITNDHLTSCFRFQDCITAA  244



>gb|EEE66127.1| hypothetical protein OsJ_22173 [Oryza sativa Japonica Group]
Length=410

 Score =   172 bits (436),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +LK+RQ FR+ F  FD  A+SK  EKK+ +  +     
Sbjct  197   DDRRLFELLVLSGALAELTWPEILKRRQLFREIFVDFDPVAISKINEKKLVAPGSVANSL  256

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+ +IL++  +FGSFD Y W ++NHKPI +++++  ++PVK+ K++ IS
Sbjct  257   LSEQKLRAVVENARQILKIVDEFGSFDRYCWGFLNHKPIVSKFRYPRQVPVKSPKADMIS  316

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAE  834
             KDMV+RGFR VGPT+I+SFMQAAGLTNDHL +C R   C E
Sbjct  317   KDMVRRGFRGVGPTIIYSFMQAAGLTNDHLVSCFRFKECNE  357



>emb|CDX79346.1| BnaC06g19570D [Brassica napus]
Length=258

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 110/157 (70%), Gaps = 2/157 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+ T KKITS   +  + 
Sbjct  96    DDKKLFELLSLSGALAELSWKDILSKRQSFREVFMDFDPVAISELTNKKITS--PDSLLS  153

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
               ++R  ++N+ ++ ++  +FGSFD Y+W +VNHKP  ++ ++  ++P KTSK+E ISKD
Sbjct  154   EQKLRSILENANQVRKIIVEFGSFDKYIWNFVNHKPTQSRSRYQRQVPAKTSKAELISKD  213

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +V+RGFR V PTVI+SFMQ AGLTNDHLT+C RHH C
Sbjct  214   LVRRGFRSVSPTVIYSFMQTAGLTNDHLTSCFRHHEC  250



>ref|XP_006453620.1| hypothetical protein CICLE_v10008612mg [Citrus clementina]
 ref|XP_006453622.1| hypothetical protein CICLE_v10008612mg [Citrus clementina]
 gb|ESR66860.1| hypothetical protein CICLE_v10008612mg [Citrus clementina]
 gb|ESR66862.1| hypothetical protein CICLE_v10008612mg [Citrus clementina]
 gb|KDO59452.1| hypothetical protein CISIN_1g016657mg [Citrus sinensis]
Length=385

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F GFD  AVSK  EKK+ +  +     
Sbjct  187   DDKKLFELLVLSGALSELTWPAILSKRHIFREVFVGFDPIAVSKLNEKKLLAAGSAASSL  246

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +I +V  +FGSF+NY+W++V+HKPI +++++  ++PVKT K++ IS
Sbjct  247   LSELKLRAIIENARQISKVIDEFGSFNNYIWSFVSHKPIVSRFRYPRQVPVKTPKADVIS  306

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPT+I+SFMQ AG+TNDHLT+C R   C   A
Sbjct  307   KDLVRRGFRSVGPTIIYSFMQVAGVTNDHLTSCFRFQECINAA  349



>ref|XP_007153458.1| hypothetical protein PHAVU_003G037100g [Phaseolus vulgaris]
 gb|ESW25452.1| hypothetical protein PHAVU_003G037100g [Phaseolus vulgaris]
Length=300

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 117/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+G  +  +WT +LK+++  R  F+GFD   V+K  EK+I  +++   I 
Sbjct  131   DDKTLFELLTLSGLLIDYNWTEILKRKKILRQVFAGFDPTTVAKMEEKEIMEITSNKEIM  190

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L   +VR  VDN+  I+++ ++ GSF  Y+W YVNHKP+  ++K+   +P++TSK++ IS
Sbjct  191   LPDCRVRCIVDNARCIMKIVRECGSFSCYIWGYVNHKPVINKFKFPRDVPLRTSKADTIS  250

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGF+++GP +++SFMQAAGLT DHL  C RH+ C  LA  QRP
Sbjct  251   KDLIKRGFQFLGPVIVYSFMQAAGLTIDHLVDCHRHNECVRLA--QRP  296



>ref|XP_011033406.1| PREDICTED: uncharacterized protein LOC105131909 [Populus euphratica]
 ref|XP_011033407.1| PREDICTED: uncharacterized protein LOC105131909 [Populus euphratica]
Length=381

 Score =   171 bits (434),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AVSK+ EKKI +  +     
Sbjct  184   DDRKLFELLVLSGALAELTWPAILSKRHMFREVFADFDPIAVSKFNEKKIIAPGSTASSL  243

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +I +V  +FGSFD Y+W++VN+KPI +++++  ++PVKT K++AIS
Sbjct  244   LSELKLRAIIENARQISKVIDEFGSFDKYIWSFVNYKPIVSRFRYPRQVPVKTPKADAIS  303

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTVI+SFMQ AG+TNDHL +C R   C + A
Sbjct  304   KDLVRRGFRSVGPTVIYSFMQVAGVTNDHLISCFRFQECIDAA  346



>gb|KJB78242.1| hypothetical protein B456_012G185200 [Gossypium raimondii]
Length=330

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+G  +  +WT +LKK++ +R+AF+GFD E V+K  +K+I  +S+   I 
Sbjct  161   DDIQLFELLALSGMLMDYNWTEILKKKELYREAFAGFDTEIVAKMGDKEINEISSNKAIM  220

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  + N+  I ++ ++ GSF +++W YVNH+P   +YK+   +P++T K+EAIS
Sbjct  221   LVESRVRCIIHNAKCIQKIVREHGSFSSFMWGYVNHQPQINKYKYPRNVPLRTPKAEAIS  280

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQAAGLT DHL  C RH  C  LA  +RP
Sbjct  281   KDLLKRGFRFVGPVIVYSFMQAAGLTIDHLIGCFRHKECVALA--ERP  326



>ref|XP_010092198.1| Putative Glutamine amidotransferase [Morus notabilis]
 gb|EXB50424.1| Putative Glutamine amidotransferase [Morus notabilis]
Length=412

 Score =   172 bits (435),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KR  FR+ F  FD  A+SK  EKK+T+  +     
Sbjct  216   DDKKLFELLSLSGALAELSWPAILNKRDIFREVFLDFDPVAISKLNEKKVTAPGSPATSL  275

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ ++ +V ++FGSFD Y+W++VNHKPI +Q+++  ++PVKT K+E IS
Sbjct  276   LSELKLRAMIENARQMCKVIEEFGSFDEYIWSFVNHKPIVSQFRYPRQVPVKTPKAEVIS  335

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTVI+SFMQ AGLTNDHL +C R   C   A
Sbjct  336   KDLVRRGFRSVGPTVIYSFMQVAGLTNDHLISCFRFQECLATA  378



>ref|XP_002887808.1| hypothetical protein ARALYDRAFT_477160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64067.1| hypothetical protein ARALYDRAFT_477160 [Arabidopsis lyrata subsp. 
lyrata]
Length=323

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+ T KKITS        
Sbjct  157   DDKRLFELLSLSGALAELSWKDILSKRQLFREVFMDFDPIAISELTNKKITSSEIATTTL  216

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ ++ ++  +FGSFD Y+W +VN KP  +Q+++  ++PVKTSK+E IS
Sbjct  217   LSEQKLRSILENANQVCKLIVEFGSFDKYIWNFVNQKPTQSQFRYPRQVPVKTSKAELIS  276

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR V PTVI+SFMQ AGLTNDHLT C RHH C
Sbjct  277   KDLVRRGFRSVSPTVIYSFMQTAGLTNDHLTCCFRHHDC  315



>ref|NP_200605.1| putative DNA-3-methyladenine glycosylase I [Arabidopsis thaliana]
 ref|NP_001032091.1| putative DNA-3-methyladenine glycosylase I [Arabidopsis thaliana]
 dbj|BAB08867.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO23640.1| At5g57970 [Arabidopsis thaliana]
 dbj|BAE99353.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96979.1| putative DNA-3-methyladenine glycosylase I [Arabidopsis thaliana]
 gb|AED96980.1| putative DNA-3-methyladenine glycosylase I [Arabidopsis thaliana]
Length=347

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KRQ FR+ F+ FD  A+ K  EKKI    +     
Sbjct  181   DDKRLFELLVLSGALAEHTWPTILSKRQAFREVFADFDPNAIVKINEKKIIGPGSPASTL  240

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS  ++R  ++N+ +IL+V +++GSFD Y+W++V +K I +++++  ++P KT K+E IS
Sbjct  241   LSDLKLRAVIENARQILKVIEEYGSFDKYIWSFVKNKAIVSKFRYQRQVPAKTPKAEVIS  300

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTV++SFMQAAG+TNDHLT+C R H C
Sbjct  301   KDLVRRGFRSVGPTVVYSFMQAAGITNDHLTSCFRFHHC  339



>gb|EAZ01894.1| hypothetical protein OsI_23919 [Oryza sativa Indica Group]
Length=426

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +LK+RQ FR+ F  FD  A+SK  EKK+ +  +     
Sbjct  213   DDRRLFELLVLSGALAELTWPEILKRRQLFREIFVDFDPVAISKINEKKLVAPGSVANSL  272

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+ +IL++  +FGSFD Y W ++NHKPI +++++  ++PVK+ K++ IS
Sbjct  273   LSEQKLRAVVENARQILKIVDEFGSFDRYCWGFLNHKPIVSKFRYPRQVPVKSPKADMIS  332

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAE  834
             KDMV+RGFR VGPT+I+SFMQAAGLTNDHL +C R   C E
Sbjct  333   KDMVRRGFRGVGPTIIYSFMQAAGLTNDHLVSCFRFKECNE  373



>dbj|BAD38103.1| methyladenine glycosylase protein-like [Oryza sativa Japonica 
Group]
Length=433

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +LK+RQ FR+ F  FD  A+SK  EKK+ +  +     
Sbjct  220   DDRRLFELLVLSGALAELTWPEILKRRQLFREIFVDFDPVAISKINEKKLVAPGSVANSL  279

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+ +IL++  +FGSFD Y W ++NHKPI +++++  ++PVK+ K++ IS
Sbjct  280   LSEQKLRAVVENARQILKIVDEFGSFDRYCWGFLNHKPIVSKFRYPRQVPVKSPKADMIS  339

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAE  834
             KDMV+RGFR VGPT+I+SFMQAAGLTNDHL +C R   C E
Sbjct  340   KDMVRRGFRGVGPTIIYSFMQAAGLTNDHLVSCFRFKECNE  380



>ref|XP_010483357.1| PREDICTED: uncharacterized protein LOC104761888 isoform X2 [Camelina 
sativa]
Length=334

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KRQ  R+ F+ FD  A+ K  EKK+    +     
Sbjct  170   DDKRLFELLVLSGALAEHTWPTILSKRQALREVFADFDPSAIVKINEKKLIGPGSTASTL  229

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS  ++R  ++N+ +IL+V +++GSFD Y+W++V +K I +++++  ++P KT K+E IS
Sbjct  230   LSDLKLRAVIENARQILKVIEEYGSFDKYIWSFVKNKAIVSKFRYQRQVPAKTPKAEVIS  289

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTV+HSFMQAAG+TNDHLT+C R H C
Sbjct  290   KDLVRRGFRSVGPTVVHSFMQAAGITNDHLTSCFRFHHC  328



>ref|XP_009384964.1| PREDICTED: uncharacterized protein LOC103972369 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384972.1| PREDICTED: uncharacterized protein LOC103972369 [Musa acuminata 
subsp. malaccensis]
Length=393

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W ++L KR  FR+ F  FD  AVSK  EKKI    +     
Sbjct  185   DDKKLFELLVLSGALAELTWPVILSKRHMFREVFLDFDPVAVSKLNEKKIVVPGSTASSL  244

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ +IL++  +FGSF+ Y W++VNHKPI +++++  ++PVKT K++ IS
Sbjct  245   LSEPKLRAIIENARQILKIVDEFGSFERYCWSFVNHKPIVSKFRYPRQVPVKTPKADVIS  304

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPT+I+SFMQAAGLTNDHL +C R   C
Sbjct  305   KDLVRRGFRSVGPTIIYSFMQAAGLTNDHLISCFRFEGC  343



>ref|XP_006473998.1| PREDICTED: uncharacterized protein LOC102607933 [Citrus sinensis]
Length=385

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  ++ KR  FR+ F GFD  AVSK  EKK+ +  +     
Sbjct  187   DDKKLFELLVLSGALSELTWPAIMSKRHIFREVFVGFDPIAVSKLNEKKLLAAGSAASSL  246

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +I +V  +FGSF+NY+W++V+HKPI +++++  ++PVKT K++ IS
Sbjct  247   LSELKLRAIIENARQISKVIDEFGSFNNYIWSFVSHKPIVSRFRYPRQVPVKTPKADVIS  306

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPT+I+SFMQ AG+TNDHLT+C R   C   A
Sbjct  307   KDLVRRGFRSVGPTIIYSFMQVAGVTNDHLTSCFRFQECINAA  349



>ref|XP_011018029.1| PREDICTED: uncharacterized protein LOC105121177 [Populus euphratica]
Length=380

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AVSK+ EKKI +  +     
Sbjct  183   DDRKLFELLVLSGALAELTWPAILSKRHIFREVFADFDPVAVSKFNEKKIIAPGSTATSL  242

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +I +V  +FGSFD Y+W++VN KPI +++++  ++PVKT K++AIS
Sbjct  243   LSELKLRAIIENARQISKVIDEFGSFDKYIWSFVNFKPIVSRFRYPRQVPVKTPKADAIS  302

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTVI+SFMQ AG+TNDHL +C R   C + A
Sbjct  303   KDLVRRGFRSVGPTVIYSFMQVAGITNDHLISCFRFQECLDAA  345



>ref|XP_010443507.1| PREDICTED: uncharacterized protein LOC104726362 [Camelina sativa]
Length=334

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KRQ FR+ F+ FD  A+ K  EKK+    +     
Sbjct  170   DDKRLFELLVLSGALAEHTWPTILSKRQAFREVFADFDPSAIVKINEKKLIGPGSTASTL  229

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS  ++R  ++N+ +IL+V +++GSFD Y+W++V +K I +++++  ++P KT K+E IS
Sbjct  230   LSDLKLRAVIENARQILKVIEEYGSFDKYIWSFVKNKAIVSKFRYQRQVPAKTPKAEVIS  289

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTV++SFMQAAG+TNDHLT+C R H C
Sbjct  290   KDLVRRGFRSVGPTVVYSFMQAAGITNDHLTSCFRFHHC  328



>ref|WP_012376907.1| DNA-3-methyladenine glycosylase [Opitutus terrae]
 gb|ACB77379.1| DNA-3-methyladenine glycosylase I [Opitutus terrae PB90-1]
Length=192

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 112/163 (69%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFE L+L GAQ G  W+ +L KR+++R AF GFDA  +++Y ++KI ++ A+ GI 
Sbjct  29    DDRRLFEFLILEGAQAGLSWSTILAKRENYRRAFDGFDARKIARYDQRKIDALLADAGIV  88

Query  1130  LSQVRGA--VDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
              ++++ A  + N+   L V+++FGSFD Y+WA+V  KPI   ++    +P  T +S+A+S
Sbjct  89    RNRLKIAATIQNAKAFLAVQREFGSFDRYVWAFVLGKPIVNHHRTVQTVPAHTHESDALS  148

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             +D++ RGF++VG T+ ++FMQA GL NDHL TCPRH  C   A
Sbjct  149   RDLLARGFKFVGTTICYAFMQACGLVNDHLVTCPRHAACQATA  191



>ref|XP_008663363.1| PREDICTED: uncharacterized protein LOC103641812 [Zea mays]
 gb|AFW58766.1| hypothetical protein ZEAMMB73_734031 [Zea mays]
Length=385

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F  FD  +VSK +EKKI +  +     
Sbjct  179   DDRKLFELLVLSGALAELTWPAILNKRDIFREVFMDFDPVSVSKLSEKKIIAPGSPSSSL  238

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +IL++ ++FGSFD Y W++VNHKPI +++++  ++PVKTSK++AIS
Sbjct  239   LSEQKLRGVIENARQILKIIEEFGSFDKYCWSFVNHKPILSRFRYSRQVPVKTSKADAIS  298

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAA  825
             KD+V+RGFR VGPTV+++FMQ +G+TNDHL +C R   C   +A
Sbjct  299   KDLVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECVASSA  342



>ref|XP_010429893.1| PREDICTED: uncharacterized protein LOC104714283 [Camelina sativa]
Length=343

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+ T KKITS        
Sbjct  177   DDKKLFELLSLSGALAELSWKDILSKRQLFREVFMDFDPIAISELTNKKITSPDIATTTL  236

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ ++ ++  +FGSFD Y+W +VN KP  +Q+++  ++PVKTSK+E IS
Sbjct  237   LSEQKLRSILENANQVRKIIVEFGSFDKYIWNFVNQKPTQSQFRYPRQVPVKTSKAELIS  296

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR V PTVI+SFMQ AGLTNDHLT C RHH C
Sbjct  297   KDLVRRGFRSVSPTVIYSFMQTAGLTNDHLTCCFRHHDC  335



>ref|XP_010453026.1| PREDICTED: uncharacterized protein LOC104735009 [Camelina sativa]
Length=334

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KRQ FR+ F+ FD  A+ K  EKK+    +     
Sbjct  170   DDKRLFELLVLSGALAEHTWPTILSKRQAFREVFADFDPSAIVKINEKKLIGPGSTASTL  229

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS  ++R  ++N+ +IL+V +++GSFD Y+W++V +K I +++++  ++P KT K+E IS
Sbjct  230   LSDPKLRAVIENARQILKVIEEYGSFDKYIWSFVKNKAIVSKFRYQRQVPAKTPKAEVIS  289

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTV++SFMQAAG+TNDHLT+C R H C
Sbjct  290   KDLVRRGFRSVGPTVVYSFMQAAGITNDHLTSCFRFHHC  328



>ref|XP_009420383.1| PREDICTED: uncharacterized protein LOC104000141 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420384.1| PREDICTED: uncharacterized protein LOC104000141 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W ++L KR  FR+ F  FD  AVSK  EKKI    +     
Sbjct  184   DDRKLFELLVLSGALAELTWPVILSKRHIFREVFLDFDPVAVSKLNEKKILVPGSTSSSL  243

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ +IL++  +FGSFD Y W++VN+KPI +++++  ++PVKT K++ IS
Sbjct  244   LSEPKLRAIIENARQILKITDEFGSFDKYCWSFVNYKPIVSKFRYPRQVPVKTPKADVIS  303

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+VKRGFR VGPTVI+SFMQ++GLTNDHL +C R   C
Sbjct  304   KDLVKRGFRSVGPTVIYSFMQSSGLTNDHLISCFRFQEC  342



>gb|KJB54988.1| hypothetical protein B456_009G057100 [Gossypium raimondii]
Length=330

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 117/172 (68%), Gaps = 4/172 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKIT---SVSAEY  1140
             +D  LFELLVL+G+     W+ +L KR  FR+ F  FD  AVSK  EKK+    SV++  
Sbjct  131   DDKKLFELLVLSGSLSELTWSAILSKRHIFREVFMDFDPVAVSKLNEKKLIAHGSVASSL  190

Query  1139  GIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAI  960
               EL  +R  V+N+ +I +V  +F SFD Y+W++VNHKPI +++++  ++PVKT K++ I
Sbjct  191   LSEL-MLRAIVENARQISKVIDEFRSFDQYIWSFVNHKPIVSRFRYPRQVPVKTPKADVI  249

Query  959   SKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTT  804
             SKD+V+RGFR VGPTVI+SFMQ AG+TNDHLT+C R   C   A  +  + T
Sbjct  250   SKDLVRRGFRSVGPTVIYSFMQVAGITNDHLTSCFRFQECITAAEAKEENVT  301



>ref|XP_002309346.1| methyladenine glycosylase family protein [Populus trichocarpa]
 gb|EEE92869.1| methyladenine glycosylase family protein [Populus trichocarpa]
Length=381

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AVSK+ EKKI +  +     
Sbjct  184   DDRKLFELLVLSGALAELTWPAILSKRHMFREVFADFDPIAVSKFNEKKIIAPGSTAASL  243

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +I +V  +FGSFD Y+W++VN+KPI +++++  ++P KT K++AIS
Sbjct  244   LSELKLRAIIENARQISKVIDEFGSFDKYIWSFVNYKPIVSRFRYPRQVPAKTPKADAIS  303

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTVI+SFMQ AG+TNDHL +C R   C + A
Sbjct  304   KDLVRRGFRSVGPTVIYSFMQVAGVTNDHLISCFRFQECIDAA  346



>ref|XP_002446748.1| hypothetical protein SORBIDRAFT_06g021680 [Sorghum bicolor]
 gb|EES11076.1| hypothetical protein SORBIDRAFT_06g021680 [Sorghum bicolor]
Length=389

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F  FD   VSK +EKKI +  +     
Sbjct  179   DDKKLFELLVLSGALAELTWPAILNKRDIFREVFMDFDPVLVSKLSEKKIIAPGSPSSSL  238

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +RG ++N+ +IL++ ++FGSFD Y W++VNHKPI +++++  ++PVKTSK++AIS
Sbjct  239   LSEQKLRGVIENARQILKIIEEFGSFDKYCWSFVNHKPILSRFRYSRQVPVKTSKADAIS  298

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCA  837
             KD+V+RGFR VGPTV+++FMQ +G+TNDHL +C R   CA
Sbjct  299   KDLVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECA  338



>ref|XP_010536978.1| PREDICTED: uncharacterized protein LOC104811835 isoform X2 [Tarenaya 
hassleriana]
Length=349

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KRQ FR+ F+ FD  AVSK  EKK+ S  +     
Sbjct  185   DDKRLFELLVLSGALAEHTWPTILSKRQTFREVFADFDPIAVSKINEKKLISPGSTASSL  244

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ +IL+V  ++GSFD Y+W++V +KPI +++++  ++PVKT K+EAIS
Sbjct  245   LSELKLRAVIENARQILKVIDEYGSFDKYIWSFVKNKPIVSKFRYQRQVPVKTPKAEAIS  304

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTC  858
             +D+V+RGFR   PTV++SFMQA+GLTNDHLT+C
Sbjct  305   RDLVRRGFRSTSPTVVYSFMQASGLTNDHLTSC  337



>ref|XP_012067499.1| PREDICTED: uncharacterized protein LOC105630313 [Jatropha curcas]
 gb|KDP41971.1| hypothetical protein JCGZ_26989 [Jatropha curcas]
Length=367

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W ++L KR  FR+ F  FD  AVSK  +KKI +  +     
Sbjct  172   DDKKLFELLCLSGALAELTWPVILNKRHLFREVFLDFDPTAVSKLNDKKIATSGSPATSL  231

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ ++ +V  +FGSFD Y+W +VNHKPI  Q+++  ++PVKTSK+E IS
Sbjct  232   LSESKLRSIIENARQMCKVIDEFGSFDKYIWNFVNHKPIVNQFRYSRQVPVKTSKAEVIS  291

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTVI++FMQ AGLTNDHL +C R   C
Sbjct  292   KDLVRRGFRSVGPTVIYAFMQVAGLTNDHLISCFRFQEC  330



>gb|ACG46017.1| DNA-3-methyladenine glycosylase I [Zea mays]
Length=418

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  1307  DNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIEL  1128
             D  LFELLVL+GA     W  +LKKRQ FR+ F  FD  AVSK  EKK+ +  +     L
Sbjct  211   DRRLFELLVLSGALAELTWPEILKKRQLFREIFMEFDPAAVSKINEKKLVAPGSVAHSLL  270

Query  1127  SQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISK  954
             S+  +R  ++N+ +IL++  +FGSFD Y W ++NHKPI +++++  ++PVK+ K++ ISK
Sbjct  271   SEQKLRAVLENARQILKIADEFGSFDRYCWGFLNHKPIVSKFRYPRQVPVKSPKADIISK  330

Query  953   DMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAEL  831
             DM++RGFR VGPTVI+SFMQAAGLTNDHL +C R   C+ +
Sbjct  331   DMMRRGFRGVGPTVIYSFMQAAGLTNDHLVSCFRFEHCSAV  371



>ref|XP_008777405.1| PREDICTED: uncharacterized protein LOC103697341 [Phoenix dactylifera]
Length=367

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFE LVL+GA     W  +L KR  FR+ F  FD  +VSK  EKKI +  +     
Sbjct  181   DDRKLFEQLVLSGALAELTWPAILNKRHIFREVFMDFDPVSVSKLNEKKIVATGSTASSL  240

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+ +IL++  +FGSFD Y W+++NHKPI +++++  ++PVKT K++ IS
Sbjct  241   LSEPKLRAIVENARQILKIIDEFGSFDRYCWSFLNHKPIISRFRYPRQVPVKTPKADVIS  300

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTVI+SFMQAAGLTNDHL +C R   C
Sbjct  301   KDLVRRGFRSVGPTVIYSFMQAAGLTNDHLISCFRFEEC  339



>gb|KHG15995.1| putative GMP synthase [glutamine-hydrolyzing] [Gossypium arboreum]
Length=374

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL GA     W  +L KR  FR+ F+ FD  AVSK  EKK+ +  +     
Sbjct  176   DDKKLFELLVLAGALSELTWPAILSKRHIFREVFADFDPLAVSKLNEKKLIAPGSTASSL  235

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  V+N+ +I +V  +FGSFD Y+W +VNHKPI +++++  ++PVKT K++ IS
Sbjct  236   LSELKLRAIVENAHQISKVINEFGSFDKYIWGFVNHKPIVSRFRYPRQVPVKTPKADVIS  295

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR VGPTVI+SFMQ AG+TNDHLT+C R   C
Sbjct  296   KDLVRRGFRSVGPTVIYSFMQVAGITNDHLTSCFRFQDC  334



>emb|CDX73141.1| BnaC06g35890D [Brassica napus]
Length=174

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = -1

Query  1298  LFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIELSQ-  1122
             L ELLV + A     W  +L KR  FR  F  FD  A+S++TEK++ S+     + LS+ 
Sbjct  6     LRELLVFSQALAEFSWPSILHKRDAFRKLFEDFDPLAISEFTEKRLMSLKVNGCLVLSEQ  65

Query  1121  -VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKDMV  945
              +R  VDN+  +L+VK++FGSF NY W +VNHKP+   Y++  ++PVK+ K+E ISKDM+
Sbjct  66    KLRAIVDNAKSVLKVKQEFGSFSNYCWRFVNHKPLRNGYRYGRQVPVKSPKAEYISKDMM  125

Query  944   KRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             +RGFR VGPTVI+SF+Q +G+ NDHLTTC R+  C
Sbjct  126   QRGFRCVGPTVIYSFLQVSGIVNDHLTTCFRYQEC  160



>ref|XP_010103669.1| Putative Glutamine amidotransferase [Morus notabilis]
 gb|EXB96612.1| Putative Glutamine amidotransferase [Morus notabilis]
Length=383

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AVSK  EKKI +  +     
Sbjct  183   DDRKLFELLVLSGALAELTWPAILSKRHIFREVFADFDPAAVSKLNEKKIMAPGSTASSL  242

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N  +I +V  +FGSFDNY+W++VN+KPI +++++  ++PVKT K++ IS
Sbjct  243   LSELKLRAIIENGRQISKVIDEFGSFDNYIWSFVNNKPIVSKFRYPRQVPVKTPKADVIS  302

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTV++SFMQ AG+TNDHL +C R   C   A
Sbjct  303   KDLVRRGFRSVGPTVVYSFMQVAGITNDHLISCFRFQECLNAA  345



>gb|KFK41948.1| hypothetical protein AALP_AA2G192700 [Arabis alpina]
Length=312

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             ED  LFELLV + A     W  +L KR+ FR  F  FD  A++++TEK++ S+     + 
Sbjct  129   EDKKLFELLVFSQALAEFSWPSILHKREAFRKLFEDFDPSAIAQFTEKRLMSLRVNGCLI  188

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+  +L+VK++FGSF NY W +VNHKP+   Y++  ++PVK+ K+E IS
Sbjct  189   LSEQKLRAIVENAKSVLKVKQEFGSFSNYCWRFVNHKPLQNGYRYGRQVPVKSPKAEYIS  248

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTV++SF+Q +G+ NDHLTTC R+  C
Sbjct  249   KDMMQRGFRCVGPTVVYSFLQVSGIVNDHLTTCFRYQEC  287



>ref|XP_011070893.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105156460 
[Sesamum indicum]
Length=309

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +DN LFELL + G  +  +WT +LK+R+  R+AF+GFD   VSK  EK+I  +++   + 
Sbjct  140   DDNQLFELLAMCGMLMDFNWTEILKRRELLREAFAGFDPNNVSKMGEKEILDIASNKELT  199

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  I++V ++ GSF +Y+W YV++KP+  ++++   +P+++ K+E IS
Sbjct  200   LAESRVRCIVDNAKCIIKVARECGSFSSYMWEYVSYKPVINKFRYPRNVPLRSPKAEIIS  259

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD+V+RGFR+VGP +++SFMQAAG+T DHL  C R++ C  LA  +RP
Sbjct  260   KDLVRRGFRFVGPVIVYSFMQAAGMTIDHLVDCFRYNECVNLA--ERP  305



>ref|XP_010417657.1| PREDICTED: uncharacterized protein LOC104703348 [Camelina sativa]
 ref|XP_010417658.1| PREDICTED: uncharacterized protein LOC104703348 [Camelina sativa]
Length=339

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITS--VSAEYG  1137
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+ T K ITS  +S    
Sbjct  173   DDKKLFELLSLSGALAELSWKDILSKRQLFREVFMDFDPVAISELTNKNITSPDISTTTL  232

Query  1136  IELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             +   ++R  ++N+ ++ ++  +FGSFD Y+W +VN KP  +Q+++  ++PVKTSK+E IS
Sbjct  233   LSEQKLRSILENANQVRKIIVEFGSFDKYIWNFVNQKPTQSQFRYPRQVPVKTSKAELIS  292

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR V PTVI+SFMQ AGLTNDHLT C RHH C
Sbjct  293   KDLVRRGFRSVSPTVIYSFMQTAGLTNDHLTCCFRHHDC  331



>ref|XP_007225526.1| hypothetical protein PRUPE_ppa026563mg, partial [Prunus persica]
 gb|EMJ26725.1| hypothetical protein PRUPE_ppa026563mg, partial [Prunus persica]
Length=315

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 113/160 (71%), Gaps = 4/160 (3%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+ A     W  +L KR  FR  F  FD  +++K+ EKK+ S+    GI 
Sbjct  139   DDKKLFELLVLSQALAELSWPEILHKRDMFRKLFDDFDPSSIAKFEEKKLLSLKIN-GIP  197

Query  1130  L---SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAI  960
             L    ++R  V+N++++L+V+++FGSF NY W++VNHKPI  ++++  ++PVK+ K+E I
Sbjct  198   LLSEQKLRAVVENAMQMLKVQQEFGSFSNYCWSFVNHKPIRNRFRYGRQVPVKSPKAEVI  257

Query  959   SKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             SKD++KRGFR VGPTVI+SFMQ AG+ NDHL TC R+  C
Sbjct  258   SKDLMKRGFRCVGPTVIYSFMQVAGIVNDHLITCFRYKEC  297



>gb|KHG02440.1| putative GMP synthase [glutamine-hydrolyzing] [Gossypium arboreum]
Length=379

 Score =   169 bits (428),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKIT---SVSAEY  1140
             +D  LFELLVL+G+     W+ +L KR  FR+ F  FD  AVSK  EKK+    SV++  
Sbjct  180   DDRKLFELLVLSGSLSELTWSAILSKRHIFREVFIDFDPVAVSKLNEKKLIAHGSVASSL  239

Query  1139  GIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAI  960
               EL ++R  V+N+ +I +V  +FGSFD Y+W++VNHKPI +++++  ++PVKT K++ I
Sbjct  240   LSEL-KLRVIVENARQISKVIDEFGSFDQYIWSFVNHKPIVSRFRYPRQVPVKTPKADVI  298

Query  959   SKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRPSTT  804
             SKD+V+RGFR VGPTVI+SFMQ AG+TNDHLT+C R   C   A  +  + T
Sbjct  299   SKDLVRRGFRSVGPTVIYSFMQVAGITNDHLTSCFRFQECITAAEAKEENVT  350



>ref|XP_008794351.1| PREDICTED: uncharacterized protein LOC103710431 [Phoenix dactylifera]
Length=385

 Score =   169 bits (428),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+GA     W  +L KR  FR+ F  FD   VSK  EKK+ +  +     
Sbjct  183   DDKKLFELLVLSGALAELTWPAILSKRHIFREVFRDFDPVLVSKLNEKKLITPGSTASSL  242

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ +IL++ ++FGSFD Y W++VNHKP+ +++++  ++PVKT +++ IS
Sbjct  243   LSEPKLRAIIENARQILKIIEEFGSFDRYCWSFVNHKPVVSRFRYPRQVPVKTPRADVIS  302

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KDMV+RGFR VGPTVI+SFMQA+G+TNDHL +C R   C   A
Sbjct  303   KDMVRRGFRSVGPTVIYSFMQASGITNDHLISCYRFEECVTAA  345



>ref|XP_006302564.1| hypothetical protein CARUB_v10020671mg [Capsella rubella]
 gb|EOA35462.1| hypothetical protein CARUB_v10020671mg [Capsella rubella]
Length=318

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+G      W  +L KRQ FR  F  FD  A+S+ T KKI S        
Sbjct  152   DDKKLFELLSLSGTLAELSWKDILSKRQLFRQVFMDFDPIAISELTNKKIASSDIATTTL  211

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  ++N+ ++ ++  +FGSFD Y+W +VNHKP  +Q+++  ++PVKTSK+E IS
Sbjct  212   LSEQKLRSILENANQVRKIIVEFGSFDKYIWNFVNHKPTHSQFRYPRQVPVKTSKAELIS  271

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR V PTVI+SFMQ AGLTNDHLT C RHH C
Sbjct  272   KDLVRRGFRSVSPTVIYSFMQTAGLTNDHLTCCFRHHDC  310



>ref|XP_010656606.1| PREDICTED: uncharacterized protein LOC100267363 isoform X1 [Vitis 
vinifera]
 ref|XP_010656607.1| PREDICTED: uncharacterized protein LOC100267363 isoform X1 [Vitis 
vinifera]
 ref|XP_010656608.1| PREDICTED: uncharacterized protein LOC100267363 isoform X1 [Vitis 
vinifera]
 ref|XP_010656609.1| PREDICTED: uncharacterized protein LOC100267363 isoform X1 [Vitis 
vinifera]
Length=376

 Score =   169 bits (427),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKIT---SVSAEY  1140
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AV+K  EKK+    S+++  
Sbjct  178   DDKKLFELLVLSGALAELTWPTILSKRHIFREVFADFDPIAVAKLNEKKLMAPGSIASSL  237

Query  1139  GIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAI  960
               EL ++RG ++N+ ++ +V  +FGSFD Y+W++VNHKPI +++++   +PVKT K++ I
Sbjct  238   ISEL-KLRGIIENARQMSKVIDEFGSFDEYIWSFVNHKPIVSRFRYPRHVPVKTPKADVI  296

Query  959   SKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             SKD+V+RGFR VGPTVI+SFMQ AG+TNDHL +C R   C   A
Sbjct  297   SKDLVRRGFRSVGPTVIYSFMQVAGITNDHLISCFRFQDCVTAA  340



>ref|XP_002276173.1| PREDICTED: uncharacterized protein LOC100267363 isoform X2 [Vitis 
vinifera]
 emb|CBI36525.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   169 bits (427),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKIT---SVSAEY  1140
             +D  LFELLVL+GA     W  +L KR  FR+ F+ FD  AV+K  EKK+    S+++  
Sbjct  177   DDKKLFELLVLSGALAELTWPTILSKRHIFREVFADFDPIAVAKLNEKKLMAPGSIASSL  236

Query  1139  GIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAI  960
               EL ++RG ++N+ ++ +V  +FGSFD Y+W++VNHKPI +++++   +PVKT K++ I
Sbjct  237   ISEL-KLRGIIENARQMSKVIDEFGSFDEYIWSFVNHKPIVSRFRYPRHVPVKTPKADVI  295

Query  959   SKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             SKD+V+RGFR VGPTVI+SFMQ AG+TNDHL +C R   C   A
Sbjct  296   SKDLVRRGFRSVGPTVIYSFMQVAGITNDHLISCFRFQDCVTAA  339



>ref|XP_010472866.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104752430 
[Camelina sativa]
Length=337

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+GA     W  +L KRQ FR+ F  FD  A+S+   KKITS        
Sbjct  171   DDKKLFELLSLSGALAELSWKDILSKRQLFREVFMDFDPVAISELPNKKITSPDIPITAL  230

Query  1130  LSQV--RGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS++  R  ++N+ ++ ++  +FGSFD Y+W +VN KP  +Q+++  ++PVKTSK+E IS
Sbjct  231   LSELKLRSILENANQVSKIIVEFGSFDKYIWNFVNQKPTQSQFRYPRQVPVKTSKAELIS  290

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KD+V+RGFR V PTVI+SFMQ AGLTNDHLT C RHH C
Sbjct  291   KDLVRRGFRSVSPTVIYSFMQTAGLTNDHLTCCFRHHDC  329



>ref|XP_007011936.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007011937.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007011938.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007011939.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29555.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29556.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29557.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29558.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
Length=379

 Score =   169 bits (427),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 114/160 (71%), Gaps = 4/160 (3%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKIT---SVSAEY  1140
             +D  LFELLVL+GA     W  +L KR   R+ F  FDA AVSK  EKK+    S+++  
Sbjct  180   DDRKLFELLVLSGALSELTWPAILSKRHIVREVFVDFDAVAVSKLNEKKLVTPGSIASSL  239

Query  1139  GIELSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAI  960
               EL ++R  ++N+ +I +V  +FGSFD Y+W++VNHKPI +++++  ++PVKT K++ I
Sbjct  240   LSEL-KLRAIIENARQISKVIDEFGSFDEYIWSFVNHKPIVSRFRYPRQVPVKTPKADVI  298

Query  959   SKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             SKD+V+RGFR VGPTVI+SFMQ AG+TNDHLT+C R   C
Sbjct  299   SKDLVRRGFRSVGPTVIYSFMQVAGITNDHLTSCFRFQEC  338



>ref|XP_010254938.1| PREDICTED: uncharacterized protein LOC104595760 [Nelumbo nucifera]
Length=351

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+ A     W  +L KR  FR  F  FD   ++++TEKK+ S+       
Sbjct  163   DDRKLFELLVLSEALAELSWPTILNKRDIFRTLFDNFDPATIAQFTEKKVLSLKTSSSTL  222

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+ +I++V+++FGSF NY W++VNHKP+   +++  ++PVKT K+E +S
Sbjct  223   LSEPKLRAVVENARQIIKVQQEFGSFANYCWSFVNHKPLRNGFRYARQVPVKTPKAETMS  282

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM+++GFR VGPTVI+SFMQ AG+ NDHL TC R+  C
Sbjct  283   KDMMRKGFRCVGPTVIYSFMQVAGIVNDHLVTCFRYQEC  321



>gb|KDP31413.1| hypothetical protein JCGZ_11789 [Jatropha curcas]
Length=250

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 118/166 (71%), Gaps = 13/166 (8%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +++ LFE+L L+G  +  +WT +LK+R+ FR+AF+GFD + V+K  EK+IT ++++  I 
Sbjct  94    QNSKLFEVLTLSGMLMDYNWTEILKRRELFREAFAGFDPKIVAKMGEKEITEIASDKTIM  153

Query  1130  LSQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKD  951
             L++ R           ++++FGSF +Y+W YVN+KP+  +YK+   +P++T K+E ISKD
Sbjct  154   LAETR-----------IEREFGSFSSYMWGYVNYKPMINRYKYPRNVPLRTPKAEIISKD  202

Query  950   MVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             ++KRGFR+VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  203   LLKRGFRFVGPVIVYSFMQAAGLTIDHLVDCFRYGECVSLA--ERP  246



>ref|XP_003610321.1| Methyladenine glycosylase protein-like protein [Medicago truncatula]
 gb|AES92518.1| DNA-3-methyladenine glycosylase I [Medicago truncatula]
Length=375

 Score =   169 bits (427),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 112/163 (69%), Gaps = 2/163 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFE+LVL+ A     W  +L KR  FR+ F+ FD  AVSK  EKK+ +        
Sbjct  175   DDKKLFEVLVLSSALSELTWPAILSKRHIFREVFADFDPVAVSKLNEKKVITPGTTASSL  234

Query  1130  LS--QVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS  ++RG ++N+ +I +V  +FGSFDNY+W++VNHKPI +++++  ++PVKT K+E IS
Sbjct  235   LSDQKLRGIIENARQISKVIVEFGSFDNYIWSFVNHKPILSKFRYPRQVPVKTPKAEVIS  294

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             KD+V+RGFR VGPTVI+SFMQ  GLTNDHL +C R   C   A
Sbjct  295   KDLVRRGFRGVGPTVIYSFMQVVGLTNDHLISCFRFQECVAAA  337



>ref|XP_008220761.1| PREDICTED: uncharacterized protein LOC103320814 [Prunus mume]
Length=329

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 112/160 (70%), Gaps = 4/160 (3%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLVL+ A     W  +L KR  FR  F  FD  +++K+ EKK+ S+    GI 
Sbjct  139   DDKKLFELLVLSQALAELSWPEILHKRDMFRKLFDNFDPSSIAKFEEKKLQSLKVN-GIP  197

Query  1130  L---SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAI  960
             L    ++R  V+N++++L+V+++FGSF NY W++VNHKPI   +++  ++PVK+ K+E I
Sbjct  198   LLSEQKLRAVVENAMQMLKVQQEFGSFSNYCWSFVNHKPIRNGFRYGRQVPVKSPKAEVI  257

Query  959   SKDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             SKD++KRGFR VGPTVI+SFMQ AG+ NDHL TC R+  C
Sbjct  258   SKDLMKRGFRCVGPTVIYSFMQVAGIVNDHLLTCFRYKEC  297



>ref|XP_011021090.1| PREDICTED: uncharacterized protein LOC105123272 [Populus euphratica]
Length=318

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELL L+G  +  +WT +LK+++ FR+AF+GF+   V+K  EK+I  +++   I 
Sbjct  149   DDIQLFELLALSGMLMDYNWTEILKRKELFREAFNGFNPNIVAKKGEKEIMEIASNKAIM  208

Query  1130  L--SQVRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             L  S+VR  VDN+  +L++ ++FGSF NY+W  VN KP   +YK+   + +++ K+EAIS
Sbjct  209   LAESRVRCIVDNARCLLKIAREFGSFSNYMWGNVNFKPTINRYKYPRNVQLRSPKAEAIS  268

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELAAPQRP  813
             KD++KRGFR+VGP +++SFMQAAGLT DHL  C R+  C  LA  +RP
Sbjct  269   KDLLKRGFRFVGPVIVYSFMQAAGLTIDHLVDCYRYGECVSLA--ERP  314



>emb|CAE01637.3| OSJNBa0029H02.23 [Oryza sativa Japonica Group]
Length=437

 Score =   170 bits (430),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = -1

Query  1301  LLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIELSQ  1122
             +LFELLVL+GA     W  +L KR  FR+ F  FD   VSK +EKKI +  +     LS+
Sbjct  234   VLFELLVLSGALAELTWPTILNKRPIFREVFMDFDPVLVSKLSEKKIIAPGSPSSTLLSE  293

Query  1121  --VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAISKDM  948
               +RG ++N+ +IL++ ++FG+FD Y W++VN+KPI +++++  ++PVKTSK++AISKD+
Sbjct  294   QKLRGVIENARQILKIVEEFGTFDKYCWSFVNNKPILSRFRYPRQVPVKTSKADAISKDL  353

Query  947   VKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPCAELA  828
             V+RGFR VGPTV+++FMQ +G+TNDHL +C R   CA  A
Sbjct  354   VRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECAAAA  393



>ref|XP_007017467.1| DNA-3-methyladenine glycosylase, putative [Theobroma cacao]
 gb|EOY14692.1| DNA-3-methyladenine glycosylase, putative [Theobroma cacao]
Length=332

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV + A     W  +L KR  FR  F  FD  +++++TEKK+ S+     + 
Sbjct  148   DDRKLFELLVFSQALAELSWPTILNKRDIFRKLFDNFDPSSIAQFTEKKLLSLKVNGSLL  207

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+ ++L+V+++FGSF +Y W +VNHKPI   +++  ++PVKT K+E IS
Sbjct  208   LSEPKLRAVVENAKQMLKVQQEFGSFSSYCWGFVNHKPIRNGFRYVRQVPVKTPKAELIS  267

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTV++SFMQ AG+ NDHL TC R+  C
Sbjct  268   KDMMQRGFRCVGPTVVYSFMQVAGIVNDHLVTCFRYQEC  306



>ref|NP_565100.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
 gb|AAK59504.1| putative DNA-3-methyladenine glycosylase I [Arabidopsis thaliana]
 gb|AAL34182.1| putative DNA-3-methyladenine glycosylase I [Arabidopsis thaliana]
 gb|AEE35671.1| putative 3-methyladenine glycosylase I [Arabidopsis thaliana]
Length=329

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  1310  EDNLLFELLVLTGAQVGSDWTIVLKKRQDFRDAFSGFDAEAVSKYTEKKITSVSAEYGIE  1131
             +D  LFELLV + A     W  +L++R DFR  F  FD  A++++TEK++ S+     + 
Sbjct  146   DDKKLFELLVFSQALAEFSWPSILRRRDDFRKLFEEFDPSAIAQFTEKRLMSLRVNGCLI  205

Query  1130  LSQ--VRGAVDNSIRILEVKKQFGSFDNYLWAYVNHKPIATQYKWCNKIPVKTSKSEAIS  957
             LS+  +R  V+N+  +L+VK++FGSF NY W +VNHKP+   Y++  ++PVK+ K+E IS
Sbjct  206   LSEQKLRAIVENAKSVLKVKQEFGSFSNYCWRFVNHKPLRNGYRYGRQVPVKSPKAEYIS  265

Query  956   KDMVKRGFRYVGPTVIHSFMQAAGLTNDHLTTCPRHHPC  840
             KDM++RGFR VGPTV++SF+QA+G+ NDHLT C R+  C
Sbjct  266   KDMMQRGFRCVGPTVMYSFLQASGIVNDHLTACFRYQEC  304



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3887460491620