BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13724

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57286.1|  V-type proton ATPase subunit                           335   6e-110   Ipomoea nil [qian niu]
ref|XP_009786911.1|  PREDICTED: V-type proton ATPase subunit C          304   4e-98    Nicotiana sylvestris
ref|XP_009618992.1|  PREDICTED: V-type proton ATPase subunit C          303   1e-97    Nicotiana tomentosiformis
ref|XP_006363973.1|  PREDICTED: V-type proton ATPase subunit C-like     303   1e-97    Solanum tuberosum [potatoes]
ref|XP_004235295.1|  PREDICTED: V-type proton ATPase subunit C          301   8e-97    Solanum lycopersicum
emb|CDP15722.1|  unnamed protein product                                296   4e-95    Coffea canephora [robusta coffee]
ref|XP_011073132.1|  PREDICTED: V-type proton ATPase subunit C-like     296   1e-94    Sesamum indicum [beniseed]
ref|XP_011083360.1|  PREDICTED: V-type proton ATPase subunit C-like     292   3e-93    Sesamum indicum [beniseed]
gb|EYU24479.1|  hypothetical protein MIMGU_mgv1a006812mg                289   2e-91    Erythranthe guttata [common monkey flower]
gb|KJB40644.1|  hypothetical protein B456_007G072500                    283   3e-91    Gossypium raimondii
ref|XP_007031994.1|  Vacuolar ATP synthase subunit C (VATC) / V-A...    284   3e-90    Theobroma cacao [chocolate]
gb|KJB40648.1|  hypothetical protein B456_007G072500                    283   9e-90    Gossypium raimondii
gb|KJB76316.1|  hypothetical protein B456_012G082900                    281   4e-89    Gossypium raimondii
gb|KJB76315.1|  hypothetical protein B456_012G082900                    281   6e-89    Gossypium raimondii
ref|XP_010249179.1|  PREDICTED: V-type proton ATPase subunit C-like     280   8e-89    Nelumbo nucifera [Indian lotus]
ref|XP_012067332.1|  PREDICTED: V-type proton ATPase subunit C          280   2e-88    Jatropha curcas
ref|XP_008231040.1|  PREDICTED: V-type proton ATPase subunit C          278   6e-88    Prunus mume [ume]
ref|XP_002284444.1|  PREDICTED: V-type proton ATPase subunit C is...    278   1e-87    Vitis vinifera
ref|XP_007151733.1|  hypothetical protein PHAVU_004G070900g             276   3e-87    Phaseolus vulgaris [French bean]
ref|XP_002275510.1|  PREDICTED: V-type proton ATPase subunit C          276   5e-87    Vitis vinifera
ref|XP_006599411.1|  PREDICTED: V-type proton ATPase subunit C-like     275   7e-87    Glycine max [soybeans]
ref|XP_007215551.1|  hypothetical protein PRUPE_ppa007256mg             275   1e-86    Prunus persica
ref|XP_008362171.1|  PREDICTED: V-type proton ATPase subunit C-like     271   2e-86    
gb|AIY85415.1|  V-ATPase subunit C1                                     274   3e-86    Eriobotrya japonica [loquat]
ref|XP_011045799.1|  PREDICTED: V-type proton ATPase subunit C-li...    273   4e-86    Populus euphratica
ref|XP_003553974.1|  PREDICTED: V-type proton ATPase subunit C-like     273   4e-86    Glycine max [soybeans]
ref|XP_006446960.1|  hypothetical protein CICLE_v10015638mg             273   6e-86    Citrus clementina [clementine]
gb|ABH07428.1|  vacuolar H+-ATPase subunit C                            273   6e-86    Gossypium hirsutum [American cotton]
ref|XP_003548919.2|  PREDICTED: V-type proton ATPase subunit C-like     273   7e-86    Glycine max [soybeans]
ref|XP_011468207.1|  PREDICTED: V-type proton ATPase subunit C          272   1e-85    Fragaria vesca subsp. vesca
ref|XP_003624472.1|  V-type proton ATPase subunit C                     272   2e-85    Medicago truncatula
ref|XP_009378027.1|  PREDICTED: V-type proton ATPase subunit C          272   2e-85    Pyrus x bretschneideri [bai li]
dbj|BAE98945.1|  vacuolar ATP sythase subunit C                         267   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010066422.1|  PREDICTED: V-type proton ATPase subunit C          271   5e-85    Eucalyptus grandis [rose gum]
ref|XP_010925033.1|  PREDICTED: V-type proton ATPase subunit C-like     271   5e-85    Elaeis guineensis
ref|XP_008379060.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    270   1e-84    
ref|XP_006417188.1|  hypothetical protein EUTSA_v10007948mg             268   4e-84    Eutrema salsugineum [saltwater cress]
ref|NP_563916.1|  V-type proton ATPase subunit C                        268   6e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDY19421.1|  BnaC05g09300D                                          268   6e-84    Brassica napus [oilseed rape]
ref|XP_010693540.1|  PREDICTED: V-type proton ATPase subunit C          268   6e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004493016.1|  PREDICTED: V-type proton ATPase subunit C-like     268   8e-84    Cicer arietinum [garbanzo]
ref|XP_010939209.1|  PREDICTED: V-type proton ATPase subunit C-li...    267   1e-83    Elaeis guineensis
ref|XP_009148561.1|  PREDICTED: V-type proton ATPase subunit C          267   1e-83    Brassica rapa
ref|XP_003518129.1|  PREDICTED: V-type proton ATPase subunit C-like     267   2e-83    Glycine max [soybeans]
gb|KHM99227.1|  V-type proton ATPase subunit C                          267   2e-83    Glycine soja [wild soybean]
ref|XP_009386009.1|  PREDICTED: V-type proton ATPase subunit C-like     265   6e-83    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16036.1|  BnaC08g40870D                                          268   7e-83    Brassica napus [oilseed rape]
gb|KEH23490.1|  vacuolar H+-ATPase subunit C                            265   7e-83    Medicago truncatula
ref|XP_008775427.1|  PREDICTED: V-type proton ATPase subunit C-li...    265   1e-82    Phoenix dactylifera
ref|XP_008808181.1|  PREDICTED: V-type proton ATPase subunit C-like     265   1e-82    Phoenix dactylifera
ref|XP_004977299.1|  PREDICTED: V-type proton ATPase subunit C-like     264   2e-82    Setaria italica
gb|KHN28568.1|  V-type proton ATPase subunit C                          265   2e-82    Glycine soja [wild soybean]
gb|ABD32569.1|  V-ATPase subunit C                                      264   2e-82    Medicago truncatula
gb|KGN50885.1|  hypothetical protein Csa_5G312840                       264   2e-82    Cucumis sativus [cucumbers]
ref|XP_009395792.1|  PREDICTED: V-type proton ATPase subunit C-like     264   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512862.1|  vacuolar ATP synthase subunit C, putative          263   3e-82    Ricinus communis
ref|XP_011045798.1|  PREDICTED: V-type proton ATPase subunit C-li...    264   3e-82    Populus euphratica
ref|NP_001141160.1|  hypothetical protein                               257   4e-82    
ref|XP_004150739.1|  PREDICTED: V-type proton ATPase subunit C          263   4e-82    Cucumis sativus [cucumbers]
gb|AFW81322.1|  hypothetical protein ZEAMMB73_736936                    259   6e-82    
ref|XP_007161646.1|  hypothetical protein PHAVU_001G086700g             263   7e-82    Phaseolus vulgaris [French bean]
ref|XP_008463120.1|  PREDICTED: V-type proton ATPase subunit C          262   9e-82    Cucumis melo [Oriental melon]
gb|KHG11234.1|  V-type proton ATPase subunit C -like protein            261   1e-81    Gossypium arboreum [tree cotton]
ref|XP_010096044.1|  V-type proton ATPase subunit C                     262   2e-81    
ref|XP_010476263.1|  PREDICTED: V-type proton ATPase subunit C-like     261   3e-81    Camelina sativa [gold-of-pleasure]
ref|XP_002441755.1|  hypothetical protein SORBIDRAFT_08g001880          261   3e-81    Sorghum bicolor [broomcorn]
ref|XP_010250562.1|  PREDICTED: V-type proton ATPase subunit C          261   3e-81    Nelumbo nucifera [Indian lotus]
ref|XP_002441624.1|  hypothetical protein SORBIDRAFT_09g030620          261   4e-81    Sorghum bicolor [broomcorn]
ref|XP_006844509.1|  PREDICTED: V-type proton ATPase subunit C          260   6e-81    Amborella trichopoda
ref|XP_006305100.1|  hypothetical protein CARUB_v10009467mg             259   9e-81    
ref|XP_010494723.1|  PREDICTED: V-type proton ATPase subunit C          259   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010556324.1|  PREDICTED: V-type proton ATPase subunit C          259   2e-80    Tarenaya hassleriana [spider flower]
ref|XP_003567787.1|  PREDICTED: V-type proton ATPase subunit C          259   2e-80    Brachypodium distachyon [annual false brome]
ref|XP_008654564.1|  PREDICTED: hypothetical protein isoform X1         258   3e-80    
ref|XP_010458722.1|  PREDICTED: V-type proton ATPase subunit C-like     258   3e-80    Camelina sativa [gold-of-pleasure]
ref|XP_011001967.1|  PREDICTED: V-type proton ATPase subunit C          258   3e-80    Populus euphratica
ref|XP_006369829.1|  Vacuolar ATP synthase subunit C family protein     258   4e-80    
ref|XP_006655657.1|  PREDICTED: V-type proton ATPase subunit C-like     258   6e-80    Oryza brachyantha
gb|EMT31457.1|  V-type proton ATPase subunit C                          253   8e-80    
ref|XP_006373110.1|  hypothetical protein POPTR_0017s08810g             257   1e-79    Populus trichocarpa [western balsam poplar]
gb|ABG23314.1|  vacuolar proton-ATPase C subunit                        256   3e-79    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001056500.1|  Os05g0593100                                       256   4e-79    
ref|XP_010528136.1|  PREDICTED: V-type proton ATPase subunit C-like     255   5e-79    Tarenaya hassleriana [spider flower]
gb|KFK43549.1|  hypothetical protein AALP_AA1G141200                    255   6e-79    Arabis alpina [alpine rockcress]
ref|NP_001142247.1|  uncharacterized protein LOC100274416               255   6e-79    Zea mays [maize]
emb|CDY21070.1|  BnaA08g24550D                                          255   8e-79    Brassica napus [oilseed rape]
ref|XP_009110617.1|  PREDICTED: V-type proton ATPase subunit C-like     255   8e-79    Brassica rapa
emb|CDX71966.1|  BnaC08g29080D                                          254   9e-79    
ref|XP_009118052.1|  PREDICTED: V-type proton ATPase subunit C-like     254   1e-78    Brassica rapa
ref|XP_002889973.1|  de-etiolated 3                                     254   1e-78    
gb|ACT34062.1|  vacuolar ATP synthetase subunit C                       254   1e-78    Aegilops tauschii
gb|EMS67397.1|  V-type proton ATPase subunit C                          254   2e-78    Triticum urartu
emb|CDY66539.1|  BnaCnng51300D                                          253   2e-78    Brassica napus [oilseed rape]
ref|XP_010554131.1|  PREDICTED: V-type proton ATPase subunit C-li...    253   4e-78    Tarenaya hassleriana [spider flower]
ref|NP_001147632.1|  LOC100281241                                       252   8e-78    Zea mays [maize]
ref|XP_010554130.1|  PREDICTED: V-type proton ATPase subunit C-li...    253   2e-77    Tarenaya hassleriana [spider flower]
emb|CDY26596.1|  BnaA09g46810D                                          253   2e-75    Brassica napus [oilseed rape]
gb|ADE77882.1|  unknown                                                 239   1e-72    Picea sitchensis
gb|KJB76319.1|  hypothetical protein B456_012G082900                    233   1e-70    Gossypium raimondii
ref|XP_006373109.1|  hypothetical protein POPTR_0017s08810g             233   2e-70    
gb|KJB76320.1|  hypothetical protein B456_012G082900                    232   2e-70    Gossypium raimondii
gb|KCW64312.1|  hypothetical protein EUGRSUZ_G019431                    227   1e-68    Eucalyptus grandis [rose gum]
gb|AAO72561.1|  putative vacuolar ATP synthase subunit C                224   1e-66    
ref|XP_010939292.1|  PREDICTED: V-type proton ATPase subunit C-li...    220   1e-65    Elaeis guineensis
gb|AGJ98217.1|  DET3                                                    217   2e-65    Petunia x hybrida [garden petunia]
ref|XP_001773067.1|  predicted protein                                  219   3e-65    
gb|AFA36545.1|  vacuolar ATP synthetase subunit C                       201   2e-60    Lolium perenne [perennial ryegrass]
ref|XP_002980160.1|  hypothetical protein SELMODRAFT_111716             200   2e-57    Selaginella moellendorffii
gb|KJB40646.1|  hypothetical protein B456_007G072500                    198   2e-57    Gossypium raimondii
gb|EMT09400.1|  V-type proton ATPase subunit C                          197   2e-56    
ref|XP_008775428.1|  PREDICTED: V-type proton ATPase subunit C-li...    182   2e-51    
ref|XP_010528980.1|  PREDICTED: V-type proton ATPase subunit C-like     175   2e-50    Tarenaya hassleriana [spider flower]
gb|KDO47363.1|  hypothetical protein CISIN_1g017251mg                   167   5e-46    Citrus sinensis [apfelsine]
gb|KJB40647.1|  hypothetical protein B456_007G072500                    167   1e-45    Gossypium raimondii
gb|EPS62747.1|  hypothetical protein M569_12043                         165   5e-45    Genlisea aurea
gb|KJB76317.1|  hypothetical protein B456_012G082900                    164   1e-44    Gossypium raimondii
ref|XP_005651974.1|  vacuolar H+ ATPase V1 sector, subunit C            164   7e-44    Coccomyxa subellipsoidea C-169
ref|XP_008341246.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    162   8e-44    
ref|XP_010663792.1|  PREDICTED: V-type proton ATPase subunit C is...    162   1e-43    
sp|Q9SCB9.1|VATC_HORVU  RecName: Full=V-type proton ATPase subuni...    158   7e-42    Hordeum vulgare [barley]
gb|ADI46924.1|  ATPvC1m                                                 150   1e-38    Volvox carteri f. nagariensis
ref|XP_002954527.1|  vacuolar ATP synthase, subunit C                   149   2e-38    Volvox carteri f. nagariensis
ref|XP_010068642.1|  PREDICTED: V-type proton ATPase subunit C-like     145   3e-37    
gb|KJB40645.1|  hypothetical protein B456_007G072500                    142   5e-36    Gossypium raimondii
ref|XP_002503957.1|  H+-or Na+-translocating f-type, v-type and A...    142   8e-36    Micromonas commoda
ref|XP_001696429.1|  vacuolar H+ ATPase V1 sector, subunit C            141   2e-35    Chlamydomonas reinhardtii
ref|XP_005847214.1|  hypothetical protein CHLNCDRAFT_35880              139   2e-34    Chlorella variabilis
ref|XP_007513767.1|  V-type proton ATPase subunit C 1                   137   2e-33    Bathycoccus prasinos
ref|XP_001756840.1|  predicted protein                                  136   2e-33    
ref|XP_009051892.1|  hypothetical protein LOTGIDRAFT_206255             135   3e-33    Lottia gigantea
ref|XP_001814187.1|  PREDICTED: V-type proton ATPase subunit C is...    133   2e-32    Tribolium castaneum [rust-red flour beetle]
ref|XP_008195426.1|  PREDICTED: V-type proton ATPase subunit C is...    133   3e-32    Tribolium castaneum [rust-red flour beetle]
gb|EFA06700.1|  hypothetical protein TcasGA2_TC009631                   133   4e-32    
ref|XP_002585525.1|  hypothetical protein BRAFLDRAFT_60009              130   2e-31    Branchiostoma floridae
gb|AIJ50380.1|  V-ATPase subunit C                                      130   2e-31    Pectinophora gossypiella
ref|XP_011399399.1|  V-type proton ATPase subunit C                     130   3e-31    Auxenochlorella protothecoides
gb|ABF18462.1|  V-ATPase C subunit                                      129   3e-31    Aedes aegypti
emb|CCD60515.1|  subfamily S1B unassigned peptidase (S01 family)        128   6e-31    Schistosoma mansoni
ref|XP_011305233.1|  PREDICTED: V-type proton ATPase subunit C          128   2e-30    Fopius arisanus
gb|KFB48532.1|  AGAP005845-PA-like protein                              127   2e-30    Anopheles sinensis
gb|ENN78483.1|  hypothetical protein YQE_05047                          126   2e-30    Dendroctonus ponderosae
ref|XP_009861882.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    127   2e-30    
emb|CAX70572.1|  Vacuolar H+ ATPase 44kD C subunit                      127   2e-30    Schistosoma japonicum
ref|XP_006626108.1|  PREDICTED: V-type proton ATPase subunit C 1-...    127   3e-30    Lepisosteus oculatus
gb|KDR10550.1|  V-type proton ATPase subunit C                          127   4e-30    Zootermopsis nevadensis
emb|CAX70571.1|  Vacuolar H+ ATPase 44kD C subunit                      126   4e-30    Schistosoma japonicum
ref|XP_001418773.1|  F-ATPase family transporter: protons (vacuolar)    126   5e-30    Ostreococcus lucimarinus CCE9901
ref|XP_005797406.1|  PREDICTED: V-type proton ATPase subunit C 1-...    126   5e-30    Xiphophorus maculatus
ref|XP_001843335.1|  vacuolar ATP synthase subunit C                    127   5e-30    Culex quinquefasciatus
ref|XP_008420198.1|  PREDICTED: V-type proton ATPase subunit C 1-A      126   5e-30    Poecilia reticulata
ref|XP_011553183.1|  PREDICTED: V-type proton ATPase subunit C is...    126   5e-30    Plutella xylostella [cabbage moth]
ref|XP_008480724.1|  PREDICTED: V-type proton ATPase subunit C          126   6e-30    
gb|ERL87116.1|  hypothetical protein D910_04516                         126   7e-30    Dendroctonus ponderosae
ref|XP_011553182.1|  PREDICTED: V-type proton ATPase subunit C is...    126   7e-30    Plutella xylostella [cabbage moth]
ref|XP_001650489.1|  AAEL005173-PA                                      128   9e-30    
dbj|BAM20425.1|  vacuolar H[+] ATPase 44kD C subunit                    125   1e-29    Papilio polytes
ref|XP_002423137.1|  vacuolar ATP synthase subunit C, putative          126   1e-29    Pediculus humanus corporis [human body lice]
ref|XP_001201267.2|  PREDICTED: V-type proton ATPase subunit C          125   1e-29    Strongylocentrotus purpuratus [purple urchin]
ref|XP_011504285.1|  PREDICTED: V-type proton ATPase subunit C is...    125   1e-29    Ceratosolen solmsi marchali
ref|XP_007547766.1|  PREDICTED: V-type proton ATPase subunit C 1-...    125   1e-29    Poecilia formosa
ref|XP_006012217.1|  PREDICTED: V-type proton ATPase subunit C 1-...    125   2e-29    Latimeria chalumnae
ref|XP_009012372.1|  hypothetical protein HELRODRAFT_156435             124   3e-29    Helobdella robusta
ref|XP_315870.4|  AGAP005845-PA                                         124   3e-29    Anopheles gambiae str. PEST
ref|XP_004077677.1|  PREDICTED: V-type proton ATPase subunit C 1        124   3e-29    Oryzias latipes [Japanese rice fish]
ref|XP_011879957.1|  PREDICTED: V-type proton ATPase subunit C          124   3e-29    Vollenhovia emeryi
gb|ESA12183.1|  hypothetical protein GLOINDRAFT_185994                  124   3e-29    
ref|XP_002733333.1|  PREDICTED: V-type proton ATPase subunit C 1-...    124   3e-29    Saccoglossus kowalevskii
ref|NP_001005772.2|  V-type proton ATPase subunit C 1-B                 124   3e-29    Danio rerio [leopard danio]
ref|XP_004993351.1|  hypothetical protein PTSG_05481                    124   4e-29    Salpingoeca rosetta
ref|NP_958479.1|  V-type proton ATPase subunit C 1-A                    124   4e-29    Danio rerio [leopard danio]
ref|XP_008559568.1|  PREDICTED: V-type proton ATPase subunit C          124   4e-29    Microplitis demolitor
ref|XP_003389520.1|  PREDICTED: V-type proton ATPase subunit C 1-...    124   5e-29    Amphimedon queenslandica
ref|XP_005098193.1|  PREDICTED: V-type proton ATPase subunit C-li...    124   5e-29    Aplysia californica
ref|NP_001023451.1|  Protein VHA-11, isoform a                          124   5e-29    Caenorhabditis elegans [roundworm]
ref|XP_011687853.1|  PREDICTED: V-type proton ATPase subunit C          124   5e-29    Wasmannia auropunctata
ref|XP_001946227.1|  PREDICTED: V-type proton ATPase subunit C          123   6e-29    Acyrthosiphon pisum
ref|XP_010751636.1|  PREDICTED: V-type proton ATPase subunit C 1-A      123   7e-29    Larimichthys crocea [croceine croaker]
emb|CAF93730.1|  unnamed protein product                                123   8e-29    Tetraodon nigroviridis
ref|XP_002645132.1|  C. briggsae CBR-VHA-11 protein                     123   8e-29    Caenorhabditis briggsae
ref|XP_008211658.1|  PREDICTED: V-type proton ATPase subunit C is...    123   1e-28    
gb|ABO61291.1|  vacuolar ATPase subunit C                               122   1e-28    Lutzomyia longipalpis
ref|XP_003444114.1|  PREDICTED: V-type proton ATPase subunit C 1-...    122   1e-28    Oreochromis niloticus
ref|XP_001647617.1|  AAEL015594-PA                                      121   1e-28    
ref|XP_007886138.1|  PREDICTED: V-type proton ATPase subunit C 1        122   1e-28    Callorhinchus milii [Australian ghost shark]
ref|XP_001960901.1|  GF11269                                            122   1e-28    Drosophila ananassae
ref|XP_011504284.1|  PREDICTED: V-type proton ATPase subunit C is...    123   2e-28    Ceratosolen solmsi marchali
ref|XP_003094835.1|  CRE-VHA-11 protein                                 122   2e-28    Caenorhabditis remanei
sp|Q9U5N1.1|VATC_MANSE  RecName: Full=V-type proton ATPase subuni...    121   3e-28    Manduca sexta [Carolina sphinx]
ref|XP_008290531.1|  PREDICTED: V-type proton ATPase subunit C 1        121   3e-28    Stegastes partitus
ref|NP_001040138.1|  vacuolar ATPase subunit C                          121   3e-28    Bombyx mori [silk moth]
gb|EHJ73191.1|  hypothetical protein KGM_01090                          122   3e-28    
ref|XP_012137366.1|  PREDICTED: V-type proton ATPase subunit C          121   3e-28    Megachile rotundata
ref|XP_011144745.1|  PREDICTED: V-type proton ATPase subunit C          121   3e-28    Harpegnathos saltator
gb|ETN59245.1|  vacuolar ATP synthase subunit C                         123   3e-28    Anopheles darlingi [American malaria mosquito]
ref|XP_011631232.1|  PREDICTED: V-type proton ATPase subunit C is...    121   4e-28    Pogonomyrmex barbatus
ref|XP_007249407.1|  PREDICTED: V-type proton ATPase subunit C 1-...    121   4e-28    Astyanax mexicanus [blind cave fish]
gb|EFX90034.1|  hypothetical protein DAPPUDRAFT_205240                  121   4e-28    Daphnia pulex
gb|EZA45856.1|  S-methyl-5'-thioadenosine phosphorylase-like prot...    122   4e-28    
emb|CDJ90591.1|  ATPase domain containing protein                       118   4e-28    Haemonchus contortus [red stomach worm]
ref|XP_011268884.1|  PREDICTED: V-type proton ATPase subunit C          121   5e-28    Camponotus floridanus
gb|EFN75043.1|  Vacuolar proton pump subunit C                          121   5e-28    Camponotus floridanus
ref|XP_010771260.1|  PREDICTED: V-type proton ATPase subunit C 1        120   5e-28    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011414828.1|  PREDICTED: V-type proton ATPase subunit C 1-...    120   5e-28    Crassostrea gigas
gb|ACO11255.1|  Vacuolar proton pump subunit C                          120   6e-28    Caligus rogercresseyi
ref|XP_002940167.1|  PREDICTED: V-type proton ATPase subunit C 2        120   6e-28    Xenopus tropicalis [western clawed frog]
ref|XP_008329974.1|  PREDICTED: V-type proton ATPase subunit C 1-...    120   6e-28    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003055517.1|  H+-or Na+-translocating f-type, v-type and A...    120   6e-28    Micromonas pusilla CCMP1545
gb|EKC32287.1|  V-type proton ATPase subunit C 1                        120   7e-28    Crassostrea gigas
ref|XP_008321927.1|  PREDICTED: V-type proton ATPase subunit C 1        120   7e-28    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011067212.1|  PREDICTED: V-type proton ATPase subunit C          120   7e-28    Acromyrmex echinatior
ref|XP_009170324.1|  hypothetical protein T265_06723                    120   7e-28    Opisthorchis viverrini [Southeast Asian liver fluke]
gb|EGI57447.1|  V-type proton ATPase subunit C                          120   8e-28    Acromyrmex echinatior
gb|EGT48628.1|  CBN-VHA-11 protein                                      120   9e-28    Caenorhabditis brenneri
ref|XP_005917491.1|  PREDICTED: V-type proton ATPase subunit C 1-...    120   9e-28    Haplochromis burtoni
ref|XP_010883498.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    119   9e-28    Esox lucius
gb|EPB69204.1|  v-ATPase subunit C                                      120   9e-28    Ancylostoma ceylanicum
ref|XP_005728447.1|  PREDICTED: V-type proton ATPase subunit C 1-...    120   1e-27    Pundamilia nyererei
ref|XP_010898239.1|  PREDICTED: V-type proton ATPase subunit C 1-...    120   1e-27    
ref|XP_010744926.1|  PREDICTED: V-type proton ATPase subunit C 1-...    119   1e-27    
ref|XP_008304955.1|  PREDICTED: V-type proton ATPase subunit C 1-A      119   1e-27    Stegastes partitus
ref|XP_006219905.1|  PREDICTED: V-type proton ATPase subunit C-like     119   1e-27    Vicugna pacos
ref|XP_011332476.1|  PREDICTED: V-type proton ATPase subunit C is...    119   1e-27    
ref|XP_005803508.1|  PREDICTED: V-type proton ATPase subunit C 1-...    119   1e-27    Xiphophorus maculatus
ref|XP_007550566.1|  PREDICTED: V-type proton ATPase subunit C 1-...    119   1e-27    Poecilia formosa
ref|XP_007550565.1|  PREDICTED: V-type proton ATPase subunit C 1-A      119   1e-27    Poecilia formosa
ref|XP_003965909.1|  PREDICTED: V-type proton ATPase subunit C 1        119   2e-27    Takifugu rubripes [tiger puffer]
gb|EYC06045.1|  hypothetical protein Y032_0078g1163                     119   2e-27    Ancylostoma ceylanicum
ref|XP_011332474.1|  PREDICTED: V-type proton ATPase subunit C is...    119   2e-27    Ooceraea biroi
ref|XP_011631231.1|  PREDICTED: V-type proton ATPase subunit C is...    120   2e-27    
ref|XP_003459431.1|  PREDICTED: V-type proton ATPase subunit C 1-...    119   2e-27    Oreochromis niloticus
ref|XP_002015982.1|  GL11349                                            119   2e-27    Drosophila persimilis
ref|XP_008211656.1|  PREDICTED: V-type proton ATPase subunit C is...    121   2e-27    Nasonia vitripennis
gb|AAB62571.1|  V-ATPase C subunit                                      119   3e-27    Drosophila melanogaster
gb|KFH72569.1|  hypothetical protein MVEG_02858                         119   3e-27    Mortierella verticillata NRRL 6337
ref|XP_002107808.1|  hypothetical protein TRIADDRAFT_19844              118   3e-27    Trichoplax adhaerens
ref|XP_001360460.2|  GA20788                                            119   3e-27    
ref|XP_010883497.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    118   3e-27    Esox lucius
emb|CEG71831.1|  hypothetical protein RMATCC62417_07500                 118   3e-27    Rhizopus microsporus
emb|CDJ04792.1|  V type proton ATPase subunit C 1 A                     118   3e-27    
ref|XP_006636047.1|  PREDICTED: V-type proton ATPase subunit C 1-...    118   3e-27    Lepisosteus oculatus
ref|XP_003080507.1|  putative vacuolar ATP synthase subunit C (ISS)     118   3e-27    Ostreococcus tauri
dbj|GAA48137.1|  V-type proton ATPase subunit C 1-A                     120   3e-27    Clonorchis sinensis [oriental liver fluke]
ref|XP_003968986.1|  PREDICTED: V-type proton ATPase subunit C 1-A      118   4e-27    Takifugu rubripes [tiger puffer]
emb|CDH57929.1|  vacuolar atp synthase subunit c                        118   4e-27    Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_477266.1|  vacuolar H[+] ATPase 44kD subunit, isoform A          118   4e-27    Drosophila melanogaster
emb|CDH57928.1|  vacuolar atp synthase subunit c                        118   4e-27    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS17048.1|  V type proton ATPase subunit C 1 A                     118   5e-27    Echinococcus granulosus
ref|XP_012061168.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    118   5e-27    Atta cephalotes
ref|NP_725564.1|  vacuolar H[+] ATPase 44kD subunit, isoform C          118   7e-27    Drosophila melanogaster
ref|XP_003375717.1|  vacuolar proton pump subunit C                     117   7e-27    Trichinella spiralis
ref|XP_004074259.1|  PREDICTED: V-type proton ATPase subunit C 1-...    117   8e-27    Oryzias latipes [Japanese rice fish]
ref|XP_006677585.1|  hypothetical protein BATDEDRAFT_87040              117   9e-27    Batrachochytrium dendrobatidis JAM81
gb|EUB62465.1|  V-type proton ATPase subunit C 1-A                      117   1e-26    Echinococcus granulosus
ref|XP_002059879.1|  GJ14996                                            119   1e-26    
ref|XP_001975366.1|  GG22273                                            117   1e-26    
emb|CDS06331.1|  hypothetical protein LRAMOSA08859                      117   1e-26    Lichtheimia ramosa
ref|XP_002408654.1|  C subunit of V-ATPase, putative                    116   1e-26    Ixodes scapularis [blacklegged tick]
ref|XP_004533485.1|  PREDICTED: V-type proton ATPase subunit C-li...    116   2e-26    Ceratitis capitata [medfly]
gb|AAB51350.1|  C subunit of V-ATPase                                   116   2e-26    Amblyomma americanum
ref|XP_007476197.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   2e-26    Monodelphis domestica
gb|KFP57056.1|  V-type proton ATPase subunit C 1                        113   2e-26    Cathartes aura
ref|XP_002004414.1|  GI19629                                            119   2e-26    
ref|XP_003395428.1|  PREDICTED: v-type proton ATPase subunit C-like     116   2e-26    
gb|ETE67498.1|  V-type proton ATPase subunit C 1-A                      116   2e-26    Ophiophagus hannah
ref|XP_004340673.1|  Vtype proton ATPase subunit C, putative            116   2e-26    Acanthamoeba castellanii str. Neff
ref|XP_002092223.1|  GE14069                                            117   2e-26    
gb|KCW64318.1|  hypothetical protein EUGRSUZ_G01948                     109   2e-26    Eucalyptus grandis [rose gum]
ref|XP_002063006.1|  GK21692                                            119   2e-26    
ref|XP_010222647.1|  PREDICTED: V-type proton ATPase subunit C 2        116   2e-26    Tinamus guttatus
ref|NP_001279559.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...    116   3e-26    Callorhinchus milii [Australian ghost shark]
gb|KFM68542.1|  V-type proton ATPase subunit C                          115   3e-26    Stegodyphus mimosarum
ref|XP_011205545.1|  PREDICTED: V-type proton ATPase subunit C          115   3e-26    Bactrocera dorsalis [papaya fruit fly]
ref|XP_007670905.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    115   3e-26    
gb|EPZ31995.1|  ATPase, V1 complex, subunit C domain-containing p...    115   5e-26    Rozella allomycis CSF55
gb|EPX75285.1|  V-type ATPase V1 subunit C                              115   5e-26    Schizosaccharomyces octosporus yFS286
ref|XP_010768583.1|  PREDICTED: V-type proton ATPase subunit C 1-...    111   5e-26    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007423656.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    115   5e-26    Python bivittatus
dbj|BAB24526.1|  unnamed protein product                                115   6e-26    Mus musculus [mouse]
ref|XP_006028579.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    115   6e-26    Alligator sinensis
ref|XP_001506621.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    114   7e-26    
ref|XP_003488765.1|  PREDICTED: V-type proton ATPase subunit C-like     116   7e-26    
gb|KFV93235.1|  V-type proton ATPase subunit C 1                        113   7e-26    
ref|XP_005174884.1|  PREDICTED: V-type proton ATPase subunit C          114   7e-26    
ref|XP_006028578.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    114   8e-26    
gb|EDM16360.1|  rCG60064, isoform CRA_a                                 113   8e-26    
ref|XP_007488240.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    114   9e-26    
ref|NP_001088261.1|  V-type proton ATPase subunit C 1                   114   9e-26    
ref|XP_004580713.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   9e-26    
gb|KJH47284.1|  V-type ATPase, C subunit                                115   9e-26    
ref|XP_009578275.1|  PREDICTED: V-type proton ATPase subunit C 1        112   9e-26    
ref|XP_006562159.1|  PREDICTED: V-type proton ATPase subunit C is...    114   1e-25    
ref|XP_006611433.1|  PREDICTED: V-type proton ATPase subunit C-li...    114   1e-25    
ref|XP_009700298.1|  PREDICTED: V-type proton ATPase subunit C 1        114   1e-25    
gb|KFP65965.1|  V-type proton ATPase subunit C 1                        114   1e-25    
ref|XP_010071758.1|  PREDICTED: V-type proton ATPase subunit C 1        113   1e-25    
ref|XP_004436528.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    114   1e-25    
ref|XP_004047450.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   1e-25    
ref|XP_009812066.1|  PREDICTED: V-type proton ATPase subunit C 1        112   1e-25    
ref|XP_010954093.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    114   1e-25    
ref|XP_003139516.1|  V-ATPase subunit C family protein                  114   1e-25    
ref|XP_001369362.2|  PREDICTED: V-type proton ATPase subunit C 1 ...    114   1e-25    
ref|XP_006021843.1|  PREDICTED: V-type proton ATPase subunit C 2        114   1e-25    
ref|XP_007634426.1|  PREDICTED: V-type proton ATPase subunit C 1        114   1e-25    
ref|XP_004679737.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   1e-25    
gb|KFV06900.1|  V-type proton ATPase subunit C 1                        113   1e-25    
ref|XP_005306086.1|  PREDICTED: V-type proton ATPase subunit C 1        114   2e-25    
ref|XP_001987444.1|  GH21923                                            116   2e-25    
ref|XP_007056164.1|  PREDICTED: V-type proton ATPase subunit C 1        114   2e-25    
ref|XP_003509877.1|  PREDICTED: V-type proton ATPase subunit C 1        114   2e-25    
ref|XP_010610418.1|  PREDICTED: V-type proton ATPase subunit C 1        114   2e-25    
gb|AAA36803.1|  H+ -ATPase C subunit                                    113   2e-25    
ref|XP_006241664.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   2e-25    
gb|KFO20049.1|  V-type proton ATPase subunit C 1                        113   2e-25    
ref|XP_004940041.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   2e-25    
ref|XP_004663083.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   2e-25    
ref|XP_007488239.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    114   2e-25    
ref|XP_005367598.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_005072734.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_006611432.1|  PREDICTED: V-type proton ATPase subunit C-li...    114   2e-25    
ref|XP_006562158.1|  PREDICTED: V-type proton ATPase subunit C is...    114   2e-25    
ref|XP_006212224.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   2e-25    
ref|XP_006982882.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_006122461.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_005150964.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_005010664.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_004011849.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   2e-25    
ref|XP_003940719.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_008849773.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_002710769.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
emb|CEF60497.1|  V-type proton ATPase subunit C 2                       113   2e-25    
ref|XP_009890115.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_008051075.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_005316339.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   2e-25    
ref|NP_001011992.1|  V-type proton ATPase subunit C 1                   113   2e-25    
ref|XP_006145636.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_004457641.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   2e-25    
gb|ADI40552.1|  lysosomal H+-transporting ATPase 42kDa, V1 subuni...    110   2e-25    
ref|XP_004316545.1|  PREDICTED: V-type proton ATPase subunit C 1-...    112   2e-25    
ref|XP_008146707.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   2e-25    
ref|XP_005231036.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
ref|XP_003219499.1|  PREDICTED: V-type proton ATPase subunit C 1        113   2e-25    
gb|KGL98694.1|  V-type proton ATPase subunit C 1                        113   2e-25    
ref|XP_003760346.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   3e-25    
ref|XP_004768925.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_008934370.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_005499457.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_003760347.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   3e-25    
ref|XP_004457640.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   3e-25    
ref|XP_003782478.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   3e-25    
ref|XP_006010910.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    113   3e-25    
ref|XP_010148071.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_009864623.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
gb|KFQ55181.1|  V-type proton ATPase subunit C 1                        113   3e-25    
ref|NP_079770.2|  V-type proton ATPase subunit C 1                      113   3e-25    
gb|EOB07902.1|  Vacuolar proton pump subunit C 1                        113   3e-25    
gb|KFQ17703.1|  V-type proton ATPase subunit C 1                        113   3e-25    
ref|XP_009680642.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_009275405.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_009076362.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_005042435.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_010017127.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   3e-25    
ref|XP_010223600.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
gb|KFV53281.1|  V-type proton ATPase subunit C 1                        113   3e-25    
dbj|BAE40727.1|  unnamed protein product                                113   3e-25    
gb|KFP35023.1|  V-type proton ATPase subunit C 1                        113   3e-25    
ref|XP_010017126.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    113   3e-25    
ref|NP_001686.1|  V-type proton ATPase subunit C 1                      113   3e-25    
gb|KFV20198.1|  V-type proton ATPase subunit C 1                        113   3e-25    
gb|KFQ75735.1|  V-type proton ATPase subunit C 1                        113   3e-25    
gb|KFM06053.1|  V-type proton ATPase subunit C 1                        113   3e-25    
ref|XP_009896480.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
emb|CAH93171.1|  hypothetical protein                                   113   3e-25    
gb|AIC48333.1|  ATP6V1C1                                                113   3e-25    
ref|XP_002759363.1|  PREDICTED: V-type proton ATPase subunit C 1        113   3e-25    
ref|XP_007932996.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   3e-25    
gb|KFO56816.1|  V-type proton ATPase subunit C 1                        113   3e-25    
gb|KFW03506.1|  V-type proton ATPase subunit C 1                        113   3e-25    
gb|ADI40553.1|  lysosomal H+-transporting ATPase 42kDa, V1 subuni...    109   3e-25    
ref|XP_009918407.1|  PREDICTED: V-type proton ATPase subunit C 1        112   3e-25    
gb|KFV65544.1|  V-type proton ATPase subunit C 1                        112   3e-25    
ref|XP_011181512.1|  PREDICTED: V-type proton ATPase subunit C          112   3e-25    
ref|XP_004679736.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   3e-25    
gb|KGL84583.1|  V-type proton ATPase subunit C 1                        112   3e-25    
gb|KFQ53504.1|  V-type proton ATPase subunit C 1                        112   3e-25    
ref|XP_011600484.1|  PREDICTED: V-type proton ATPase subunit C 1        112   3e-25    
gb|KFZ64730.1|  V-type proton ATPase subunit C 1                        112   3e-25    
ref|XP_006140884.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    112   3e-25    
ref|XP_004663082.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   3e-25    
gb|KFP85886.1|  V-type proton ATPase subunit C 1                        112   4e-25    
gb|KFP83640.1|  V-type proton ATPase subunit C 1                        112   4e-25    
gb|KFP15570.1|  V-type proton ATPase subunit C 1                        112   4e-25    
ref|NP_989172.1|  V-type proton ATPase subunit C 1                      112   4e-25    
gb|KFQ04988.1|  V-type proton ATPase subunit C 1                        112   4e-25    
ref|XP_002199030.2|  PREDICTED: V-type proton ATPase subunit C 1        113   4e-25    
gb|AAC83084.1|  vacuolar adenosine triphosphatase subunit C             112   4e-25    
gb|EIE92422.1|  hypothetical protein RO3G_16944                         112   4e-25    
ref|XP_009510884.1|  PREDICTED: V-type proton ATPase subunit C 1        112   4e-25    
emb|CAH93365.1|  hypothetical protein                                   112   5e-25    
ref|XP_001494151.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_003787440.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    112   5e-25    
ref|XP_418370.1|  PREDICTED: V-type proton ATPase subunit C 1 iso...    112   5e-25    
ref|XP_005627900.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_006212223.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
ref|NP_001177134.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...    112   5e-25    
ref|XP_010004766.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_010302959.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_002922648.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
ref|XP_008922269.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_005316338.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
gb|KFO11936.1|  V-type proton ATPase subunit C 1                        112   5e-25    
ref|XP_004402384.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
ref|XP_007518917.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_007463323.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
ref|XP_004431292.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|NP_788849.1|  V-type proton ATPase subunit C 1                      112   5e-25    
ref|XP_008146706.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
ref|XP_003782477.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
ref|XP_008574309.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_007075876.1|  PREDICTED: V-type proton ATPase subunit C 1        112   5e-25    
ref|XP_006192890.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   5e-25    
ref|XP_005879352.1|  PREDICTED: V-type proton ATPase subunit C 1        112   6e-25    
ref|XP_006916693.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   6e-25    
gb|ELW68408.1|  V-type proton ATPase subunit C 1                        111   6e-25    
gb|KFW95221.1|  V-type proton ATPase subunit C 1                        112   6e-25    
ref|XP_004275371.1|  PREDICTED: V-type proton ATPase subunit C 1        112   6e-25    
ref|XP_008500896.1|  PREDICTED: V-type proton ATPase subunit C 1        112   6e-25    
ref|XP_006897234.1|  PREDICTED: V-type proton ATPase subunit C 1-...    112   6e-25    
ref|XP_006830685.1|  PREDICTED: V-type proton ATPase subunit C 1        112   6e-25    
ref|XP_004370770.1|  PREDICTED: V-type proton ATPase subunit C 1        112   6e-25    
gb|EIE80207.1|  hypothetical protein RO3G_04912                         112   6e-25    
ref|XP_007932994.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    112   6e-25    
ref|NP_725565.3|  vacuolar H[+] ATPase 44kD subunit, isoform E          115   7e-25    
gb|EPB87134.1|  hypothetical protein HMPREF1544_06060                   112   7e-25    
ref|XP_004607741.1|  PREDICTED: V-type proton ATPase subunit C 1        112   7e-25    
ref|XP_003696475.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    113   7e-25    
ref|XP_003741777.1|  PREDICTED: V-type proton ATPase subunit C 1-...    112   8e-25    
gb|KFP07692.1|  V-type proton ATPase subunit C 1                        111   8e-25    
ref|XP_003408473.1|  PREDICTED: V-type proton ATPase subunit C 1        111   8e-25    
ref|XP_012039419.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    111   8e-25    
gb|AAV36859.1|  RE74713p                                                114   8e-25    
gb|EMP39278.1|  V-type proton ATPase subunit C 1                        113   9e-25    
ref|XP_004903962.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    111   1e-24    
emb|CDW54631.1|  V type proton ATPase subunit C                         111   1e-24    
ref|XP_006257984.1|  PREDICTED: V-type proton ATPase subunit C 2        111   1e-24    
dbj|BAH12829.1|  unnamed protein product                                110   1e-24    
gb|EJW79943.1|  V-ATPase subunit C family protein                       111   1e-24    
ref|XP_001899274.1|  V-ATPase subunit C family protein                  111   1e-24    
dbj|GAN10975.1|  ATPase V1 complex subunit C                            111   1e-24    
gb|KII64093.1|  V-type proton ATPase subunit C 1-A                      110   1e-24    
ref|XP_008115724.1|  PREDICTED: V-type proton ATPase subunit C 2        111   1e-24    
ref|XP_003480143.1|  PREDICTED: V-type proton ATPase subunit C 1        111   1e-24    
emb|CDQ00984.1|  Protein Bm13998, isoform h                             111   2e-24    
ref|XP_008528126.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   2e-24    
ref|XP_007933285.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   2e-24    
ref|XP_008528125.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   2e-24    
emb|CEP11726.1|  hypothetical protein                                   110   2e-24    
gb|AEZ56896.1|  ATPase H+ transporting lysosomal V1 subunit C           109   2e-24    
ref|XP_007427660.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    110   2e-24    
ref|XP_009556284.1|  PREDICTED: V-type proton ATPase subunit C 1        110   2e-24    
ref|XP_010139291.1|  PREDICTED: V-type proton ATPase subunit C 1        110   2e-24    
gb|KFO92741.1|  V-type proton ATPase subunit C 1                        110   2e-24    
ref|XP_004582658.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   2e-24    
ref|XP_009321363.1|  PREDICTED: V-type proton ATPase subunit C 1        110   2e-24    
gb|KFW66441.1|  V-type proton ATPase subunit C 1                        110   2e-24    
gb|KFO74013.1|  V-type proton ATPase subunit C 1                        110   2e-24    
ref|XP_006760332.1|  PREDICTED: V-type proton ATPase subunit C 1        110   2e-24    
ref|XP_005327420.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   2e-24    
ref|XP_004665751.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   2e-24    
ref|XP_001505940.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   2e-24    
ref|XP_010980173.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    110   3e-24    
ref|XP_009029568.1|  hypothetical protein HELRODRAFT_103807             110   3e-24    
ref|XP_010734712.1|  PREDICTED: V-type proton ATPase subunit C 1-...    108   3e-24    
ref|XP_008493333.1|  PREDICTED: V-type proton ATPase subunit C 2        110   3e-24    
ref|XP_005293177.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   3e-24    
ref|XP_004310309.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    110   3e-24    
ref|XP_001503588.2|  PREDICTED: V-type proton ATPase subunit C 2 ...    109   3e-24    
gb|ELK13979.1|  V-type proton ATPase subunit C 2                        109   4e-24    
ref|XP_010627354.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    109   4e-24    
ref|XP_004887051.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    109   4e-24    
ref|XP_005655333.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    109   4e-24    
ref|XP_009068581.1|  PREDICTED: V-type proton ATPase subunit C 2        109   4e-24    
gb|EPY75601.1|  V-type proton ATPase subunit C 2 isoform 1              109   4e-24    
ref|XP_002196413.1|  PREDICTED: V-type proton ATPase subunit C 2        109   4e-24    
ref|XP_006191924.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    109   5e-24    
ref|XP_005487252.1|  PREDICTED: V-type proton ATPase subunit C 2        109   5e-24    
ref|XP_009489937.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    106   5e-24    
ref|XP_011363427.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    109   6e-24    
ref|XP_006910296.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    109   6e-24    
ref|XP_007053234.1|  PREDICTED: V-type proton ATPase subunit C 2        108   7e-24    
ref|XP_005404477.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    108   7e-24    
gb|EPY53191.1|  V-type ATPase V1 subunit C                              108   8e-24    
ref|XP_009898136.1|  PREDICTED: V-type proton ATPase subunit C 2        108   8e-24    
ref|XP_005717787.1|  V-type ATP synthase, Subunit V1C                   108   9e-24    
ref|XP_009702306.1|  PREDICTED: V-type proton ATPase subunit C 2        108   9e-24    
ref|XP_006869522.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    108   9e-24    
ref|XP_005084999.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    108   1e-23    
gb|KHJ99251.1|  v-ATPase subunit C                                      108   1e-23    
ref|XP_003501279.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    108   1e-23    
ref|XP_008063729.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    108   1e-23    
ref|XP_008570352.1|  PREDICTED: V-type proton ATPase subunit C 2        108   1e-23    



>dbj|BAO57286.1| V-type proton ATPase subunit [Ipomoea nil]
Length=376

 Score =   335 bits (858),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH
Sbjct  200  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVLSPSVKSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV
Sbjct  320  VVLSPSVKSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  376



>ref|XP_009786911.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana sylvestris]
Length=376

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE LT+YVVPRSSK LYEDNEYALYTVTLF RDADNF+IKARERGFQIRDFE+NPET 
Sbjct  200  SSYENLTTYVVPRSSKMLYEDNEYALYTVTLFNRDADNFKIKARERGFQIRDFEHNPETQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS KSEK+VRSILESLCDSSNS +WK+EDEG +  FGGD+E HPYVSFTINLV
Sbjct  320  VVLAPSTKSEKKVRSILESLCDSSNSNFWKSEDEGGMAGFGGDSEAHPYVSFTINLV  376



>ref|XP_009618992.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana tomentosiformis]
Length=376

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE LT+YVVPRSSK LYEDNEYALYTVTLF RDADNF+IKARERGFQIRDFE+NP+T 
Sbjct  200  SSYENLTTYVVPRSSKMLYEDNEYALYTVTLFNRDADNFKIKARERGFQIRDFEHNPDTQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            VVL+PS KSEK+VRSILESLCDSSNS +WK+EDEG +  FGGDAE HPYVSFTINL
Sbjct  320  VVLAPSTKSEKKVRSILESLCDSSNSNFWKSEDEGGMAGFGGDAEAHPYVSFTINL  375



>ref|XP_006363973.1| PREDICTED: V-type proton ATPase subunit C-like [Solanum tuberosum]
Length=376

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSK L+EDNEYALYTVTLF RDADNF+IKARERGFQIRDFE+NPET 
Sbjct  200  SSYETLTTYVVPRSSKMLFEDNEYALYTVTLFNRDADNFKIKARERGFQIRDFEHNPETQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS+KSEK+VRSILESLCDSSNS +WK +DEG +  FGGD E HPYVSFTINLV
Sbjct  320  VVLAPSIKSEKKVRSILESLCDSSNSNFWKADDEGGMAGFGGDTEAHPYVSFTINLV  376



>ref|XP_004235295.1| PREDICTED: V-type proton ATPase subunit C [Solanum lycopersicum]
Length=376

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSK LYEDNEYALYTVTLF RDADNF+ KARERGFQIRDFE+NPET 
Sbjct  200  SSYETLTTYVVPRSSKMLYEDNEYALYTVTLFNRDADNFKNKARERGFQIRDFEHNPETQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS+KSEK+VRSILESLCDSSNS +WK +DEG +  FGGD E HPYVSFTINLV
Sbjct  320  VVLAPSIKSEKKVRSILESLCDSSNSNFWKADDEGGMAGFGGDTEAHPYVSFTINLV  376



>emb|CDP15722.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   296 bits (759),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETL++YVVPRSSKKLYEDNEYALYTV LF+RDADNFR KARER FQIRDFEYN ET 
Sbjct  200  ASYETLSTYVVPRSSKKLYEDNEYALYTVILFSRDADNFRTKARERAFQIRDFEYNSETQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLMQDQE FRSSLLQWCYTSYGEVF SWMHFCAVR+FAESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLMQDQERFRSSLLQWCYTSYGEVFISWMHFCAVRIFAESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VLSPSVKSEK+VRSILE LCDSSNSTYWKTEDEG +  FG DA+ HPYVSFTINL+
Sbjct  320  AVLSPSVKSEKKVRSILEGLCDSSNSTYWKTEDEGPLSGFGADADAHPYVSFTINLI  376



>ref|XP_011073132.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF RDADNFR KARER FQIRDFEYNPET 
Sbjct  200  SSYETLTTYVVPRSSKKLHEDNEYALYTVTLFIRDADNFRTKARERNFQIRDFEYNPETQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL QDQET RSSLLQWCYTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLNQDQETLRSSLLQWCYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVLSP  KSEK+VR+ILE LC SSNSTYWKTEDEG +G F GD + HPYVSFTINL+
Sbjct  320  VVLSPPTKSEKKVRNILEGLCSSSNSTYWKTEDEGGMGGFAGDTDAHPYVSFTINLI  376



>ref|XP_011083360.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF+RDADNFR KARE+ FQ+RDFEYNPET 
Sbjct  200  SSYETLTTYVVPRSSKKLHEDNEYALYTVTLFSRDADNFRTKAREKNFQVRDFEYNPETQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQET RSSLLQWCYTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLS
Sbjct  260  ESRKQELEKLIQDQETLRSSLLQWCYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLS  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVLSPSVKSEK+VRSILE L DSS+STYWKT+DEG +G F GDA+ HPYV FTINL+
Sbjct  320  VVLSPSVKSEKKVRSILEGLSDSSHSTYWKTDDEGGMGGFAGDADAHPYVCFTINLI  376



>gb|EYU24479.1| hypothetical protein MIMGU_mgv1a006812mg [Erythranthe guttata]
Length=430

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT++VVPRSSKKL+EDNEYAL+TVTLF+RDADNFR KARER FQIRDFEYN ET 
Sbjct  254  SSYETLTTFVVPRSSKKLHEDNEYALFTVTLFSRDADNFRTKARERSFQIRDFEYNSETQ  313

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLMQDQE+ R+SLLQWCYTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLS
Sbjct  314  ESRKQELEKLMQDQESLRNSLLQWCYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLS  373

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS+KSEK+VRSILE LC SSNSTYWK EDE  +G FGGD++ HPYVSFT+NLV
Sbjct  374  VVLAPSLKSEKKVRSILEGLCTSSNSTYWKGEDEVGMGGFGGDSDAHPYVSFTVNLV  430



>gb|KJB40644.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=261

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  
Sbjct  84   SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQ  143

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  144  ESRKQELEKLVQDQDSLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLA  203

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             VLSPS K EK+VRSILE LCDS+NSTYWKTEDE GA+   GGDA+ +PYVSFTIN+
Sbjct  204  CVLSPSTKGEKKVRSILEGLCDSTNSTYWKTEDEGGAMAGLGGDADTYPYVSFTINI  260



>ref|XP_007031994.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
 gb|EOY02920.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
Length=375

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  
Sbjct  198  SSYETLTSYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ++ RSSLLQWCY SYGEVFSSWMHFCAVRVF+ESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLIQDQDSLRSSLLQWCYASYGEVFSSWMHFCAVRVFSESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             VL+PSVK EK+VRSILE LCDS+NSTYWKTEDE GA+   GGDA+ HPYVSFTIN+
Sbjct  318  CVLAPSVKGEKKVRSILEGLCDSTNSTYWKTEDESGAMAGLGGDADAHPYVSFTINI  374



>gb|KJB40648.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=375

 Score =   283 bits (724),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQDSLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             VLSPS K EK+VRSILE LCDS+NSTYWKTEDE GA+   GGDA+ +PYVSFTIN+
Sbjct  318  CVLSPSTKGEKKVRSILEGLCDSTNSTYWKTEDEGGAMAGLGGDADTYPYVSFTINI  374



>gb|KJB76316.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=352

 Score =   281 bits (718),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  
Sbjct  175  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQ  234

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  235  ESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  294

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             VLSPSVK EK+VRSILE LCDS+NSTYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  295  CVLSPSVKGEKKVRSILEGLCDSANSTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  351



>gb|KJB76315.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76318.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76321.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=375

 Score =   281 bits (718),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             VLSPSVK EK+VRSILE LCDS+NSTYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  318  CVLSPSVKGEKKVRSILEGLCDSANSTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  374



>ref|XP_010249179.1| PREDICTED: V-type proton ATPase subunit C-like [Nelumbo nucifera]
Length=375

 Score =   280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSKKL+EDNEYALY VTLF R ADNF+  ARERGFQIR+FEY+PET 
Sbjct  200  SSYETLTSYVVPRSSKKLHEDNEYALYNVTLFGRVADNFKTSARERGFQIREFEYSPETQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRK+ELEKLMQDQET R SLL WCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  260  ESRKRELEKLMQDQETLRGSLLLWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS K+EK+VRSILE LCDS++STYWK+EDEG VG  GGDA+ HPYVSFTIN++
Sbjct  320  TVLAPSTKNEKKVRSILEGLCDSTHSTYWKSEDEGVVG-LGGDADSHPYVSFTINII  375



>ref|XP_012067332.1| PREDICTED: V-type proton ATPase subunit C [Jatropha curcas]
 gb|KDP41839.1| hypothetical protein JCGZ_26857 [Jatropha curcas]
Length=376

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 159/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  
Sbjct  198  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFRRVADNFRTSAREKGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E RKQELEKLMQDQE+ RSSLLQW YTSYGEVFSSWMHFCAVRVF+ESILRYGLPPSFLS
Sbjct  258  EGRKQELEKLMQDQESLRSSLLQWSYTSYGEVFSSWMHFCAVRVFSESILRYGLPPSFLS  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VL+PS KSEK+VRSILE LCDS+NSTYWK+EDE  G + A GGDA  +PYVSFTINL
Sbjct  318  CVLAPSAKSEKKVRSILEGLCDSANSTYWKSEDEIGGGMAALGGDAGAYPYVSFTINL  375



>ref|XP_008231040.1| PREDICTED: V-type proton ATPase subunit C [Prunus mume]
Length=376

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQENLRSSLLQWCYASYGEVFSSWMHFCAVRIFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VL+P+ KSEK+VRSILE LCDS NST+WKT+DE  GA+   GGDA+ HPYVSFTINLV
Sbjct  318  CVLAPTTKSEKKVRSILEGLCDSGNSTFWKTDDEVGGAMAGLGGDADAHPYVSFTINLV  376



>ref|XP_002284444.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Vitis vinifera]
 emb|CBI15738.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YETL +YVVPRSSKKL+EDNEYALYTVT+F R ADNF+  ARERGFQIRDFEY+PET 
Sbjct  198  STYETLATYVVPRSSKKLHEDNEYALYTVTIFGRVADNFKTSARERGFQIRDFEYSPETQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKLM DQ+T R+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLS
Sbjct  258  ESRKQELEKLMLDQDTIRTSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLS  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PSVKSEK+ RSILE L DS+NSTYWK+EDE G +G+ GGDA+ HPYVSFTINLV
Sbjct  318  VVLAPSVKSEKKARSILEGLSDSANSTYWKSEDELGGMGSLGGDADSHPYVSFTINLV  375



>ref|XP_007151733.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
 gb|ESW23727.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
Length=376

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRS+ KLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PE+H
Sbjct  198  SSYETLTNYVVPRSANKLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPESH  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQEL+KL++DQE+ R+SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPPSFL+
Sbjct  258  ESRKQELDKLIEDQESLRASLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTINLV  285
             VL+PSVK+EK+VRSILE L DS+NS YWKTEDEG    G   GDA+ HPYVSFTINLV
Sbjct  318  SVLAPSVKAEKKVRSILEGLSDSTNSGYWKTEDEGVGMAGLVAGDADAHPYVSFTINLV  376



>ref|XP_002275510.1| PREDICTED: V-type proton ATPase subunit C [Vitis vinifera]
 emb|CBI21291.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YETLTSYVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+ E  
Sbjct  198  STYETLTSYVVPRSSKKLHEDNEYALYTVTLFHRVADNFRTNARERGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRK+ELEKLM+DQETFRS+LLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKEELEKLMRDQETFRSTLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
             VL+PSVKSEK+VRSILE LCDS+NS +WK+ED+ G +   GGDA+ HPYV FTINLV
Sbjct  318  CVLAPSVKSEKKVRSILEGLCDSTNSAFWKSEDDAGGMAGLGGDADAHPYVCFTINLV  375



>ref|XP_006599411.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN13381.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE LT+YVVPRSSKKLYEDNEYALYTVTLF+R ADNFR  ARE GFQIRDFEY+PE+H
Sbjct  198  SSYEILTNYVVPRSSKKLYEDNEYALYTVTLFSRVADNFRTSAREEGFQIRDFEYSPESH  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            +SRKQELEKL++DQE+ R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPPSFL+
Sbjct  258  DSRKQELEKLVEDQESLRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG-AVGAFGGDAEVHPYVSFTINLV  285
             VL+PSVK+EK+VRSILE L DSSNS YWKTEDEG  +    GDA+ HPYVSFTINLV
Sbjct  318  CVLAPSVKAEKKVRSILEGLSDSSNSAYWKTEDEGVGMAGLAGDADAHPYVSFTINLV  375



>ref|XP_007215551.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
 gb|EMJ16750.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
Length=376

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQENLRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VL+P+ KSEK+VRSILE LCDS NST+WKT+DE  G +    GDA+ HPYVSFTINLV
Sbjct  318  CVLAPTTKSEKKVRSILEGLCDSGNSTFWKTDDEVGGGMAGLAGDADAHPYVSFTINLV  376



>ref|XP_008362171.1| PREDICTED: V-type proton ATPase subunit C-like [Malus domestica]
Length=262

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  84   SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQ  143

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+
Sbjct  144  ESRKQELEKLVQDQENLRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPNFLA  203

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VLSP  K+EK+VRSILE LCDS NST+WK +DE  G V    GDA+ HPYVSFTINLV
Sbjct  204  CVLSPPTKAEKKVRSILEGLCDSGNSTFWKXDDEVGGGVPGLAGDADAHPYVSFTINLV  262



>gb|AIY85415.1| V-ATPase subunit C1 [Eriobotrya japonica]
Length=376

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+
Sbjct  258  ESRKQELEKLVQDQENLRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPNFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VL+P  K+EK+VRSILE LCDS NST+WKT+DE  G V    GDA+ HPYVSFTINLV
Sbjct  318  CVLAPPTKAEKKVRSILEGLCDSGNSTFWKTDDEVGGGVPGLAGDADAHPYVSFTINLV  376



>ref|XP_011045799.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Populus 
euphratica]
 ref|XP_011045800.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Populus 
euphratica]
Length=375

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  
Sbjct  198  ASYETLTNYVVPRSSKKLYEDNEYALYTVTLFKRVADNFRTNAREKGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELE+L++DQE  RSSLLQWCYTSYGEVFSSWMHFCA+RVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELERLVRDQENLRSSLLQWCYTSYGEVFSSWMHFCAIRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
             VLSP+ KSEK+VRSILE  CD+SNST+WK+EDE G +   GGDA+ +PY SFTINLV
Sbjct  318  CVLSPTTKSEKKVRSILEGFCDNSNSTHWKSEDEMGGIFGLGGDADTYPYPSFTINLV  375



>ref|XP_003553974.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=377

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETH
Sbjct  199  SSYETLTNYVVPRSSKKLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETH  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  259  ENRKQELDKLVQDQERLRTSLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLA  318

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  288
             VL+PSVKSEK+VRSILE L DS+NS YWK EDE   G  G  GDA+ HPYVSFTINL
Sbjct  319  CVLAPSVKSEKKVRSILEGLSDSTNSAYWKNEDEVGAGMAGLAGDADGHPYVSFTINL  376



>ref|XP_006446960.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446961.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446962.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006468875.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468876.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Citrus 
sinensis]
 ref|XP_006468877.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Citrus 
sinensis]
 gb|ESR60200.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60201.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60202.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|KDO47360.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47361.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47362.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=375

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSK LYEDNEYALYTVTLF R ADNFRI ARE+GFQIRDFEY+ E  
Sbjct  198  ASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESR QELEKL+ DQE+ RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRNQELEKLVHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGA-FGGDAEVHPYVSFTINLV  285
             VL+PSVK EK+VRSILE LC ++NST+WK+ED+G + A  GGDA+ HPYVSFTINLV
Sbjct  318  CVLAPSVKGEKKVRSILEELCGNANSTFWKSEDDGGMMAGLGGDADSHPYVSFTINLV  375



>gb|ABH07428.1| vacuolar H+-ATPase subunit C [Gossypium hirsutum]
Length=377

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 155/179 (87%), Gaps = 3/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYT TLF R ADNFR  ARERGFQ+RDFEY+PE  
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTATLFGRVADNFRTSARERGFQVRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfl-  459
            ESRKQELEKL+QDQ   RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPS   
Sbjct  258  ESRKQELEKLVQDQYMLRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSPSF  317

Query  458  -svvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             + VLSPSVK EK+VRSILE LCDS+NSTYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  318  LACVLSPSVKGEKKVRSILEGLCDSANSTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  376



>ref|XP_003548919.2| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=384

 Score =   273 bits (698),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETL +YVVPRSSKKLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETH
Sbjct  206  SSYETLINYVVPRSSKKLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETH  265

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  266  ENRKQELDKLVQDQERLRASLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLA  325

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  288
             VL+PSVKSEK+VRSILE L DS+NS YWKTEDE   G  G  GDA+ HPYVSFTIN+
Sbjct  326  CVLAPSVKSEKKVRSILEGLTDSTNSAYWKTEDEVGAGMAGLAGDADAHPYVSFTINV  383



>ref|XP_011468207.1| PREDICTED: V-type proton ATPase subunit C [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSKKL+EDNEYALY+VTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTSYVVPRSSKKLFEDNEYALYSVTLFGRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQENLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VL+P  KSEK+VRSILE LCDSSNS +WKTEDE  GA+    GDA+ HPYVSF INLV
Sbjct  318  CVLAPVTKSEKKVRSILEGLCDSSNS-FWKTEDEVGGAMAGLAGDADAHPYVSFNINLV  375



>ref|XP_003624472.1| V-type proton ATPase subunit C [Medicago truncatula]
 gb|AES80690.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=378

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETHE
Sbjct  201  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETHE  260

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
             RKQEL+KLMQDQE+ R SLLQWCY SYGEVFSSWMHFCAVR+F+ESILRYGLPPSFL+ 
Sbjct  261  GRKQELDKLMQDQESLRGSLLQWCYASYGEVFSSWMHFCAVRLFSESILRYGLPPSFLAC  320

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINLV  285
            VL+PSVK+EK+VRSILE L DSSNS YWKT++E   G  G  G+A+ HPYVSFTINL+
Sbjct  321  VLAPSVKAEKKVRSILEGLSDSSNSAYWKTDEEVGAGMAGLAGEADTHPYVSFTINLL  378



>ref|XP_009378027.1| PREDICTED: V-type proton ATPase subunit C [Pyrus x bretschneideri]
Length=376

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R SLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+
Sbjct  258  ESRKQELEKLVQDQENLRGSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPNFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VL+P  K+EK+VRSILE LCDS NST+WKT+DE  G V    GD + HPYVSFTINLV
Sbjct  318  CVLAPPTKAEKKVRSILEGLCDSGNSTFWKTDDEVGGGVPGLAGDVDAHPYVSFTINLV  376



>dbj|BAE98945.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
Length=263

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETLT YVVPRSSKKL+EDNEYALYTVTLFTR ADNFRI ARE+GFQ+RDFE + E  E+
Sbjct  88   YETLTDYVVPRSSKKLFEDNEYALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEAQET  147

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
            RKQEL KL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR FAESI+RYGLPP+FL+ V
Sbjct  148  RKQELAKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRTFAESIMRYGLPPAFLACV  207

Query  449  lspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            LSP+VKSEK+VRSILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  208  LSPAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  262



>ref|XP_010066422.1| PREDICTED: V-type proton ATPase subunit C [Eucalyptus grandis]
Length=378

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSK+L+EDNEYALYTVTLF+R ADNFR  ARERGFQIRDFEYN E  
Sbjct  201  SSYETLTSYVVPRSSKQLHEDNEYALYTVTLFSRVADNFRTTARERGFQIRDFEYNLEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E RKQELE+LM+DQE FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  261  EGRKQELERLMRDQENFRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             VL+PSVK EK+VRSILE LCD+++S YWK  ED G +   GGDA+ HPYVSFTIN+
Sbjct  321  CVLAPSVKGEKKVRSILEGLCDNTHSAYWKPEEDAGGMAGLGGDADTHPYVSFTINI  377



>ref|XP_010925033.1| PREDICTED: V-type proton ATPase subunit C-like [Elaeis guineensis]
Length=374

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRS+KKL+EDNEYALYTVTLF R ADNF+  ARERGFQIR+FEY+PE  
Sbjct  198  SSYETLTTYVVPRSTKKLHEDNEYALYTVTLFGRVADNFKTSARERGFQIREFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLLQDQENIRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS K EK+VRSILE LC + NST+WK+EDE  +   GG+AE +PYVSFTIN+V
Sbjct  318  AVLAPSAKGEKKVRSILEELCGNVNSTFWKSEDEVGLAGLGGEAEAYPYVSFTINIV  374



>ref|XP_008379060.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C [Malus domestica]
Length=376

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALY+VTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYSVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R+SLLQWCY SYGEVFSSWMHFCAVR FAESILRYGLPP+FL+
Sbjct  258  ESRKQELEKLVQDQENLRASLLQWCYXSYGEVFSSWMHFCAVRDFAESILRYGLPPNFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VL+P+ K+EK+VRSILE LCDS NST+WKT+DE  G V    GDA+ HPYVSFTINLV
Sbjct  318  CVLAPTTKAEKKVRSILEGLCDSGNSTFWKTDDEAGGGVPGLAGDADAHPYVSFTINLV  376



>ref|XP_006417188.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
 gb|ESQ35541.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
Length=375

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT YVVPRSSK+L+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  
Sbjct  198  ACYETLTEYVVPRSSKRLFEDNEYALYTVTLFTRVADNFRTSAREKGFQVRDFEHSAEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             VLSP VKSEK+VRSILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  318  CVLSPVVKSEKKVRSILERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>ref|NP_563916.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
 sp|Q9SDS7.1|VATC_ARATH RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar H(+)-ATPase subunit C; AltName: 
Full=Vacuolar proton pump subunit C [Arabidopsis thaliana]
 gb|AAF20146.1|AF208261_1 vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAF78489.1|AC012187_9 Identical to vacuolar ATP sythase subunit C (DET3) from Arabidopsis 
thaliana gb|AF208261. ESTs gb|AA067533, gb|Z37481, gb|AA721838, 
gb|Z37180, gb|T21206 come from this gene [Arabidopsis 
thaliana]
 gb|AAG50103.1|AF334725_1 putative vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAL24354.1| Identical to vacuolar ATP sythase subunit C (DET3) [Arabidopsis 
thaliana]
 gb|AAM13333.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
 dbj|BAH30291.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28936.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
Length=375

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT YVVPRSSKKL+EDNEYALYTVTLFTR ADNFRI ARE+GFQ+RDFE + E  
Sbjct  198  ACYETLTDYVVPRSSKKLFEDNEYALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQEL KL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELAKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRTFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>emb|CDY19421.1| BnaC05g09300D [Brassica napus]
Length=377

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT +VVPRSSKKL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  
Sbjct  200  ACYETLTDFVVPRSSKKLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  260  ETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  320  CVLSPAVKSEKKVRSILERLCDSTNSGYWKSEEDAGAMAGLAGDSETHPYVSFTINL  376



>ref|XP_010693540.1| PREDICTED: V-type proton ATPase subunit C [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT YVVPRSSKKLYEDNEYALYTVT+F+R ADNFR+KARERGFQIRDFE++PET 
Sbjct  198  SSYETLTDYVVPRSSKKLYEDNEYALYTVTMFSRVADNFRVKARERGFQIRDFEHDPETQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            +SRKQELEKL  DQET RS+LLQWCY+SYGEVFSSWMHFCAVRVF+ESILRYGLPP+FL+
Sbjct  258  DSRKQELEKLAHDQETMRSALLQWCYSSYGEVFSSWMHFCAVRVFSESILRYGLPPNFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS KSEK+VRSILE  C + NS +WK EDE GA+     +A+ HPYVSFTINLV
Sbjct  318  CVLAPSQKSEKKVRSILERNCTAGNSVHWKAEDEVGAMAGLAAEADPHPYVSFTINLV  375



>ref|XP_004493016.1| PREDICTED: V-type proton ATPase subunit C-like [Cicer arietinum]
Length=378

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSK+LYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETH
Sbjct  200  ASYETLTSYVVPRSSKQLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETH  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQEL+KLMQDQE+ R SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  260  ESRKQELDKLMQDQESLRGSLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLA  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VL+PSVK+EK+VRSILE L DSSNS YWKT+++  G +    GDA+ HPYVSFTINL+
Sbjct  320  CVLAPSVKAEKKVRSILEGLSDSSNSAYWKTDEDLGGGMAGLAGDADTHPYVSFTINLL  378



>ref|XP_010939209.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Elaeis 
guineensis]
Length=374

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRS+KKL+EDNEYALYTVTLF+R ADNF+  ARERGFQIR+FEY+PE  
Sbjct  198  SSYETLTTYVVPRSTKKLHEDNEYALYTVTLFSRVADNFKTSARERGFQIREFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFS+WMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLLQDQENMRSSLLQWCYASYGEVFSAWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+P  KSEK+VRSILE L  ++NS +WK+EDE ++   GG+AE +PYVSFTIN+V
Sbjct  318  AVLAPPAKSEKKVRSILEELSGNANSAFWKSEDEVSLAGIGGEAEAYPYVSFTINIV  374



>ref|XP_009148561.1| PREDICTED: V-type proton ATPase subunit C [Brassica rapa]
 emb|CDX98037.1| BnaA06g07880D [Brassica napus]
Length=375

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT +VVPRSSKKL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  
Sbjct  198  ACYETLTDFVVPRSSKKLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQEL+KL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELQKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSGYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_003518129.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN00618.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEY LYTVTLF+R ADNFR  ARE+GFQIRDFEY+ E++
Sbjct  198  SSYETLTNYVVPRSSKKLYEDNEYVLYTVTLFSRVADNFRTSAREKGFQIRDFEYSHESY  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            +SRKQELEKL++DQE+ RSSLLQWCY SYGEVFSSWMHFCAVRVF ESILRYGLPPSFL+
Sbjct  258  DSRKQELEKLVEDQESLRSSLLQWCYASYGEVFSSWMHFCAVRVFTESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG-AVGAFGGDAEVHPYVSFTINLV  285
             VL+PSVK+EK+VRSILE L  SSNS YWKTEDEG  +    GDA+ HPYVSFTINLV
Sbjct  318  CVLAPSVKAEKKVRSILEGLSGSSNSAYWKTEDEGVGMAGLAGDADAHPYVSFTINLV  375



>gb|KHM99227.1| V-type proton ATPase subunit C [Glycine soja]
Length=376

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETL +YV PRSSKKLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETH
Sbjct  199  SSYETLINYV-PRSSKKLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETH  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  258  ENRKQELDKLVQDQERLRASLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  288
             VL+PSVKSEK+VRSILE L DS+NS YWKTEDE   G  G  GDA+ HPYVSFTIN+
Sbjct  318  CVLAPSVKSEKKVRSILEGLTDSTNSAYWKTEDEVGAGMAGLAGDADAHPYVSFTINV  375



>ref|XP_009386009.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT++VVPRS+KKL+EDNEYALYTVTLF + ADNFR  ARE+GFQIR+FEY+PE  
Sbjct  200  SSYETLTTFVVPRSTKKLHEDNEYALYTVTLFQKVADNFRNNAREKGFQIREFEYSPEAQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE+ RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  260  ESRKQELEKLIQDQESKRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVL+P VKSEK+VR ILE LC + NS+YWK+EDE  +   GG+AE +PYVSFTINLV
Sbjct  320  VVLAPLVKSEKKVRGILEELCGNVNSSYWKSEDEIGLAGIGGEAEAYPYVSFTINLV  376



>emb|CDY16036.1| BnaC08g40870D [Brassica napus]
Length=474

 Score =   268 bits (686),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT +VVPRSSKKL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  
Sbjct  198  ACYETLTDFVVPRSSKKLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE  RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQENLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL  374



>gb|KEH23490.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=386

 Score =   265 bits (678),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 153/186 (82%), Gaps = 10/186 (5%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETHE
Sbjct  201  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETHE  260

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGl-------  474
             RKQEL+KLMQDQE+ R SLLQWCY SYGEVFSSWMHFCAVR+F+ESILRYGL       
Sbjct  261  GRKQELDKLMQDQESLRGSLLQWCYASYGEVFSSWMHFCAVRLFSESILRYGLPPSFLVL  320

Query  473  -ppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVS  303
                  + VL+PSVK+EK+VRSILE L DSSNS YWKT++E   G  G  G+A+ HPYVS
Sbjct  321  YSSRQEACVLAPSVKAEKKVRSILEGLSDSSNSAYWKTDEEVGAGMAGLAGEADTHPYVS  380

Query  302  FTINLV  285
            FTINL+
Sbjct  381  FTINLL  386



>ref|XP_008775427.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Phoenix 
dactylifera]
Length=374

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNF+  ARERGFQIR+FEY+PE+ 
Sbjct  198  SSYETLTTYVVPRSSKKLHEDNEYALYTVTLFGRVADNFKTSARERGFQIREFEYSPESQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE  RSSLLQWCY SYGEVFS+WMHFCAVR+FAESILRYGLPP+FL+
Sbjct  258  ENRKQELEKLLQDQENMRSSLLQWCYASYGEVFSAWMHFCAVRIFAESILRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+P  KSEK+VRSILE L  ++NS +WK+EDE  +   GG+AE +PYVSFTIN+V
Sbjct  318  AVLAPPAKSEKKVRSILEELGGNANSAFWKSEDEVGLAGIGGEAEAYPYVSFTINIV  374



>ref|XP_008808181.1| PREDICTED: V-type proton ATPase subunit C-like [Phoenix dactylifera]
Length=374

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRS+KKL+EDNEYALYTVTLF R ADNF+  ARERGFQIR+FEY+PE  
Sbjct  198  SSYETLTTYVVPRSTKKLHEDNEYALYTVTLFVRVADNFKTSARERGFQIREFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ES K ELEKL+QDQE  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPP FL+
Sbjct  258  ESWKLELEKLLQDQENIRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPLFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS K EK+VRSILE LC + NST+WK+EDE  +   GG+AE +PYVSFTIN+V
Sbjct  318  AVLAPSAKGEKKVRSILEELCGNVNSTFWKSEDEVGLAGLGGEAEAYPYVSFTINIV  374



>ref|XP_004977299.1| PREDICTED: V-type proton ATPase subunit C-like [Setaria italica]
Length=377

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALY+VTLF +  DNF+++ARE+GFQ+RDFEY+PE  
Sbjct  201  SSYESLDTFVVPRSSKKLYEDNEYALYSVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE+EKL+QDQE  RSSLLQWCY SY EVFSSWMHFCAVR+F ESILRYGLPPSFLS
Sbjct  261  ESRKQEMEKLLQDQEAMRSSLLQWCYASYSEVFSSWMHFCAVRIFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS KSEK+VRSILE LC +++STYWK+ED+ +V   GG++E+HPYVSFTIN+V
Sbjct  321  AVLAPSTKSEKKVRSILEELCGNAHSTYWKSEDDVSVAGLGGESELHPYVSFTINIV  377



>gb|KHN28568.1| V-type proton ATPase subunit C [Glycine soja]
Length=383

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 159/184 (86%), Gaps = 8/184 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF+R ADNFR  ARE+GFQIRDFEY+PETH
Sbjct  199  SSYETLTNYVVPRSSKKLYEDNEYALYTVTLFSRVADNFRTSAREKGFQIRDFEYSPETH  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQEL+KL+QDQE  R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  259  ENRKQELDKLVQDQERLRTSLLQWCYTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLA  318

Query  455  vvlspsvkSEKRVRSILESLCDSSN------STYWKTEDEGAVGAFG--GDAEVHPYVSF  300
             VL+PSVKSEK+VRSILE L DS+N        YWK EDE   G  G  GDA+ HPYVSF
Sbjct  319  CVLAPSVKSEKKVRSILEGLSDSTNRQVYDVRAYWKNEDEVGAGMAGLAGDADGHPYVSF  378

Query  299  TINL  288
            TINL
Sbjct  379  TINL  382



>gb|ABD32569.1| V-ATPase subunit C [Medicago truncatula]
Length=382

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 157/182 (86%), Gaps = 6/182 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PETHE
Sbjct  201  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPETHE  260

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
             RKQEL+KLMQDQE+ R SLLQWCY SYGEVFSSWMHFCAVR+F+ESILRYGLPPSFL+ 
Sbjct  261  GRKQELDKLMQDQESLRGSLLQWCYASYGEVFSSWMHFCAVRLFSESILRYGLPPSFLAC  320

Query  452  vlspsvkSEKRVRSILESLCDSSNS----TYWKTEDEGAVGAFG--GDAEVHPYVSFTIN  291
            VL+PSVK+EK+VRSILE L DSSN      YWKT++E   G  G  G+A+ HPYVSFTIN
Sbjct  321  VLAPSVKAEKKVRSILEGLSDSSNRQLGIAYWKTDEEVGAGMAGLAGEADTHPYVSFTIN  380

Query  290  LV  285
            L+
Sbjct  381  LL  382



>gb|KGN50885.1| hypothetical protein Csa_5G312840 [Cucumis sativus]
Length=370

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 159/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNF+  ARE+GFQIR+FEY+PE  
Sbjct  192  SSYETLTSYVVPRSSKKLYEDNEYALYTVTLFNRVADNFKTSAREKGFQIREFEYSPEAQ  251

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE+FRSSLLQW Y SY EVF SWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  252  ESRKQELEKLVQDQESFRSSLLQWSYASYAEVFISWMHFCAVRVFAESILRYGLPPSFLA  311

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VL+PSVKSEK+VRSILE LCDS+NSTYWKTEDE  G +   GGD++ HPYVSFTINL
Sbjct  312  SVLAPSVKSEKKVRSILEGLCDSANSTYWKTEDEVGGGMAGLGGDSDAHPYVSFTINL  369



>ref|XP_009395792.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT++VVPRS+KKL+EDNEYALYTVTLF + ADNFR  ARE+GFQIR+FEY+PE  
Sbjct  198  SSYETLTTFVVPRSAKKLHEDNEYALYTVTLFRKVADNFRNNAREKGFQIREFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE EKL+QDQE+ R SLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPP FL+
Sbjct  258  ESRKQEFEKLIQDQESKRRSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPQFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PSVK+EK+VR ILE LC + NS+YWK+EDE  +   GG+AE HPYVSFTINLV
Sbjct  318  VVLAPSVKNEKKVRGILEELCGNVNSSYWKSEDEVGLAGIGGEAEAHPYVSFTINLV  374



>ref|XP_002512862.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
 gb|EEF49365.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
Length=376

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 161/178 (90%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  
Sbjct  198  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELE+LMQDQE+FRSSLLQWCYTSYGEVFSSWMHFCAVRVF ESILRYGLPP+FL+
Sbjct  258  ENRKQELEQLMQDQESFRSSLLQWCYTSYGEVFSSWMHFCAVRVFTESILRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VL+PSVK EK+VRSILE L DS+NSTYWK+EDE  G + A GGDA+ HPYVSFTINL
Sbjct  318  CVLAPSVKGEKKVRSILEGLSDSANSTYWKSEDEVGGGLAALGGDADAHPYVSFTINL  375



>ref|XP_011045798.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 159/192 (83%), Gaps = 15/192 (8%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKAR--------------ER  678
            ASYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  AR              E+
Sbjct  198  ASYETLTNYVVPRSSKKLYEDNEYALYTVTLFKRVADNFRTNARVFKRVADNFRTNAREK  257

Query  677  GFQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFA  498
            GFQIRDFEY+PE  ESRKQELE+L++DQE  RSSLLQWCYTSYGEVFSSWMHFCA+RVFA
Sbjct  258  GFQIRDFEYSPEAQESRKQELERLVRDQENLRSSLLQWCYTSYGEVFSSWMHFCAIRVFA  317

Query  497  ESILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAE  321
            ESILRYGLPPSFL+ VLSP+ KSEK+VRSILE  CD+SNST+WK+EDE G +   GGDA+
Sbjct  318  ESILRYGLPPSFLACVLSPTTKSEKKVRSILEGFCDNSNSTHWKSEDEMGGIFGLGGDAD  377

Query  320  VHPYVSFTINLV  285
             +PY SFTINLV
Sbjct  378  TYPYPSFTINLV  389



>ref|NP_001141160.1| hypothetical protein [Zea mays]
 gb|ACF84813.1| unknown [Zea mays]
 gb|ACF85584.1| unknown [Zea mays]
 gb|ACN29201.1| unknown [Zea mays]
 gb|AFW81324.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
 gb|AFW81325.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=200

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE + ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  
Sbjct  24   SSYEKIDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQ  83

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS
Sbjct  84   ESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLS  143

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS KSEK+VRSILE LC +++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  144  AVLAPSTKSEKKVRSILEELCGNAHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  200



>ref|XP_004150739.1| PREDICTED: V-type proton ATPase subunit C [Cucumis sativus]
Length=376

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 159/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNF+  ARE+GFQIR+FEY+PE  
Sbjct  198  SSYETLTSYVVPRSSKKLYEDNEYALYTVTLFNRVADNFKTSAREKGFQIREFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE+FRSSLLQW Y SY EVF SWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQESFRSSLLQWSYASYAEVFISWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VL+PSVKSEK+VRSILE LCDS+NSTYWKTEDE  G +   GGD++ HPYVSFTINL
Sbjct  318  SVLAPSVKSEKKVRSILEGLCDSANSTYWKTEDEVGGGMAGLGGDSDAHPYVSFTINL  375



>gb|AFW81322.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
 gb|AFW81323.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=260

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE + ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  
Sbjct  84   SSYEKIDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQ  143

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS
Sbjct  144  ESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLS  203

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS KSEK+VRSILE LC +++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  204  AVLAPSTKSEKKVRSILEELCGNAHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  260



>ref|XP_007161646.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
 gb|ESW33640.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
Length=376

 Score =   263 bits (671),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 158/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT YVVPRSSKKLYEDNEYALYTVTLF+R  +N+R  ARE+GFQIRDFEY+ ETH
Sbjct  198  SSYETLTDYVVPRSSKKLYEDNEYALYTVTLFSRVVENYRTSAREKGFQIRDFEYSQETH  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQEL+KL+QDQE  R+SLLQWC+TSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL+
Sbjct  258  ENRKQELDKLVQDQERLRASLLQWCFTSYGEVFSSWMHFCAVRLFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG--GDAEVHPYVSFTINL  288
             VL+PSVKSEK+VRSILE+L DS+NS YWK EDE   G  G  GD++ HPYVSFTINL
Sbjct  318  CVLAPSVKSEKKVRSILEALSDSTNSAYWKIEDEVGAGMAGLAGDSDAHPYVSFTINL  375



>ref|XP_008463120.1| PREDICTED: V-type proton ATPase subunit C [Cucumis melo]
Length=376

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 159/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNF+  ARE+GFQIR+FEY+PE  
Sbjct  198  SSYETLTSYVVPRSSKKLYEDNEYALYTVTLFNRVADNFKTSAREKGFQIREFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE+FRSSLLQW Y SY EVF SWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQESFRSSLLQWSYASYAEVFISWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VL+PSVKSEK+VRSILE LCDS+NSTYWKTEDE  G +   GGD++ HPYVSFTINL
Sbjct  318  FVLAPSVKSEKKVRSILEGLCDSANSTYWKTEDEVGGGMAGLGGDSDAHPYVSFTINL  375



>gb|KHG11234.1| V-type proton ATPase subunit C -like protein [Gossypium arboreum]
Length=328

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 152/177 (86%), Gaps = 8/177 (5%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  
Sbjct  158  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQ  217

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  218  ESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  277

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             VLSPSVK EK+VRSILE        TYWKTEDE GA+   GGD + HPYVSFTIN+
Sbjct  278  CVLSPSVKGEKKVRSILE-------GTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI  327



>ref|XP_010096044.1| V-type proton ATPase subunit C [Morus notabilis]
 gb|EXB62850.1| V-type proton ATPase subunit C [Morus notabilis]
Length=384

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 157/187 (84%), Gaps = 10/187 (5%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRS+K LYEDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTSYVVPRSTKMLYEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKLM DQE+ RSSLLQWCYTSYGEVFSSWMHFCAVRVFAES+LRYGLPPSFLS
Sbjct  258  ETRKQELEKLMHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESVLRYGLPPSFLS  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNS--------TYWKTEDEGAVGAFG--GDAEVHPYV  306
             VL+PSVK EK+VRSILE LCD++N         T+WKT+DE   G  G  G+A+ HPYV
Sbjct  318  CVLAPSVKREKKVRSILEGLCDNANRQVVELLSVTFWKTDDEAGGGIVGLTGEADAHPYV  377

Query  305  SFTINLV  285
            SFTINLV
Sbjct  378  SFTINLV  384



>ref|XP_010476263.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYE  T YVVPRSSK L+EDNEYALYTV LFTR ADNFR  ARERGFQ+RDFE++ E  E
Sbjct  199  SYEKFTEYVVPRSSKLLFEDNEYALYTVVLFTRVADNFRTTARERGFQVRDFEHSVEAQE  258

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            +RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ 
Sbjct  259  TRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLAC  318

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            VLSP+VKSEK+VR ILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  319  VLSPAVKSEKKVRPILERLCDSTNSLYWKSEEDGGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_002441755.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
 gb|EES15593.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
Length=377

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSK+LYEDNEYALYTVTLF +  DNF+++ARE+GFQIRDFEY+PE  
Sbjct  201  SSYESLDTFVVPRSSKQLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQIRDFEYSPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE+EKL+QDQE  R+SLLQWCY SY EVFSSWMHFCAVR+F ESILRYGLPPSFLS
Sbjct  261  ESRKQEMEKLLQDQEAMRTSLLQWCYASYSEVFSSWMHFCAVRIFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS K EK+VRSILE LC + +S YWK ED+ AV   GG++EVHPYVSFT+N V
Sbjct  321  AVLAPSTKGEKKVRSILEELCGNVHSIYWKAEDDVAVAGLGGESEVHPYVSFTVNFV  377



>ref|XP_010250562.1| PREDICTED: V-type proton ATPase subunit C [Nelumbo nucifera]
Length=376

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE LT+YVVPRSSKKL+EDNEYALYTV LF   ADNF+   RE+GFQIR+FEY+PE  
Sbjct  200  SSYEKLTNYVVPRSSKKLHEDNEYALYTVMLFGHVADNFKTSTREKGFQIREFEYSPEAQ  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E R +E+E+LM+DQET R SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPP FL+
Sbjct  260  EGRNREMERLMEDQETLRGSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPLFLA  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS+KSEK+ RSILE LCDS++S+YWK+EDEG +   G DA+ HPYVSFTIN+V
Sbjct  320  AVLAPSIKSEKKARSILEGLCDSTHSSYWKSEDEGGMAGLGCDADAHPYVSFTINIV  376



>ref|XP_002441624.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
 gb|EES20054.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
Length=377

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETL ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  
Sbjct  201  SSYETLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS
Sbjct  261  ESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS KSEK+VRSILE LC +++S YWK+ED+  +   GG+ E HPYVSFTIN V
Sbjct  321  AVLAPSTKSEKKVRSILEELCGNAHSLYWKSEDDVGIAGLGGETEAHPYVSFTINFV  377



>ref|XP_006844509.1| PREDICTED: V-type proton ATPase subunit C [Amborella trichopoda]
 gb|ERN06184.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
Length=374

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT++VVPRSSKKLYEDNEYALYTV LF + ADNFRI ARERGFQIRDFEY+PE  
Sbjct  198  SSYETLTTFVVPRSSKKLYEDNEYALYTVILFRKVADNFRISARERGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            + R+QELEKL+QDQET   SLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  DKRQQELEKLLQDQETMSHSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+P  KSEK+VRSILE  C S NS  WK+EDEG +    G+A+ +PYVSFTINL+
Sbjct  318  AVLAPPTKSEKKVRSILEGHCGSRNSALWKSEDEGGLLGLVGEADAYPYVSFTINLI  374



>ref|XP_006305100.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
 gb|EOA37998.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
Length=375

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YET T YVVPRSSK L+EDNEYALYTV LFTR ADNFR  ARE+GFQ+RDFE++ E  E
Sbjct  199  NYETFTEYVVPRSSKHLFEDNEYALYTVVLFTRVADNFRTTAREKGFQVRDFEHSVEAQE  258

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            +RKQELEKL QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ 
Sbjct  259  TRKQELEKLGQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLAC  318

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG-AVGAFGGDAEVHPYVSFTINL  288
            VLSP+VKSEK+VRSILE +CDS+NS YWK+E++G A+    GD+E HPYVSFTINL
Sbjct  319  VLSPAVKSEKKVRSILERMCDSTNSLYWKSEEDGAAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010494723.1| PREDICTED: V-type proton ATPase subunit C [Camelina sativa]
Length=375

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE  T YVVPRSSK L+EDNEYALYTV LFTR ADNFR  ARERGFQ+RDFE++ E  E
Sbjct  199  NYEKFTEYVVPRSSKLLFEDNEYALYTVVLFTRVADNFRTTARERGFQVRDFEHSVEAQE  258

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            +RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+ 
Sbjct  259  TRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLAC  318

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            VLSP+VKSEK+VR ILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  319  VLSPAVKSEKKVRPILERLCDSTNSLYWKSEEDGGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_010556324.1| PREDICTED: V-type proton ATPase subunit C [Tarenaya hassleriana]
Length=377

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 156/179 (87%), Gaps = 3/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPPSFLS
Sbjct  258  ESRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPSFLS  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT---EDEGAVGAFGGDAEVHPYVSFTINL  288
             VL+P+ K EK+VRSILE LCD++NSTYWK       G +   GGDAE HPYVSFTINL
Sbjct  318  CVLAPTGKGEKKVRSILEGLCDAANSTYWKMEEEGGGGGMAGLGGDAEGHPYVSFTINL  376



>ref|XP_003567787.1| PREDICTED: V-type proton ATPase subunit C [Brachypodium distachyon]
 gb|ACU01766.1| vacuolar ATP synthetase subunit C [Brachypodium distachyon]
Length=382

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYE+L ++VVPRSSK+LYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  
Sbjct  205  ASYESLDTFVVPRSSKRLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQ  264

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPP+FLS
Sbjct  265  ESRKQELEKLLQDQELMRTSLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPNFLS  324

Query  455  vvlspsvkSEKRVRSILESLCDSSNS-TYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS KSEK+VR+ILE LC SSNS  YWK +D+  V   GGD E HPYVSFTIN V
Sbjct  325  VVLAPSTKSEKKVRNILEGLCGSSNSNNYWKQDDDVGVAGLGGDTESHPYVSFTINFV  382



>ref|XP_008654564.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF85084.1| unknown [Zea mays]
 gb|ACG35170.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW81320.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE + ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  
Sbjct  201  SSYEKIDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE+EKL+QDQE  R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS
Sbjct  261  ESRKQEMEKLLQDQEAMRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS KSEK+VRSILE LC +++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  321  AVLAPSTKSEKKVRSILEELCGNAHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  377



>ref|XP_010458722.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE  T YVVPRSSK L+EDNEYALYTV LFTR ADNFR  ARERGFQ+RDFE++ E  E
Sbjct  199  NYEKFTEYVVPRSSKLLFEDNEYALYTVVLFTRVADNFRTTARERGFQVRDFEHSVEAQE  258

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            +RKQELEKL++DQE+ RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESI+RYGLPP+FL+ 
Sbjct  259  TRKQELEKLVEDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESIMRYGLPPAFLAC  318

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            VLSP+VKSEK+VR ILE LCDS+NS YWK+ ED GA+    GD+E HPYVSFTINL
Sbjct  319  VLSPAVKSEKKVRPILERLCDSTNSLYWKSEEDGGAMAGLAGDSETHPYVSFTINL  374



>ref|XP_011001967.1| PREDICTED: V-type proton ATPase subunit C [Populus euphratica]
Length=376

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  +RE+GFQIRD EY+ E  
Sbjct  198  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFHRVADNFRTSSREKGFQIRDVEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELE+++QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSF++
Sbjct  258  ENRKQELERIVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFMA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VLSPS+KSEK+VRSIL+ L DSSNSTYWK+EDE  G +   GGDA+ HPYVS TINLV
Sbjct  318  CVLSPSLKSEKKVRSILDGLGDSSNSTYWKSEDELVGGMMGLGGDADTHPYVSLTINLV  376



>ref|XP_006369829.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
 gb|ERP66398.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
Length=376

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLT YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  
Sbjct  198  ASYETLTDYVVPRSSKKLHEDNEYALYTVTLFKRVADNFRTNAREKGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELE+L++DQE+ RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELERLVRDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VLSP+ KSEK+VRSILE  CD+SNST+WK+EDE  G +   GG+A+ +PY SFTINLV
Sbjct  318  CVLSPTTKSEKKVRSILEGFCDNSNSTHWKSEDEMGGGIFGLGGEADTYPYPSFTINLV  376



>ref|XP_006655657.1| PREDICTED: V-type proton ATPase subunit C-like [Oryza brachyantha]
Length=377

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+PE  
Sbjct  201  SSYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRK+EL+KL+QDQE  R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS
Sbjct  261  ESRKEELDKLLQDQEAMRASLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS K EK+VRSILE LC + +S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  321  AVLAPSQKGEKKVRSILEELCGNVHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFV  377



>gb|EMT31457.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=259

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  
Sbjct  82   SSYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQ  141

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLS
Sbjct  142  ESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLS  201

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ G     GG+ E HPYVSFTIN V
Sbjct  202  VVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDVGMAAGLGGETESHPYVSFTINFV  259



>ref|XP_006373110.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50907.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=376

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  +R++GFQIRD E++ E  
Sbjct  198  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFHRVADNFRTSSRDKGFQIRDIEHSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELE+++QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ENRKQELERIVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINLV  285
             VLSPS+K EK+VRSIL+ L DSSNSTYWK+EDE  G +   GGDA+ HPYVSFTINLV
Sbjct  318  CVLSPSLKGEKKVRSILDGLGDSSNSTYWKSEDEVVGGMMGLGGDADTHPYVSFTINLV  376



>gb|ABG23314.1| vacuolar proton-ATPase C subunit [Triticum aestivum]
Length=380

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  
Sbjct  203  SSYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQ  262

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLS
Sbjct  263  ESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLS  322

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ G     GG+AE HPYVSFTIN V
Sbjct  323  VVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDVGMAAGLGGEAESHPYVSFTINFV  380



>ref|NP_001056500.1| Os05g0593100 [Oryza sativa Japonica Group]
 gb|AAT44305.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
 dbj|BAF18414.1| Os05g0593100 [Oryza sativa Japonica Group]
 dbj|BAG88149.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94456.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79794.1| hypothetical protein OsI_21221 [Oryza sativa Indica Group]
 gb|EEE64903.1| hypothetical protein OsJ_19763 [Oryza sativa Japonica Group]
Length=377

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+ E  
Sbjct  201  SSYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSSEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRK+ELEKLMQDQE  R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS
Sbjct  261  ESRKEELEKLMQDQEAMRASLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS K EK+VRSILE LC + +S YWK+ED+  V   GG+ E HPYVSFTIN +
Sbjct  321  AVLAPSQKGEKKVRSILEELCGNVHSIYWKSEDDVGVAGLGGETEAHPYVSFTINFI  377



>ref|XP_010528136.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=376

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+PE  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFGRAADNFRTSAREKGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFLS
Sbjct  258  ESRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFLS  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKT--EDEGAVGAFGGDAEVHPYVSFTINL  288
             VL+PS K EK+VRSI+E L DS+NS YWK   E  G  G  GGDA+ HPYVSFTINL
Sbjct  318  CVLAPSSKGEKKVRSIIEGLSDSANSKYWKPEEEGGGMGGLGGGDADAHPYVSFTINL  375



>gb|KFK43549.1| hypothetical protein AALP_AA1G141200 [Arabis alpina]
Length=376

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 159/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT YVVPRSSKKL+EDNEYALYTVTLFTR ADNFRI ARE+G+Q+RDFE++ E  
Sbjct  198  ACYETLTEYVVPRSSKKLHEDNEYALYTVTLFTRVADNFRITAREKGYQVRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE +CDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERMCDSTNSLYWKSEEDAGAAMAGLAGDSETHPYVSFTINL  375



>ref|NP_001142247.1| uncharacterized protein LOC100274416 [Zea mays]
 gb|ACF87983.1| unknown [Zea mays]
 tpg|DAA59220.1| TPA: hypothetical protein ZEAMMB73_061434 [Zea mays]
Length=377

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSK+LYEDNEYALYT+TLF +  DNF+++ARE+GFQ+RDFEY+PE  
Sbjct  201  SSYESLDTFVVPRSSKQLYEDNEYALYTITLFAKVVDNFKVRAREKGFQVRDFEYSPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQE+EKL+ +QE  R+SLLQWCY SY EVFSSWMHFCAVR+F ESILRYGLPPSFLS
Sbjct  261  ESRKQEMEKLLLEQEVMRTSLLQWCYASYSEVFSSWMHFCAVRIFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS K EK+VRSILE LC + +S YWK ED+ AV   GG++EVHPYVSFTIN V
Sbjct  321  AVLAPSTKGEKKVRSILEDLCGNVHSIYWKGEDDVAVAGLGGESEVHPYVSFTINFV  377



>emb|CDY21070.1| BnaA08g24550D [Brassica napus]
Length=376

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 158/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT YVVPRSSKKL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  
Sbjct  198  ACYETLTEYVVPRSSKKLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDGGAAIAGLAGDSETHPYVSFTINL  375



>ref|XP_009110617.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=376

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 158/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT YVVPRSSKKL+EDNEYALYTVTLFTR ADN+R  ARE+GFQIRDFE++ E  
Sbjct  198  ACYETLTEYVVPRSSKKLFEDNEYALYTVTLFTRVADNYRTSAREKGFQIRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDGGAAMAGLAGDSETHPYVSFTINL  375



>emb|CDX71966.1| BnaC08g29080D [Brassica napus]
Length=378

 Score =   254 bits (650),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 159/180 (88%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT +VVPRSSKKL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  
Sbjct  198  ACYETLTDFVVPRSSKKLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+E++    GA+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAGGAMAGLAGDSETHPYVSFTINL  377



>ref|XP_009118052.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=378

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 159/180 (88%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT +VVPRSSKKL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  
Sbjct  198  ACYETLTDFVVPRSSKKLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+E++    GA+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAGGAMAGLAGDSETHPYVSFTINL  377



>ref|XP_002889973.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66232.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
Length=378

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 160/180 (89%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT YVVPRSSKKL+EDNEYALYTVTLFTR ADNFRI ARE+GFQ+RDFE++ E  
Sbjct  198  ACYETLTEYVVPRSSKKLFEDNEYALYTVTLFTRVADNFRISAREKGFQVRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE +CDS+NS YWK+E++    GA+    GD+E +PYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERMCDSTNSLYWKSEEDAGAGGAMAGLAGDSETYPYVSFTINL  377



>gb|ACT34062.1| vacuolar ATP synthetase subunit C [Aegilops tauschii]
Length=380

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  
Sbjct  203  SSYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQ  262

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLS
Sbjct  263  ESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLS  322

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ G     GG+ E HPYVSFTIN V
Sbjct  323  VVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDVGMAAGLGGETESHPYVSFTINFV  380



>gb|EMS67397.1| V-type proton ATPase subunit C [Triticum urartu]
Length=374

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  
Sbjct  197  SSYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQ  256

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSSWMHF AVRVF ESILRYGLP  FLS
Sbjct  257  ESRKQELEKLLQDQEVMRTSLLQWCYASYSEVFSSWMHFSAVRVFVESILRYGLPARFLS  316

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINLV  285
            VVL+PS KSEK+VR+ILE LC ++NS+YW++ED+ G     GG+ E HPYVSFTIN V
Sbjct  317  VVLAPSTKSEKKVRNILEGLCGNANSSYWRSEDDVGMAAGLGGETESHPYVSFTINFV  374



>emb|CDY66539.1| BnaCnng51300D [Brassica napus]
Length=376

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT YVVPRSSKKL+EDNEYALYTVTLF+R ADN+R  ARE+GFQIRDFE++ E  
Sbjct  198  ACYETLTEYVVPRSSKKLFEDNEYALYTVTLFSRVADNYRTSAREKGFQIRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ R+SLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRTSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+E++   A+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDGGAAMAGLAGDSETHPYVSFTINL  375



>ref|XP_010554131.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Tarenaya 
hassleriana]
Length=377

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 153/177 (86%), Gaps = 3/177 (2%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQ RDFEY+PE  ES
Sbjct  200  YETLTNYVVPRSSKKLFEDNEYALYTVTLFGRVADNFRTSAREKGFQTRDFEYSPEAQES  259

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
            RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPP+FLS V
Sbjct  260  RKQELEKLVQDQESMRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPAFLSCV  319

Query  449  lspsvkSEKRVRSILESLCDSSNSTYWKTEDE---GAVGAFGGDAEVHPYVSFTINL  288
            L+PS K EK+VRSILE  CD++NSTYWK E+E   G  G  GGD E +PYV FTINL
Sbjct  320  LAPSTKGEKKVRSILEGSCDAANSTYWKVEEEAGGGMAGFGGGDTEAYPYVCFTINL  376



>ref|NP_001147632.1| LOC100281241 [Zea mays]
 gb|ACF83479.1| unknown [Zea mays]
 gb|ACG28176.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW79360.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETL ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQIRDFEY+PE  
Sbjct  201  SSYETLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQIRDFEYSPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESR QE+EKL++DQE  R++LLQWCY SY EVFSSWMHFCAVRVF ESILRYGLPPSFLS
Sbjct  261  ESRMQEMEKLLRDQEAMRTTLLQWCYASYSEVFSSWMHFCAVRVFVESILRYGLPPSFLS  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VL+PS KSEK+VRSIL+ L   ++S YWK+ED+  V   GG+ E HPYVSFTIN V
Sbjct  321  AVLAPSTKSEKKVRSILDELSGDAHSLYWKSEDDVGVAGLGGETEAHPYVSFTINFV  377



>ref|XP_010554130.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Tarenaya 
hassleriana]
Length=426

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 153/177 (86%), Gaps = 3/177 (2%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQ RDFEY+PE  ES
Sbjct  249  YETLTNYVVPRSSKKLFEDNEYALYTVTLFGRVADNFRTSAREKGFQTRDFEYSPEAQES  308

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
            RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPP+FLS V
Sbjct  309  RKQELEKLVQDQESMRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPAFLSCV  368

Query  449  lspsvkSEKRVRSILESLCDSSNSTYWKTEDE---GAVGAFGGDAEVHPYVSFTINL  288
            L+PS K EK+VRSILE  CD++NSTYWK E+E   G  G  GGD E +PYV FTINL
Sbjct  369  LAPSTKGEKKVRSILEGSCDAANSTYWKVEEEAGGGMAGFGGGDTEAYPYVCFTINL  425



>emb|CDY26596.1| BnaA09g46810D [Brassica napus]
Length=614

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 159/180 (88%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YETLT +VVPRSSKKL+EDNEYALYTVTLFTR ADNFR  ARE+GFQ+RDFE++ E  
Sbjct  198  ACYETLTDFVVPRSSKKLFEDNEYALYTVTLFTRVADNFRTNAREKGFQVRDFEHSVEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAESI+RYGLPP+FL+
Sbjct  258  ETRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAESIMRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE----GAVGAFGGDAEVHPYVSFTINL  288
             VLSP+VKSEK+VRSILE LCDS+NS YWK+E++    GA+    GD+E HPYVSFTINL
Sbjct  318  CVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAGGAMAGLAGDSETHPYVSFTINL  377



>gb|ADE77882.1| unknown [Picea sitchensis]
Length=379

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETL+++VVPRSSKKL EDNEYALY+VTLF + AD+FR+ ARE+GFQ+RDFEY+PE  
Sbjct  201  SSYETLSTFVVPRSSKKLQEDNEYALYSVTLFKKVADSFRVSAREKGFQVRDFEYDPEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E R+++LE+L+ DQET R  L QWCY SYGEVFSSWMH CA+R+F ESILRYGLPPSFL+
Sbjct  261  ERRREDLERLISDQETMRGGLQQWCYASYGEVFSSWMHLCAIRLFTESILRYGLPPSFLA  320

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
             VL+PS KSEK+VRSILE L   SN+++WK ED+ G  G  GG+ EV+PYVSFTINL
Sbjct  321  AVLAPSSKSEKKVRSILERLSGGSNNSFWKAEDDVGIAGLAGGETEVYPYVSFTINL  377



>gb|KJB76319.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=349

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTY  372
             VLSPSVK EK+VRSILE LCDS+N  Y
Sbjct  318  CVLSPSVKGEKKVRSILEGLCDSANRQY  345



>ref|XP_006373109.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50906.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=366

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 149/177 (84%), Gaps = 8/177 (5%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSKKLYEDNEYALYTVTLF R ADNFR  +R++GFQIRD E++ E  
Sbjct  198  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFHRVADNFRTSSRDKGFQIRDIEHSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E+RKQELE+++QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ENRKQELERIVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
             VLSPS+K EK+VRSIL+ L D+        E  G +   GGDA+ HPYVSFTINLV
Sbjct  318  CVLSPSLKGEKKVRSILDGLGDN--------EVVGGMMGLGGDADTHPYVSFTINLV  366



>gb|KJB76320.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=345

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQ+  RSSLLQWCY SYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLVQDQDMLRSSLLQWCYASYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSN  381
             VLSPSVK EK+VRSILE LCDS+N
Sbjct  318  CVLSPSVKGEKKVRSILEGLCDSAN  342



>gb|KCW64312.1| hypothetical protein EUGRSUZ_G019431, partial [Eucalyptus grandis]
Length=345

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVVPRSSK+L+EDNEYALYTVTLF+R ADNFR  ARERGFQIRDFEYN E  
Sbjct  201  SSYETLTSYVVPRSSKQLHEDNEYALYTVTLFSRVADNFRTTARERGFQIRDFEYNLEAQ  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E RKQELE+LM+DQE FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  261  EGRKQELERLMRDQENFRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  320

Query  455  vvlspsvkSEKRVRSILESLCDSSN  381
             VL+PSVK EK+VRSILE LCD+++
Sbjct  321  CVLAPSVKGEKKVRSILEGLCDNTH  345



>gb|AAO72561.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
Length=408

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF+++ARE+GFQ+RDFEY+ E  
Sbjct  241  SSYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVRAREKGFQVRDFEYSSEAQ  300

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRK+ELEKLMQDQE  R+SLLQWCY SY EVFSSWMHFC VRVF ESILRYGLPPSFLS
Sbjct  301  ESRKEELEKLMQDQEAMRASLLQWCYASYSEVFSSWMHFCLVRVFVESILRYGLPPSFLS  360

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDA  324
             VL+PS K EK+VRSIL +   + +S YWK+ED+  V   GG A
Sbjct  361  AVLAPSQKGEKKVRSILRNSVGNVHSIYWKSEDDVGVAGLGGKA  404



>ref|XP_010939292.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRS+KKL+EDNEYALYTVTLF+R ADNF+  ARERGFQIR+FEY+PE  
Sbjct  198  SSYETLTTYVVPRSTKKLHEDNEYALYTVTLFSRVADNFKTSARERGFQIREFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ESRKQELEKL+QDQE  RSSLLQWCY SYGEVFS+WMHFCAVRVFAESILRYGLPPSFL+
Sbjct  258  ESRKQELEKLLQDQENMRSSLLQWCYASYGEVFSAWMHFCAVRVFAESILRYGLPPSFLA  317

Query  455  vvlspsvkSEKRVRSILESL  396
             VL+P  KSEK+VRSILE L
Sbjct  318  AVLAPPAKSEKKVRSILEEL  337



>gb|AGJ98217.1| DET3, partial [Petunia x hybrida]
Length=268

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSK-KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPET  639
            +SY+TLT++VVPRSSK    EDNEYALYTVTLF+RDADNF+IKARERGFQIRDFEY+PET
Sbjct  131  SSYKTLTAFVVPRSSKFPPMEDNEYALYTVTLFSRDADNFKIKARERGFQIRDFEYDPET  190

Query  638  HESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfl  459
             ESRK ELEKLMQDQE FRSS+ QWCYTSYGEVFSSWMHFCAVR+FAESILRYGLPPSFL
Sbjct  191  QESRKHELEKLMQDQEIFRSSVXQWCYTSYGEVFSSWMHFCAVRIFAESILRYGLPPSFL  250

Query  458  svvlspsvkSEKRVRSIL  405
            SVVL+PS KSEK+VRSIL
Sbjct  251  SVVLAPSTKSEKKVRSIL  268



>ref|XP_001773067.1| predicted protein [Physcomitrella patens]
 gb|EDQ62107.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGF-QIRDFEYNPET  639
            ASYETL+++VVPRSSK+L EDNEYAL+TVTLF + ADNF+   RERGF Q+RDFE +PE 
Sbjct  200  ASYETLSTFVVPRSSKRLTEDNEYALFTVTLFRKVADNFKTAGRERGFLQVRDFELDPEG  259

Query  638  HESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfl  459
              S+++E+ KL +DQ+  R SL QWCY  YGEVFS+WMH CA+R+F ESILRYGLPP FL
Sbjct  260  QSSKQEEMAKLQKDQDELRQSLQQWCYAVYGEVFSAWMHVCAIRLFTESILRYGLPPKFL  319

Query  458  svvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEVHPYVSFTINL  288
            + VL+PS K+EK+VR + E L   +NS +W +ED+ G +G  GGD+EVHPYVS T+NL
Sbjct  320  AAVLAPSSKTEKKVRGVCEKLSSGTNSLFWHSEDDAGMMGLAGGDSEVHPYVSLTVNL  377



>gb|AFA36545.1| vacuolar ATP synthetase subunit C, partial [Lolium perenne]
Length=184

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  
Sbjct  55   ASYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQ  114

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYG  477
            ESRKQELEKL+QDQE  R+SLLQWCY SY EVFSSWMHFCAVRVF ESILRYG
Sbjct  115  ESRKQELEKLLQDQELMRTSLLQWCYASYSEVFSSWMHFCAVRVFVESILRYG  167



>ref|XP_002980160.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
 ref|XP_002992900.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ05989.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ19030.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
Length=380

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 144/177 (81%), Gaps = 2/177 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYE+LT +VVPRSS KL+EDNEYALYTV LF + ADNF+  ARERGFQ+RD E++PE  +
Sbjct  202  SYESLTDFVVPRSSAKLHEDNEYALYTVILFRKVADNFKSAARERGFQVRDIEFDPEGQQ  261

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
             R+QE +KL ++ ++ RSSL QWC  SYGEVFS+WMH CA+R+FAESILRYGLPP FL+ 
Sbjct  262  QRRQEQDKLSRELDSLRSSLQQWCCASYGEVFSAWMHICAIRIFAESILRYGLPPKFLAA  321

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDE--GAVGAFGGDAEVHPYVSFTINL  288
            V++PS ++EK+VRS+LE LC++ NS +WK++++  G  G  GG+ E HPYVSFT+NL
Sbjct  322  VMAPSQRNEKKVRSMLEGLCNAPNSGFWKSDEDGGGVAGIVGGEVEAHPYVSFTLNL  378



>gb|KJB40646.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=336

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = -1

Query  674  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  495
            + IRDFEY+PE  ESRKQELEKL+QDQ++ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAE
Sbjct  206  YVIRDFEYSPEAQESRKQELEKLVQDQDSLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAE  265

Query  494  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDE-GAVGAFGGDAEV  318
            SILRYGLPPSFL+ VLSPS K EK+VRSILE LCDS+NSTYWKTEDE GA+   GGDA+ 
Sbjct  266  SILRYGLPPSFLACVLSPSTKGEKKVRSILEGLCDSTNSTYWKTEDEGGAMAGLGGDADT  325

Query  317  HPYVSFTINL  288
            +PYVSFTIN+
Sbjct  326  YPYVSFTINI  335



>gb|EMT09400.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=377

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 8/176 (5%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE+L ++VVPRSSK+LYED+EYALYTVTLF +   NF+  A+E+GF IRDF Y+PE  ES
Sbjct  209  YESLDTFVVPRSSKRLYEDDEYALYTVTLFAKVVGNFKAHAQEKGFLIRDFVYSPEAQES  268

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K +LEKL+QD+E  R+SLLQ  Y  Y EVFSSWMH CAV VFAESILRYGL PS L V+
Sbjct  269  -KDDLEKLLQDEEAMRTSLLQLLYARYSEVFSSWMHICAVFVFAESILRYGLSPSILCVI  327

Query  449  lspsvkSEKRVRSILESLCDSSNST-YWKTEDEGAVGAFGGDAEVHPYVSFTINLV  285
            L+PS++SEK+VR ILE  C ++NS  +WK++D+G     GG  E+HPYVS T+N+V
Sbjct  328  LAPSMESEKKVRDILEEHCGNANSNDFWKSDDDG----LGG--EIHPYVSSTMNVV  377



>ref|XP_008775428.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Phoenix 
dactylifera]
Length=335

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -1

Query  674  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  495
            + IR+FEY+PE+ E+RKQELEKL+QDQE  RSSLLQWCY SYGEVFS+WMHFCAVR+FAE
Sbjct  206  YVIREFEYSPESQENRKQELEKLLQDQENMRSSLLQWCYASYGEVFSAWMHFCAVRIFAE  265

Query  494  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVH  315
            SILRYGLPP+FL+ VL+P  KSEK+VRSILE L  ++NS +WK+EDE  +   GG+AE +
Sbjct  266  SILRYGLPPAFLAAVLAPPAKSEKKVRSILEELGGNANSAFWKSEDEVGLAGIGGEAEAY  325

Query  314  PYVSFTINLV  285
            PYVSFTIN+V
Sbjct  326  PYVSFTINIV  335



>ref|XP_010528980.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=169

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = -1

Query  674  FQIRDFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  495
            FQIRDFEY+PE  ESRKQELEKL+QDQE+ RSSLLQWCYTSYGEVFSSWMHFCAVR+FAE
Sbjct  38   FQIRDFEYSPEAQESRKQELEKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRIFAE  97

Query  494  SILRYGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKT--EDEGAVGAFGGDAE  321
            SILRYGLPPSFLS VL+PS K EK+VRSI+E L DS+NS YWK   E  G  G  GGDA+
Sbjct  98   SILRYGLPPSFLSCVLAPSSKGEKKVRSIIEGLSDSANSKYWKPEEEGGGMGGLGGGDAD  157

Query  320  VHPYVSFTINL  288
             HPYVSFTINL
Sbjct  158  AHPYVSFTINL  168



>gb|KDO47363.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47364.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47365.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=303

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYETLTSYVVPRSSK LYEDNEYALYTVTLF R ADNFRI ARE+GFQIRDFEY+ E  
Sbjct  198  ASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMH  522
            ESR QELEKL+ DQE+ RSSLLQWCYTSYGEV S+++H
Sbjct  258  ESRNQELEKLVHDQESLRSSLLQWCYTSYGEVCSTFLH  295



>gb|KJB40647.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=323

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQIRDFEY+PE  
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQIRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWM  525
            ESRKQELEKL+QDQ++ RSSLLQWCYTSYGE+  +++
Sbjct  258  ESRKQELEKLVQDQDSLRSSLLQWCYTSYGELLDAFL  294



>gb|EPS62747.1| hypothetical protein M569_12043, partial [Genlisea aurea]
Length=310

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLFTRDADNFR KARER +QIRDFEYN ET 
Sbjct  219  SSYETLTTYVVPRSSKKLHEDNEYALYTVTLFTRDADNFRTKARERNYQIRDFEYNSETQ  278

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEV  540
            ESRKQELEKL+QDQ+  R+ LLQWCY SYGEV
Sbjct  279  ESRKQELEKLVQDQDALRTGLLQWCYASYGEV  310



>gb|KJB76317.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=323

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGFQ+RDFEY+PE  
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQVRDFEYSPEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAE  495
            ESRKQELEKL+QDQ+  RSSLLQWCY SYGE+  + +  C  R+  E
Sbjct  258  ESRKQELEKLVQDQDMLRSSLLQWCYASYGELLDALL--CCTRLCRE  302



>ref|XP_005651974.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27430.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
Length=372

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 131/176 (74%), Gaps = 0/176 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YETL+ +VVPRSSK ++ED +Y+L++VTLF R AD+F+  AR +G+Q+RD+E++ E  
Sbjct  195  STYETLSDFVVPRSSKLIFEDQDYSLFSVTLFKRVADSFKAAARSKGYQVRDYEFDQELQ  254

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E++ +  + L  + ++ RS L QW  ++YGE FS+W+H CA+R+F ESILRYGLPP FL+
Sbjct  255  ENQSEAAKTLKANADSKRSQLEQWSASAYGEAFSAWIHICAIRLFVESILRYGLPPKFLA  314

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            V+L P+ K+  ++R +L SL  SS ++ +   + GA G   G++E++PYVSFT+++
Sbjct  315  VLLKPNQKNTTKLRKLLASLFGSSGTSQYFDGEAGATGGLAGESEMYPYVSFTVSV  370



>ref|XP_008341246.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C-like [Malus domestica]
Length=299

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLT+YVVPRSSKKL+EDNEYALYTVTLF R ADNFR  ARE+GFQIRDFEY+ E  
Sbjct  198  SSYETLTNYVVPRSSKKLFEDNEYALYTVTLFNRVADNFRTSAREKGFQIRDFEYSSEAQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVF  537
            ESRKQELEKL+QDQE  R SLLQWCYTSYGEV 
Sbjct  258  ESRKQELEKLVQDQENLRGSLLQWCYTSYGEVI  290



>ref|XP_010663792.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Vitis vinifera]
Length=319

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YETL +YVVPRSSKKL+EDNEYALYTVT+F R ADNF+  ARERGFQIRDFEY+PET 
Sbjct  198  STYETLATYVVPRSSKKLHEDNEYALYTVTIFGRVADNFKTSARERGFQIRDFEYSPETQ  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFS  534
            ESRKQELEKLM DQ+T R+SLLQWCYTSYGE F+
Sbjct  258  ESRKQELEKLMLDQDTIRTSLLQWCYTSYGEEFA  291



>sp|Q9SCB9.1|VATC_HORVU RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Hordeum 
vulgare]
 emb|CAB65127.1| vacuolar H+-ATPase subunit C [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ASYE+L ++VVPRSSKKLYEDNEYALYTVTLF +  DNF++ ARE+GFQIRDFEY+PE  
Sbjct  203  ASYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQ  262

Query  635  ESRKQELEKLMQDQETFRSS-LLQWCYTSYGEVFSSWMHF-CAVRVFAESILRYG  477
            ESRKQELEKL+QDQE  R+S +      +   VFSSW  F  AVRVF ESILRYG
Sbjct  263  ESRKQELEKLLQDQEVMRTSPIAMGAMLATVRVFSSWDAFSSAVRVFVESILRYG  317



>gb|ADI46924.1| ATPvC1m [Volvox carteri f. nagariensis]
Length=376

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 114/175 (65%), Gaps = 4/175 (2%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNP--ETH  636
            Y  L ++VVPRSS  + EDN+Y L +V LF R  D+F+  AR +G+Q+R  EYNP  E  
Sbjct  196  YANLANFVVPRSSAVIAEDNDYTLVSVVLFKRVVDDFKAAARIKGYQVR--EYNPPAEGM  253

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E    + E+L +D E  R+++  WC T+YGEVFS +MH   VR+F ESILRYGLPP+F +
Sbjct  254  ELSLMQTEQLKRDVEQRRAAVEHWCKTAYGEVFSCYMHILVVRLFVESILRYGLPPTFQA  313

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
             VL P  K+E R+R+ LE+     N+ YWK +D        GDA++HPYVS TIN
Sbjct  314  AVLQPQEKAESRLRAELEATFGGGNTHYWKDDDTILGNGLIGDADLHPYVSLTIN  368



>ref|XP_002954527.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
 gb|ADI46857.1| ATPvC1f [Volvox carteri f. nagariensis]
 gb|EFJ44420.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
Length=376

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 115/177 (65%), Gaps = 4/177 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNP--ET  639
            SY  + ++VVPRSS  + EDN+YAL TV LF R  D+F+  AR +G+Q+R  EYNP  E 
Sbjct  195  SYTKMANFVVPRSSTTVAEDNDYALVTVVLFKRVIDDFKAAARTKGYQVR--EYNPPAEG  252

Query  638  HESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfl  459
             E    ++E+L  D E  ++ + QWC T+Y EVFS +MH   V++F ESILRYGLPP+F 
Sbjct  253  AELSLAQIEQLKHDMEQKKTDVEQWCKTAYSEVFSCYMHMLVVQLFVESILRYGLPPNFQ  312

Query  458  svvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            + V+ P  K+E R+R+ LE+   S  + YW+ +         GDAE+HPYVS T+N+
Sbjct  313  AAVVRPQDKAEGRLRAELEATFGSGKTHYWRDDGSSLGAGLVGDAELHPYVSLTVNM  369



>ref|XP_010068642.1| PREDICTED: V-type proton ATPase subunit C-like [Eucalyptus grandis]
Length=329

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 101/145 (70%), Gaps = 25/145 (17%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETLTSYVV  S                          I        IRDFEYN E  
Sbjct  201  SSYETLTSYVVSVSF-------------------------ISTSSLHVLIRDFEYNLEAQ  235

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E RKQELE+LM+DQE FR+SLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFL+
Sbjct  236  EGRKQELERLMRDQENFRNSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLA  295

Query  455  vvlspsvkSEKRVRSILESLCDSSN  381
             VL+PSVK EK+VRSILE LCD+++
Sbjct  296  CVLAPSVKGEKKVRSILEGLCDNTH  320



>gb|KJB40645.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=387

 Score =   142 bits (358),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 85/143 (59%), Gaps = 51/143 (36%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGF------------  672
            +SYETLT+YVVPRSSKKLYEDNEYALYTVTLF R ADNFR  ARERGF            
Sbjct  198  SSYETLTTYVVPRSSKKLYEDNEYALYTVTLFGRVADNFRTSARERGFQVSAFDGCICIF  257

Query  671  ---------------------------------------QIRDFEYNPETHESRKQELEK  609
                                                   QIRDFEY+PE  ESRKQELEK
Sbjct  258  YMSKISLGYSYAWSWCIENVLLSWRISYSRCCRISFGVIQIRDFEYSPEAQESRKQELEK  317

Query  608  LMQDQETFRSSLLQWCYTSYGEV  540
            L+QDQ++ RSSLLQWCYTSYGEV
Sbjct  318  LVQDQDSLRSSLLQWCYTSYGEV  340


 Score = 37.0 bits (84),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -2

Query  544  RFSAPGCTFVLYVSLLKAF  488
            RFSAPGC FVLYVSL +AF
Sbjct  369  RFSAPGCIFVLYVSLQRAF  387



>ref|XP_002503957.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO65215.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=375

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 112/185 (61%), Gaps = 16/185 (9%)
 Frame = -1

Query  812  SYETLTSYVVPRSSK----------KLYEDNEYALYTVTLFTRDADNFRIKARERGFQIR  663
            +YETL  +VVPRSSK           + ED EYALYTVTLF R  D F   ARE  FQ+R
Sbjct  197  TYETLAQFVVPRSSKYAKLLFEKLSLINEDGEYALYTVTLFRRVVDAFNTAARENSFQVR  256

Query  662  DFEYNPETHESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILR  483
            +F  + E  +++  E   L +D +  R+S+ QWC TSYGE F +W+H CA+R+F ESILR
Sbjct  257  EFSLDTEAVQAKIAERNDLERDIKERRTSMFQWCQTSYGEAFGAWVHVCAIRLFVESILR  316

Query  482  YGlppsflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVS  303
            YGLPPSF + V+ P  +SEK++R IL +      S++W   D+          E  PYVS
Sbjct  317  YGLPPSFQACVMKPQKRSEKKLRGILANTFGQGASSHWSNSDDDK------GEEAFPYVS  370

Query  302  FTINL  288
            F+I +
Sbjct  371  FSIEI  375



>ref|XP_001696429.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
 gb|EDP08406.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
Length=373

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 110/173 (64%), Gaps = 0/173 (0%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE + ++VVPRSS  + EDN+Y+L +V LF R  D+F+  AR +G+Q+R++    E  E 
Sbjct  196  YEKMCNFVVPRSSAHISEDNDYSLVSVVLFKRVLDDFKAAARSKGYQVREYHAPTEGSEL  255

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
               + E+L +D E  +++L QWC T+YGE FS +MH   VR+F ESILRYGLPPSF + V
Sbjct  256  TTAQAEQLKKDVEQKKNALEQWCKTAYGEAFSCYMHVLVVRLFVESILRYGLPPSFQAAV  315

Query  449  lspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            + P  KSE R+R  LE+      + YWK +         GD E++PYVS T++
Sbjct  316  VRPQDKSEARLRLELETTFGGGKAHYWKDDGSNLGAGLAGDTELYPYVSLTLS  368



>ref|XP_005847214.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
 gb|EFN55112.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
Length=367

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 113/177 (64%), Gaps = 9/177 (5%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQ-IRDFEYNPET  639
            A YE+L+ +VVPRS+  + ED +Y  +TV LF R  DNF+  AR +GFQ ++D + +PE 
Sbjct  197  AQYESLSEFVVPRSTSVVAEDQDYQAFTVVLFRRVVDNFKTAARGKGFQQVKDLKVDPEA  256

Query  638  HESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfl  459
              S + EL ++  + E  R SL QWC TSYGE FSSW+H CAVR+F ESILRYGLPP FL
Sbjct  257  ARSSEAELARVRTEVEQRRVSLEQWCITSYGEAFSSWIHVCAVRLFVESILRYGLPPKFL  316

Query  458  svvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            SV++ P+ K   ++R ++      + S ++  E        G   ++ PYVSFT+N+
Sbjct  317  SVLMRPNAKYTAKLRKLMAHSFSHTGSDHFSAE--------GAGEDMFPYVSFTLNI  365



>ref|XP_007513767.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
 emb|CCO16292.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
Length=433

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 120/186 (65%), Gaps = 11/186 (6%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARER--GFQIRDFEYNPET  639
            SYETL  +VVPRSSK L E+N+Y+L+TVTLF R  D+F+   RE+   FQ+R++ Y+ + 
Sbjct  248  SYETLAQFVVPRSSKMLKEENDYSLFTVTLFRRTVDSFKNAVREKNGAFQVREYSYDKDK  307

Query  638  HESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfl  459
                K+E + L ++ ET R+ L +WC TSYGEV SSW+H   VR+F ESILRYGLPP+F 
Sbjct  308  ITENKEEKQSLEEEVETRRNELYEWCQTSYGEVVSSWIHVVVVRLFVESILRYGLPPAFQ  367

Query  458  svvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVH---------PYV  306
            +V++ P  + EK++RS++ +   + +S++W   + G     GG   +          PYV
Sbjct  368  AVIMRPKERLEKKLRSVMNAAFGNGSSSHWSATESGGGSGGGGGDGLGGERGGDDCFPYV  427

Query  305  SFTINL  288
            SFT+ L
Sbjct  428  SFTVTL  433



>ref|XP_001756840.1| predicted protein [Physcomitrella patens]
 gb|EDQ78437.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 117/192 (61%), Gaps = 17/192 (9%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPET-H  636
            +YE L  YVVPRS+K L+ED +Y +YTV +F    ++F   A  + FQ+R    +P   H
Sbjct  198  NYEKLCDYVVPRSAKNLHEDTDYLIYTVIVFRHVVESFTNAAGLKNFQVRTLTRDPNGGH  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + + ELE   ++    R +LL WCY ++GEVFS+W+H CA+R+F ES+LRYGLPP+FL+
Sbjct  258  FAYRAELEHWQEEHGKKRHALLHWCYATFGEVFSAWVHLCAIRIFVESVLRYGLPPAFLA  317

Query  455  vvlspsvkSEKRVRSILESLCDSS---------------NSTYWKTEDEGAVGAFGGDA-  324
            VVL+P  K+E +V  +LE     +               +  +W TE++ +V +  GD  
Sbjct  318  VVLAPRQKNESKVCRMLEHFSGGTMRWVTVNHSFHVKIGSGKFWATEEDPSVASLAGDGI  377

Query  323  EVHPYVSFTINL  288
            E HPYVS T+N+
Sbjct  378  ESHPYVSLTLNI  389



>ref|XP_009051892.1| hypothetical protein LOTGIDRAFT_206255 [Lottia gigantea]
 gb|ESO97287.1| hypothetical protein LOTGIDRAFT_206255 [Lottia gigantea]
Length=383

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 112/176 (64%), Gaps = 2/176 (1%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE LT  VVPRSSKK+++DNE  L TVTLF R  D F+   RE  F +RDF Y+ E  +S
Sbjct  202  YEKLTDMVVPRSSKKIFDDNENVLVTVTLFKRVVDEFKHHCRENKFSVRDFTYSEEEIQS  261

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K EL KL  D++     L++W   ++GE F++W+H  A+RVF ES+LRYGLP +F ++V
Sbjct  262  GKTELTKLEADKKKQFGPLVKWLKVNFGECFAAWLHVKALRVFVESVLRYGLPVNFQAMV  321

Query  449  lspsvkSEKRVRSILESL-CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            + PS +S KR+R +L+ L     NS   +  DE  +   G G +E +PYVS+ + L
Sbjct  322  VQPSKRSTKRLRDVLKQLYSHLDNSALQQGTDEVDIPGIGLGGSEYYPYVSYKMTL  377



>ref|XP_001814187.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Tribolium 
castaneum]
 ref|XP_008195427.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Tribolium 
castaneum]
Length=386

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DNEY LYTV+LF +  + F++ ARER F +RDF YN E  
Sbjct  199  ANYEKITDMIVPRSSQLITQDNEYGLYTVSLFKKVVEEFKLHARERKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ K+ KR+R +L  L    DSS +      D   +   G G +E +PYV + IN+
Sbjct  319  ILIHPNKKTMKRLRDVLNQLYGHLDSSAAISGSNADSVDIPGLGFGQSEYYPYVYYKINV  378



>ref|XP_008195426.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Tribolium 
castaneum]
Length=401

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DNEY LYTV+LF +  + F++ ARER F +RDF YN E  
Sbjct  214  ANYEKITDMIVPRSSQLITQDNEYGLYTVSLFKKVVEEFKLHARERKFIVRDFTYNEEEL  273

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  274  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  333

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ K+ KR+R +L  L    DSS +      D   +   G G +E +PYV + IN+
Sbjct  334  ILIHPNKKTMKRLRDVLNQLYGHLDSSAAISGSNADSVDIPGLGFGQSEYYPYVYYKINV  393



>gb|EFA06700.1| hypothetical protein TcasGA2_TC009631 [Tribolium castaneum]
Length=444

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DNEY LYTV+LF +  + F++ ARER F +RDF YN E  
Sbjct  257  ANYEKITDMIVPRSSQLITQDNEYGLYTVSLFKKVVEEFKLHARERKFIVRDFTYNEEEL  316

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  317  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  376

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ K+ KR+R +L  L    DSS +      D   +   G G +E +PYV + IN+
Sbjct  377  ILIHPNKKTMKRLRDVLNQLYGHLDSSAAISGSNADSVDIPGLGFGQSEYYPYVYYKINV  436



>ref|XP_002585525.1| hypothetical protein BRAFLDRAFT_60009 [Branchiostoma floridae]
 ref|XP_002588498.1| hypothetical protein BRAFLDRAFT_63445 [Branchiostoma floridae]
 gb|EEN41536.1| hypothetical protein BRAFLDRAFT_60009 [Branchiostoma floridae]
 gb|EEN44509.1| hypothetical protein BRAFLDRAFT_63445 [Branchiostoma floridae]
Length=394

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 105/184 (57%), Gaps = 11/184 (6%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETLT  VVPRSSKK+YEDN++ L+TVT+FTR  D ++  ARE  F +R+F+YN E   +
Sbjct  201  YETLTDMVVPRSSKKIYEDNDHGLFTVTMFTRVVDEYKHHARENRFVVREFQYNEEEMTA  260

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYG------lpp  468
             K EL KL  D++     L++W   ++ E F++W+H  A+RVF ES+LRYG         
Sbjct  261  GKNELSKLASDKKKQFGPLVRWLKVNFSEAFTAWIHVKALRVFVESVLRYGLPVNFQAML  320

Query  467  sflsvvlspsvkSEKRVRSILESLCDSSNSTYWKTED-----EGAVGAFGGDAEVHPYVS  303
                     + K  +++R  L+ L    +S+ +  +D      G  G   G  E +PYV 
Sbjct  321  LQPMNKKPLNKKVHRKLRDSLQQLYGHLDSSSFAVDDLPMDIPGLSGMNIGQGEYYPYVY  380

Query  302  FTIN  291
            ++IN
Sbjct  381  YSIN  384



>gb|AIJ50380.1| V-ATPase subunit C [Pectinophora gossypiella]
Length=382

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 112/179 (63%), Gaps = 3/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
             +YE +T  +VPRS++ +Y+DN+Y LY+VTLF + AD F++ ARER F +R+F YN    
Sbjct  198  VNYEKITDMIVPRSTQLIYQDNDYGLYSVTLFKKVADEFKLHARERKFVVREFSYNEADL  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  258  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  317

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
             VL PS KS K++R +L SL    D S +   + E     G   G +E  PYV + IN+
Sbjct  318  AVLVPSRKSMKKLRDVLHSLYAHLDHSANAGAQAEGAELAGLGFGQSEYFPYVFYKINI  376



>ref|XP_011399399.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
 gb|KFM26467.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
Length=374

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 111/175 (63%), Gaps = 7/175 (4%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYE LT +VVPRS++ + ED+EY++ +V LF R  D+F+  AR +G+Q ++   + E+ +
Sbjct  204  SYEGLTEWVVPRSARLVTEDSEYSVVSVVLFRRVVDDFKAAARAKGYQAKEITSDAESQK  263

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + ++ LEKL    E  RS    WC TSY E FS+W+H  AVR+F ESILRYGLPP FL V
Sbjct  264  ANEEGLEKLRAAVEVKRSEFEAWCLTSYSEAFSAWIHILAVRLFVESILRYGLPPQFLPV  323

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            ++ P+ K+  ++R +L S        ++  E        G D+++ PYVSFT+N+
Sbjct  324  LMRPNPKAVAKLRKLLASKYSGVGGQFFSNES-------GADSDLFPYVSFTLNI  371



>gb|ABF18462.1| V-ATPase C subunit [Aedes aegypti]
Length=364

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E  
Sbjct  178  ANYEKITDMIVPRSSQLITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEEL  237

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  238  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  297

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ K+ KR+R +L  L    D S ++     D   +   G G +E +PYV + +N+
Sbjct  298  ILIHPNKKNTKRLRDVLMQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYYPYVYYKLNI  357



>emb|CCD60515.1| subfamily S1B unassigned peptidase (S01 family) [Schistosoma 
mansoni]
Length=330

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 115/179 (64%), Gaps = 4/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YE +T  VVP+SS+ ++ED +  L+TVTLF +  D+F+ +ARE  F +RDF Y+ +  
Sbjct  147  SNYERMTDMVVPKSSELIFEDQDNGLWTVTLFKKMTDDFKTQAREFRFVVRDFTYDEKKI  206

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  + EL KL  D++   + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +
Sbjct  207  EESRNELSKLESDKKRQFAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQA  266

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            ++L P+ K +K++R IL+ L    D S+S+    ED   VG FG  ++  PYVSF + L
Sbjct  267  ILLEPNKKQQKKLRDILKQLYNHLDGSSSSSVLDEDMN-VGGFGTSSDYFPYVSFKVEL  324



>ref|XP_011305233.1| PREDICTED: V-type proton ATPase subunit C [Fopius arisanus]
 ref|XP_011305235.1| PREDICTED: V-type proton ATPase subunit C [Fopius arisanus]
Length=386

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRSS+ + +D+EY L+TVTLF + A+ F++ ARE+ F +RDF YN E  
Sbjct  199  AIYEKLTDMIVPRSSQMITQDSEYGLFTVTLFKKVAEEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSSNS-TYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            ++L P+ K+ KR+R +L  L    DSS S      +D   +   G G  E +PYV + IN
Sbjct  319  ILLHPNKKNTKRLRDVLNQLYAHLDSSASGAGGGNQDSMDIPGLGFGQNEYYPYVYYKIN  378

Query  290  L  288
            +
Sbjct  379  V  379



>gb|KFB48532.1| AGAP005845-PA-like protein [Anopheles sinensis]
Length=385

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 112/180 (62%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE +T  +VPRSS+ + +D++YAL  VTLF +  D F++ ARER F +R+F YN E  
Sbjct  199  AHYEKITDMIVPRSSQLIMQDSDYALVNVTLFKKVVDEFKLHARERKFVVREFVYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ KS KR+R +L+ L    D S S+     D   +   G G +E  PYV + +N+
Sbjct  319  ILIHPNKKSTKRLRDVLQQLYGHLDGSGSSAGGNADNVDIPGLGFGQSEYFPYVYYKLNI  378



>gb|ENN78483.1| hypothetical protein YQE_05047, partial [Dendroctonus ponderosae]
Length=319

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 109/180 (61%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DNE+ LYTVTLF +  D F+  ARER F +RDF Y+ E  
Sbjct  132  ATYEKITDMIVPRSSQLITQDNEFGLYTVTLFKKVIDEFKHHARERKFIVRDFTYDEEQL  191

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  192  AAGKNEITKLATDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  251

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P  K+ KR+R +L  L    D S        D   +   G G +E +PYV + +N+
Sbjct  252  ILIHPHKKTMKRLRDVLNQLYGHLDGSVGHQGANMDNVDIPGLGFGQSEYYPYVYYKLNV  311



>ref|XP_009861882.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 2-like [Ciona intestinalis]
Length=382

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 103/177 (58%), Gaps = 2/177 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETLT YV PRSS+ LY D EY LY VT+F +  + F+ K     F +RDF+YN     
Sbjct  200  NYETLTDYVAPRSSRLLYRDEEYGLYGVTIFKKVYEEFKTKCGRHKFFLRDFQYNERDMA  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            S K +L KL  D++     LL+W   ++ EVF++WMH  A+RVF ES+LRYGLP +F + 
Sbjct  260  SDKDQLTKLTSDKKKMLGPLLRWLKVNFSEVFTAWMHVKALRVFVESVLRYGLPVNFQAT  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWK--TEDEGAVGAFGGDAEVHPYVSFTINL  288
            V+ P  K  KR++  L  L    +ST      ED+   G   G  E HPYV + + L
Sbjct  320  VVQPQKKQSKRLQETLNKLYVGLDSTGLAAVNEDDFLPGLTLGTQEYHPYVFYKVVL  376



>emb|CAX70572.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
 emb|CAX70573.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
Length=347

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 116/179 (65%), Gaps = 4/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YET+T  VVP+SS+ ++ED +  L+TVTLF +  D+F+ +ARE  F +RDF Y+ +  
Sbjct  164  SNYETMTDMVVPKSSELIFEDQDNGLWTVTLFKKMMDDFKTQAREHRFVVRDFIYDEKKI  223

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  + EL KL  D++   + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +
Sbjct  224  EEGRNELSKLESDKKRQFAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQA  283

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            ++L P+ K +K++R +L+ L    D S+S+    ED   VG FG  ++  PYVSF + L
Sbjct  284  ILLEPNKKQQKKLRDVLKQLYSHLDGSSSSSIIDEDVN-VGNFGASSDYFPYVSFKVEL  341



>ref|XP_006626108.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Lepisosteus 
oculatus]
Length=381

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 115/178 (65%), Gaps = 3/178 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE+L+ +VVPRS+KK+ ED+E  L+TVTLF +   +FRIKARE  F +R+F +N    +
Sbjct  199  TYESLSEFVVPRSTKKIMEDSEGGLFTVTLFKKAVSDFRIKARENKFTVREFSFNETELQ  258

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     LL+W   ++ E F++W+H  A+RVF ES+LRYGLP +F ++
Sbjct  259  AEKEEMTRLAADKKQQFGPLLRWLKVNFSEAFTAWIHVKALRVFVESVLRYGLPVNFQAI  318

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTINL  288
            +L PS K+ KR+R IL SL    +     ++ +  V   G    + E + YV FTI++
Sbjct  319  LLQPSKKNSKRLREILNSLYKHLDGVAASSKLDAGVDLPGLGLSNQEYYCYVYFTIDV  376



>gb|KDR10550.1| V-type proton ATPase subunit C [Zootermopsis nevadensis]
Length=385

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
             YE LT  +VPRSS+ + +D++Y L+TVTLF +  D F++ ARE+ F +RDF YN E   
Sbjct  200  GYEKLTDMIVPRSSQLVSQDSDYGLFTVTLFKKVVDEFKLHAREKKFVVRDFTYNEEELA  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  AGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWVHVKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +L P+ K+ KR+R +L  L    DSS      + D   +   G G +E  PYV + IN+
Sbjct  320  LLHPNKKNTKRLRDVLNQLYGHLDSSAVQGSASHDSVDIPGLGFGQSEYFPYVYYKINV  378



>emb|CAX70571.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
 emb|CAX75463.1| Vacuolar H+ ATPase 44kD C subunit [Schistosoma japonicum]
Length=384

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 116/179 (65%), Gaps = 4/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YET+T  VVP+SS+ ++ED +  L+TVTLF +  D+F+ +ARE  F +RDF Y+ +  
Sbjct  201  SNYETMTDMVVPKSSELIFEDQDNGLWTVTLFKKMMDDFKTQAREHRFVVRDFIYDEKKI  260

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  + EL KL  D++   + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +
Sbjct  261  EEGRNELSKLESDKKRQFAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQA  320

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            ++L P+ K +K++R +L+ L    D S+S+    ED   VG FG  ++  PYVSF + L
Sbjct  321  ILLEPNKKQQKKLRDVLKQLYSHLDGSSSSSIIDEDVN-VGNFGASSDYFPYVSFKVEL  378



>ref|XP_001418773.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97066.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
Length=374

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 109/177 (62%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SYETL S+VVPRSSK ++ +++Y L TV LF R  D F   ARE G   +++ ++PE  
Sbjct  198  SSYETLASFVVPRSSKIIHVEDDYELRTVVLFRRVVDAFTTAAREIGCTAKEYSHDPEAS  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K +   L Q+    R SLL+WC  SYGE FS+ MH C VRVF ESILRYGLPP F +
Sbjct  258  RAAKSQRGALEQEVVQRRDSLLEWCQISYGEAFSTMMHVCTVRVFVESILRYGLPPDFQA  317

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAE-VHPYVSFTINL  288
            V++ P++K   ++R +L        S++W  E  G   + GG  E ++ YVS T+ +
Sbjct  318  VLMRPNMKHVSKLRKVLNQEFGKDASSHWDDEIGGDEKSGGGLVEDMYSYVSLTMKV  374



>ref|XP_005797406.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=382

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K+L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKQLFEDNDSGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLNDLYKHLDSSAAVIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_001843335.1| vacuolar ATP synthase subunit C [Culex quinquefasciatus]
 gb|EDS32198.1| vacuolar ATP synthase subunit C [Culex quinquefasciatus]
Length=528

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 113/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
             +YE +T  +VPRSS+ + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E  
Sbjct  342  VNYEKITDMIVPRSSQMITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEEL  401

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  402  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  461

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ K+ KR+R +L  L    D S ++     D   +   G G +E +PYV + +N+
Sbjct  462  ILIHPNKKNTKRLRDVLNQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYYPYVYYKLNI  521



>ref|XP_008420198.1| PREDICTED: V-type proton ATPase subunit C 1-A [Poecilia reticulata]
Length=382

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K+L+EDNE  L++VTLF +  D+FR KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKQLFEDNESGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYDLYKHLDSSAAVIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_011553183.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Plutella 
xylostella]
Length=384

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 113/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ L++D +Y LY+V+LF +  + F++ ARER F +R+F YN    
Sbjct  198  ANYEKITDMIVPRSSQLLHQDQDYGLYSVSLFKKVVEEFKLHARERKFIVREFNYNEAEL  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  258  AAGKHEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  317

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
             VLSPS KS K++R +L+ L    D S   +  + D   +   G G +E  PYV + IN+
Sbjct  318  AVLSPSRKSMKKLRDVLQQLYAHLDHSAQGHGSSSDNAELAGLGFGSSEYFPYVFYKINI  377



>ref|XP_008480724.1| PREDICTED: V-type proton ATPase subunit C [Diaphorina citri]
Length=410

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 113/179 (63%), Gaps = 4/179 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE LT+ +VPRSS+ + +D ++ALYTVTLF +  D FR  ARE+ F +R+F YN E   
Sbjct  224  NYEKLTAMIVPRSSQLVSQDQDFALYTVTLFKKVQDEFRHHAREKKFIVREFVYNEEELA  283

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  284  AGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAM  343

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +L P+ K+ KR+R +L+ L    DSS     +  D   +   G G A+  PYV + IN+
Sbjct  344  LLHPNKKNTKRLRDVLQQLYGHLDSSAQGGSQHHDSVEIPGLGFGQADYFPYVYYKINI  402



>gb|ERL87116.1| hypothetical protein D910_04516 [Dendroctonus ponderosae]
Length=386

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 109/180 (61%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DNE+ LYTVTLF +  D F+  ARER F +RDF Y+ E  
Sbjct  199  ATYEKITDMIVPRSSQLITQDNEFGLYTVTLFKKVIDEFKHHARERKFIVRDFTYDEEQL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLATDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P  K+ KR+R +L  L    D S        D   +   G G +E +PYV + +N+
Sbjct  319  ILIHPHKKTMKRLRDVLNQLYGHLDGSVGHQGANMDNVDIPGLGFGQSEYYPYVYYKLNV  378



>ref|XP_011553182.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Plutella 
xylostella]
Length=426

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 113/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ L++D +Y LY+V+LF +  + F++ ARER F +R+F YN    
Sbjct  240  ANYEKITDMIVPRSSQLLHQDQDYGLYSVSLFKKVVEEFKLHARERKFIVREFNYNEAEL  299

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  300  AAGKHEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  359

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
             VLSPS KS K++R +L+ L    D S   +  + D   +   G G +E  PYV + IN+
Sbjct  360  AVLSPSRKSMKKLRDVLQQLYAHLDHSAQGHGSSSDNAELAGLGFGSSEYFPYVFYKINI  419



>ref|XP_001650489.1| AAEL005173-PA [Aedes aegypti]
 gb|EAT43366.1| AAEL005173-PA [Aedes aegypti]
Length=695

 Score =   128 bits (322),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E  
Sbjct  509  ANYEKITDMIVPRSSQLITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEEL  568

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  569  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  628

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ K+ KR+R +L  L    D S ++     D   +   G G +E +PYV + +N+
Sbjct  629  ILIHPNKKNTKRLRDVLMQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYYPYVYYKLNI  688



>dbj|BAM20425.1| vacuolar H[+] ATPase 44kD C subunit [Papilio polytes]
Length=385

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T+ +VPRS++ ++ DN+Y L+TVTLF +  D F++ ARER F +R+F YN    
Sbjct  198  ANYEKITNMIVPRSTQLIHHDNDYGLFTVTLFKKVVDEFKLHARERKFVVREFSYNEADL  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  258  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  317

Query  455  vvlspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
             V+ P+ KS K++R +L+ L      S++  + +  +   +   G G +E  PYV + IN
Sbjct  318  AVVVPARKSMKKLRDVLQQLYAHLDHSAHQGHGQASENVEIAGLGFGQSEYFPYVFYKIN  377

Query  290  L  288
            +
Sbjct  378  I  378



>ref|XP_002423137.1| vacuolar ATP synthase subunit C, putative [Pediculus humanus 
corporis]
 gb|EEB10399.1| vacuolar ATP synthase subunit C, putative [Pediculus humanus 
corporis]
Length=495

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
              YE LT  +VPRSS+ + +DN+Y L+TVTLF +  + F++ ARE+ F +R+F YN E  
Sbjct  309  GHYEKLTDMIVPRSSQLITQDNDYGLFTVTLFKKVVEEFKLHAREKKFVVREFTYNEEEM  368

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  369  AAGKNEITKLVLDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  428

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            ++L P+ K+ KR+R IL  L    DSS       +D   +   G G A+  PYV + IN+
Sbjct  429  MLLQPNKKNTKRLREILNQLYGHLDSSALQGSGHQDSVDIPGLGFGQADYFPYVYYKINI  488



>ref|XP_001201267.2| PREDICTED: V-type proton ATPase subunit C [Strongylocentrotus 
purpuratus]
Length=383

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 109/179 (61%), Gaps = 5/179 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE L+  VVPRS++ +YEDN++ LY+VTLF +  D +++ ARE  F +R+F YN E   +
Sbjct  201  YEKLSDMVVPRSTRMIYEDNDHGLYSVTLFKKVVDEYKLHARENKFMVREFTYNEEELNA  260

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K EL KL  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F  ++
Sbjct  261  GKSELNKLAADKKRQYGPLVRWLKINFSEAFQAWVHVKALRVFVESVLRYGLPVNFQPMI  320

Query  449  lspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG-----GDAEVHPYVSFTINL  288
            L P  K++K+++ +L +L    + +   T+D   V AF       + E  PYV + I +
Sbjct  321  LQPYKKTQKKLKEVLNTLYGHLDGSNINTKDAKGVPAFDMPGLMSNTEYFPYVFYPIQI  379



>ref|XP_011504285.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Ceratosolen 
solmsi marchali]
Length=388

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 7/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRSS+ + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E  
Sbjct  199  AMYEKLTDMIVPRSSQLIIQDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFT  297
            ++L P  KS KR+R +L  L    DSS    S+    +D   +   G G ++  PYV + 
Sbjct  319  ILLRPHKKSTKRLRDVLNQLYAHLDSSATAGSSQSSNQDSVDIPGLGFGQSDYFPYVYYK  378

Query  296  INL  288
            IN+
Sbjct  379  INV  381



>ref|XP_007547766.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Poecilia 
formosa]
 ref|XP_007547767.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Poecilia 
formosa]
Length=382

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K+L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKQLFEDNDSGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYDLYKHLDSSAAVIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_006012217.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Latimeria chalumnae]
 ref|XP_006012218.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Latimeria chalumnae]
Length=381

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 114/177 (64%), Gaps = 4/177 (2%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE+L+  +VPRS+K + ED +  L+TVTLF +  D F++KARE  F +R+F +N +  +S
Sbjct  200  YESLSDLIVPRSTKMITEDADGGLFTVTLFKKAVDEFKVKARENKFMVREFTFNEQELQS  259

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K+EL +L  D++     LL+W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++
Sbjct  260  EKEELTRLAADKKQQYGPLLRWLKVNFSEAFIAWIHLKALRVFVESVLRYGLPVNFQAML  319

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            L P+ KS  R+R +L +L    D + +++  T+ +   G   G+ E +PYV F I+L
Sbjct  320  LQPNKKSINRLRDVLNALYKHLDGAAASFSDTKID-IPGLNVGNQEYYPYVYFRIDL  375



>ref|XP_009012372.1| hypothetical protein HELRODRAFT_156435 [Helobdella robusta]
 gb|ESO09279.1| hypothetical protein HELRODRAFT_156435 [Helobdella robusta]
Length=400

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 108/179 (60%), Gaps = 3/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
              YETLT  + P SS  + ED+E+ L+TVTLF +  + F++K RE  F +RDFEYN +  
Sbjct  214  GKYETLTDMIAPESSTLVTEDSEHCLFTVTLFRKVVEEFKLKCRENKFVVRDFEYNEQEM  273

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  K+E+ KL  D+      L++W  T++ E FS W+H  A+R F ESILRYGLP +F +
Sbjct  274  EDGKKEIMKLNTDKAKQEGPLIRWLKTNFTETFSGWLHVKALRTFIESILRYGLPVNFQA  333

Query  455  vvlspsvkSEKRVRSILES---LCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            +V++P  ++ K+++ +L       D+S +   KTE +   G      E +PYV F INL
Sbjct  334  MVIAPPKRNMKKIKELLNQHYLHLDASGTYDAKTEMDDIPGFTMSSVEYYPYVYFKINL  392



>ref|XP_315870.4| AGAP005845-PA [Anopheles gambiae str. PEST]
 gb|EAA11948.4| AGAP005845-PA [Anopheles gambiae str. PEST]
Length=385

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 111/180 (62%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE +T  +VPRSS+ + +D +Y L TVTLF +  D F++ ARER F +R+F YN E  
Sbjct  199  AHYEKITDMIVPRSSQTITQDQDYVLCTVTLFKKVVDEFKLHARERKFVVREFVYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWVHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ KS KR+R +L+ L    D S ++     D   +   G G +E  PYV + +N+
Sbjct  319  ILIHPNKKSTKRLRDVLQQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYFPYVYYKLNI  378



>ref|XP_004077677.1| PREDICTED: V-type proton ATPase subunit C 1 [Oryzias latipes]
Length=383

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 111/177 (63%), Gaps = 4/177 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  LYEDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSSNLLYEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    T  +   G      E +PYV + I+
Sbjct  320  LLQPNKKTMKKLREVLNDLYKHLDSSAAAIMDTAMDIP-GLNLSQQEYYPYVYYKID  375



>ref|XP_011879957.1| PREDICTED: V-type proton ATPase subunit C [Vollenhovia emeryi]
Length=387

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 111/182 (61%), Gaps = 6/182 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRS++ + +D+EY L+T+TLF +  D F++ ARE+ F +RDF YN E  
Sbjct  199  ACYEKLTDMIVPRSTQLITQDSEYGLFTITLFKKVMDEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS--NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTI  294
            ++L P  K  +R+R  L  L    DSS   ST    +D   +   G G ++  PYV + I
Sbjct  319  ILLHPHKKCARRLRDALNQLYAHLDSSATGSTAQHNQDNVDIPGLGFGQSDYFPYVYYKI  378

Query  293  NL  288
            N+
Sbjct  379  NV  380



>gb|ESA12183.1| hypothetical protein GLOINDRAFT_185994 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX75116.1| Vma5p [Rhizophagus irregularis DAOM 197198w]
Length=388

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 112/176 (64%), Gaps = 2/176 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YETL S +VPRSS+K+ EDN+Y L+TVTLF R +D F  K RE  F +RDF+Y+    
Sbjct  206  SKYETLASMIVPRSSQKIAEDNDYGLFTVTLFKRVSDEFANKCREEKFVVRDFKYDENDM  265

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E++++E E++   ++     LL+    ++GEVFSSW+H  A+RV+ ES+LRYGLPP F+S
Sbjct  266  ENQRKEFEEVGAVEKELAVELLRLATANFGEVFSSWIHLKALRVYVESVLRYGLPPDFMS  325

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGG--DAEVHPYVSFTI  294
             V+ P  K +K++R IL +L    +   +  ++   +  +    D + +PYV F +
Sbjct  326  AVIRPKFKMDKKIREILNNLYGKLDGLAYGRDENENIEEYQNFIDKDYYPYVYFHL  381



>ref|XP_002733333.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Saccoglossus 
kowalevskii]
Length=384

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 111/179 (62%), Gaps = 3/179 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YETLT  VVPRS+  +YEDNEY L+TVT+F +  D ++  ARE  F +RDF YN E  
Sbjct  199  SKYETLTDMVVPRSTNLIYEDNEYGLFTVTMFRKVVDEYKHHARENRFIVRDFAYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F++W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  TADKNEIIKLVSDKKKSFGPLVRWLKVNFSEAFTAWIHVHALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTED---EGAVGAFGGDAEVHPYVSFTINL  288
            ++L P  K+ +++R  L+ L     S+ +K +    E   G    + + +PYV + IN+
Sbjct  319  MLLQPYKKTHRKLRDQLKQLYSHLESSAFKADTDMMEDIPGLALSNQDYYPYVYYQINV  377



>ref|NP_001005772.2| V-type proton ATPase subunit C 1-B [Danio rerio]
 sp|Q5XIY6.1|VTC1B_DANRE RecName: Full=V-type proton ATPase subunit C 1-B; Short=V-ATPase 
subunit C 1-B; AltName: Full=Vacuolar proton pump subunit 
C 1-B [Danio rerio]
 gb|AAH83532.1| Atp6v1c1l protein [Danio rerio]
Length=381

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 116/181 (64%), Gaps = 11/181 (6%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL+  VVPRS+K L+ED E  L++VTLFT+  D+F+ +ARE  F +RDF YN E  +
Sbjct  200  TYETLSEMVVPRSTKLLFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L+ L    DSS +       +G+V   G      E +PYV + I+
Sbjct  320  LLQPNKKNVKKLREVLKDLYKHLDSSAAVI-----DGSVDIPGLNLSQQEYYPYVYYKID  374

Query  290  L  288
            +
Sbjct  375  V  375



>ref|XP_004993351.1| hypothetical protein PTSG_05481 [Salpingoeca rosetta]
 gb|EGD73788.1| hypothetical protein PTSG_05481 [Salpingoeca rosetta]
Length=373

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 109/179 (61%), Gaps = 7/179 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SY TLT YV P S++ ++ED+EY L++VTLF R AD+FR  ARE+ F +RDFE++ ET 
Sbjct  192  SSYSTLTDYVCPGSTQLIHEDSEYGLFSVTLFRRIADDFRAAAREKKFTVRDFEFDEETV  251

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
              ++ +   L  + +   + L+ W   S+ + F++WMH  A+R+F ES+LRYGLPP F  
Sbjct  252  AQQEADTTHLANEFKEKHARLMDWLQLSFDQCFTAWMHLKALRLFVESVLRYGLPPKFSF  311

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
              +S     EKR+R+ L+ L    D + +   +  D    G F G  E  PYVSF++ L
Sbjct  312  YAVSFKPDEEKRMRTALQRLYGHLDKAGAEAGEVAD--VPGLFQG--EYFPYVSFSVRL  366



>ref|NP_958479.1| V-type proton ATPase subunit C 1-A [Danio rerio]
 sp|Q7T385.1|VTC1A_DANRE RecName: Full=V-type proton ATPase subunit C 1-A; Short=V-ATPase 
subunit C 1-A; AltName: Full=Vacuolar proton pump subunit 
C 1-A [Danio rerio]
 gb|AAH53214.1| ATPase, H+ transporting, lysosomal, V1 subunit C, isoform 1 [Danio 
rerio]
 gb|AAI64479.1| Atp6v1c1 protein [Danio rerio]
Length=383

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 112/177 (63%), Gaps = 3/177 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+  L+ED++  L+TVTLF +  D+FR KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    +S+     D+ A+   G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYDLYKHLDSSAAAIIDQSAMDIPGLNLSQQEYYPYVYYKID  376



>ref|XP_008559568.1| PREDICTED: V-type proton ATPase subunit C [Microplitis demolitor]
 ref|XP_008559569.1| PREDICTED: V-type proton ATPase subunit C [Microplitis demolitor]
Length=387

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 112/182 (62%), Gaps = 6/182 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRS++ + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E  
Sbjct  199  AIYEKLTDMIVPRSTQLITQDAEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTI  294
            ++L P  K  KR+R +L  L    DSS ++   + ++ +V   G   G  E  PYV + I
Sbjct  319  ILLHPHKKCTKRLRDVLNQLYAHLDSSAASGGHSANQDSVDIPGLGFGQNEYFPYVYYKI  378

Query  293  NL  288
            N+
Sbjct  379  NV  380



>ref|XP_003389520.1| PREDICTED: V-type proton ATPase subunit C 1-B-like [Amphimedon 
queenslandica]
Length=386

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYE L+  VVPRS++ + ED EY L+TVT+F +  D F+++ARE+ F +R++E++P+  E
Sbjct  203  SYERLSDMVVPRSTELVTEDQEYGLFTVTVFKKIVDEFKLQAREKRFAVREYEHDPQALE  262

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + ++E EKL +D +     L+ W   ++ +VFS+W+H  A+RVF+ESILRYGL  + +S+
Sbjct  263  AERKEKEKLERDLKRQFGPLMNWLKVNFSQVFSAWLHLKALRVFSESILRYGLDSNCVSL  322

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            VL P  +S K V   L       DS      K +D   +   G   AE +PYV F +NL
Sbjct  323  VLKPHRRSAKSVHQALNDKYYHLDSMPLKGSKGDDHIDIPGLGLNQAEYYPYVFFKMNL  381



>ref|XP_005098193.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Aplysia 
californica]
 ref|XP_005098194.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Aplysia 
californica]
Length=390

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 108/177 (61%), Gaps = 3/177 (2%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE LT  VVPRSS+ +YEDNE+ + TVTLF    D F+ K RE  F +RDF+Y+ E  ++
Sbjct  207  YEKLTDKVVPRSSRCVYEDNEHQVMTVTLFRLVQDEFKNKCRENKFIVRDFQYSDEEIQA  266

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K EL+KL  D++     L++W   ++GE F +WMH  A+RVF ES+LRYGLP +F  ++
Sbjct  267  GKMELDKLNADKKKQFGPLVKWLKINFGESFVAWMHIKALRVFVESVLRYGLPVNFQGML  326

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            + P  K+ KR+R +L  L    DS+  +  K       G     ++ +PYV + I+L
Sbjct  327  VRPVKKNSKRLRDLLNQLYGHLDSTALSGQKVNSMDIPGLNLSASDYYPYVFYKISL  383



>ref|NP_001023451.1| Protein VHA-11, isoform a [Caenorhabditis elegans]
 sp|Q9XXU9.1|VATC_CAEEL RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Caenorhabditis 
elegans]
 dbj|BAA75067.1| Vha11 protein [Caenorhabditis elegans]
 emb|CCD66967.1| VHA-11, isoform a [Caenorhabditis elegans]
Length=384

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 115/178 (65%), Gaps = 5/178 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            Y TL+S VVP SSK L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ ET ++
Sbjct  203  YATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETLKA  262

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             + E +KLM +++   + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V
Sbjct  263  GRTERDKLMAEKQRQYAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAV  322

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            + P+   +K++R  L  L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  323  IEPAKGQQKKLRQELHKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  379



>ref|XP_011687853.1| PREDICTED: V-type proton ATPase subunit C [Wasmannia auropunctata]
 ref|XP_011687854.1| PREDICTED: V-type proton ATPase subunit C [Wasmannia auropunctata]
Length=387

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 6/180 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E   +
Sbjct  201  YEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFTYNEEELAA  260

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++
Sbjct  261  GKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAIL  320

Query  449  lspsvkSEKRVRSILESL---CDSS--NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            L P  K  +R+R  L  L    DSS   ST   ++D   +   G G ++  PYV + IN+
Sbjct  321  LHPHKKCARRLRDALNQLYAHLDSSATGSTAQHSQDNVDIPGLGFGQSDYFPYVYYKINV  380



>ref|XP_001946227.1| PREDICTED: V-type proton ATPase subunit C [Acyrthosiphon pisum]
 ref|XP_008181338.1| PREDICTED: V-type proton ATPase subunit C [Acyrthosiphon pisum]
Length=387

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 112/184 (61%), Gaps = 12/184 (7%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE LT  +VPRSS+ + +DN+Y L+TVTLF + A+ F+  ARER F +R+F YN     
Sbjct  200  NYEKLTDMIVPRSSQLVSQDNDYGLFTVTLFKKVAEEFKHHARERKFIVREFTYNEVELA  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  AGKNEISKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG---------GDAEVHPYVSF  300
            +L P+ K+ KR+R +L  L    +S+    +  GA GA           G AE  PYV +
Sbjct  320  LLHPNKKNTKRLRDVLHQLYGHLDSS---AQQGGATGAHDSVDIPGLGFGQAEYFPYVYY  376

Query  299  TINL  288
             IN+
Sbjct  377  KINI  380



>ref|XP_010751636.1| PREDICTED: V-type proton ATPase subunit C 1-A [Larimichthys crocea]
Length=382

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKLLFEDNDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>emb|CAF93730.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=366

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 108/175 (62%), Gaps = 2/175 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  LYED++  LY+VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  183  TYETLAEMVVPRSSDLLYEDSDSGLYSVTLFMKAVDDFKHKARENKFVVRDFQYNEEEMK  242

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  243  ADKEEMTRLCTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  302

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTI  294
            +L P+ K+ KR+R +L  L    +S+     D      G      E +PYV + I
Sbjct  303  LLQPNKKTMKRLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKI  357



>ref|XP_002645132.1| C. briggsae CBR-VHA-11 protein [Caenorhabditis briggsae]
 sp|Q612A4.1|VATC_CAEBR RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Caenorhabditis 
briggsae]
 emb|CAP34690.1| Protein CBR-VHA-11 [Caenorhabditis briggsae]
Length=385

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 115/178 (65%), Gaps = 5/178 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            Y TL+S VVP SSK L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ ET ++
Sbjct  204  YATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNIARENKFIVRDFVYDEETLKA  263

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             + E +KL+ +++   + L++W   ++GE+FS+++H  A+RVF ES+LRYGLP +F + V
Sbjct  264  GRTERDKLLAEKQKQYAPLIRWLKINFGEIFSAYIHIKALRVFVESVLRYGLPVNFQAAV  323

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            + P+    K++R  L+ L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  324  IEPAKGQSKKLRQELQKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  380



>ref|XP_008211658.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Nasonia 
vitripennis]
Length=388

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 111/183 (61%), Gaps = 7/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRSS+ + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E  
Sbjct  199  AMYEKLTDMIVPRSSQLINQDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFT  297
            ++L P  KS KR+R +L  L    DSS     +    +D   +   G G ++  PYV + 
Sbjct  319  ILLRPHKKSTKRLRDVLNQLYAHLDSSATAGGSQSGNQDSVDIPGLGFGQSDYFPYVYYK  378

Query  296  INL  288
            IN+
Sbjct  379  INV  381



>gb|ABO61291.1| vacuolar ATPase subunit C [Lutzomyia longipalpis]
Length=386

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE LT  +VPRS++ + +D ++ALYTVTLF +  D F++ ARE+ F +R+F YN E   +
Sbjct  201  YEKLTDMIVPRSTQCITQDQDFALYTVTLFKKVVDEFKLHAREKKFVVREFTYNEEELAA  260

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++
Sbjct  261  GKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAIL  320

Query  449  lspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            + P  KS KR+R +L  L      S+ S+     D   +   G G +E +PYV + +N+
Sbjct  321  IHPHKKSTKRLRDVLNQLYGHLDGSAASSGGSNADNVDIPGLGFGQSEYYPYVYYKLNI  379



>ref|XP_003444114.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Oreochromis 
niloticus]
Length=382

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K L+EDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKLLFEDNDSGLFSVTLFRKAVDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_001647617.1| AAEL015594-PA, partial [Aedes aegypti]
 gb|EAT32285.1| AAEL015594-PA, partial [Aedes aegypti]
Length=299

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 106/166 (64%), Gaps = 9/166 (5%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRSS+ + +DN+YAL TVTLF +  D F++ ARER F +R+F YN E  
Sbjct  143  ANYEKITDMIVPRSSQLITQDNDYALCTVTLFKKVVDEFKLHARERKFVVREFTYNEEEL  202

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  203  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  262

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEV  318
            +++ P+ K+ KR+R +L  L             +G+  + GG+A+V
Sbjct  263  ILIHPNKKNTKRLRDVLMQLYGHL---------DGSAASSGGNADV  299



>ref|XP_007886138.1| PREDICTED: V-type proton ATPase subunit C 1 [Callorhinchus milii]
Length=382

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 4/177 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSSK +Y+DN+  LY VTLF +  D+FR++ARE  F +R+F+YN E  +
Sbjct  200  TYETLADMVVPRSSKLIYDDNDSGLYNVTLFRKAVDDFRLQARENKFVVREFQYNEEELK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTIN  291
            +L PS K  K++R +L  L    +S+     D  A+   G      E +PYV + I+
Sbjct  320  LLQPSKKMMKKLREVLYDLYKHLDSSAASIID-AAIDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_001960901.1| GF11269 [Drosophila ananassae]
 gb|EDV37723.1| GF11269 [Drosophila ananassae]
Length=388

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 111/180 (62%), Gaps = 5/180 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE +T  +VPRSS+ + EDN+Y L+ VTLF + A+ F++ ARER F +RDF YN E   
Sbjct  201  NYEKITDMIVPRSSQLIQEDNDYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELA  260

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ KLM D++     L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++
Sbjct  261  AGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAI  320

Query  452  vlspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            ++ P+ KS KR+R +L  L      +S      + D   +   G G +E +PYV + +N+
Sbjct  321  LIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYYPYVFYKVNI  380



>ref|XP_011504284.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Ceratosolen 
solmsi marchali]
Length=542

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 7/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRSS+ + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E  
Sbjct  353  AMYEKLTDMIVPRSSQLIIQDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEEL  412

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  413  AAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  472

Query  455  vvlspsvkSEKRVRSILESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFT  297
            ++L P  KS KR+R +L  L    DSS    S+    +D   +   G G ++  PYV + 
Sbjct  473  ILLRPHKKSTKRLRDVLNQLYAHLDSSATAGSSQSSNQDSVDIPGLGFGQSDYFPYVYYK  532

Query  296  INL  288
            IN+
Sbjct  533  INV  535



>ref|XP_003094835.1| CRE-VHA-11 protein [Caenorhabditis remanei]
 gb|EFO90482.1| CRE-VHA-11 protein [Caenorhabditis remanei]
Length=386

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + Y TL+S VVP SSK L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ ET 
Sbjct  203  SKYATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETL  262

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ++ + E +KL  +++   + L++W   ++GE+FS+++H  A+RVF ES+LRYGLP +F +
Sbjct  263  KAGRTERDKLQAEKQRQYAPLIRWLKINFGEIFSAYIHIKALRVFVESVLRYGLPVNFQA  322

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             V+ P+   +K++R  L  L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  323  AVIEPAKGQQKKLRQELHKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  381



>sp|Q9U5N1.1|VATC_MANSE RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Manduca 
sexta]
 emb|CAB55498.1| vacuolar ATPase subunit C [Manduca sexta]
Length=385

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 112/181 (62%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRS++ +++D +Y L+TVTLF +  D F++ ARER F +R+F YN    
Sbjct  198  ANYEKITDMIVPRSTQLIHQDGDYGLFTVTLFKKVVDEFKLHARERKFVVREFAYNEADL  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  258  VAGKNEITKLLTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  317

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFG-GDAEVHPYVSFTIN  291
             +L PS +S +R+R  L +L    D S   +    +D   +   G G +E +PYV + IN
Sbjct  318  ALLVPSRRSARRLRDTLHALYAHLDHSAHHHANAQQDSVELAGLGFGQSEYYPYVFYKIN  377

Query  290  L  288
            +
Sbjct  378  I  378



>ref|XP_008290531.1| PREDICTED: V-type proton ATPase subunit C 1 [Stegastes partitus]
Length=383

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  L+EDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  AYETLAEMVVPRSSNLLFEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPNKKTLKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|NP_001040138.1| vacuolar ATPase subunit C [Bombyx mori]
 gb|ABD36144.1| vacuolar ATPase subunit C [Bombyx mori]
Length=386

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRS++ +++DN+Y L+TVTLF + AD F++ ARER F +R+F YN    
Sbjct  198  ANYEKITDMIVPRSTQLVHQDNDYGLFTVTLFKKVADEFKLHARERKFVVREFAYNEADL  257

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  258  LAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  317

Query  455  vvlspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            VV+ P+ KS K++R +L  L      S+++      D   +   G G +E  PYV + IN
Sbjct  318  VVMVPARKSMKKLRDLLNQLYAHLDHSAHAHSAAAPDSVELAGLGFGQSEYFPYVFYKIN  377

Query  290  L  288
            +
Sbjct  378  I  378



>gb|EHJ73191.1| hypothetical protein KGM_01090 [Danaus plexippus]
Length=451

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 115/181 (64%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRS++ +++DN+Y L+TVTLF +  D F++ ARER F +R+F YN    
Sbjct  265  ANYEKITDMIVPRSTQLVHQDNDYGLFTVTLFRKVVDEFKLHARERKFIVREFSYNEADL  324

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ +L+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +FL+
Sbjct  325  AAGKNEITRLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFLA  384

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWK-TEDEGAVGAFG-GDAEVHPYVSFTIN  291
            VV+ P+ KS K++R +L+ L    D S   +    +D   +   G G ++  PYV + IN
Sbjct  385  VVMVPARKSMKKLRDVLQHLYAHLDHSAQQHGHAAQDNAELAGLGFGQSDYFPYVFYKIN  444

Query  290  L  288
            +
Sbjct  445  I  445



>ref|XP_012137366.1| PREDICTED: V-type proton ATPase subunit C [Megachile rotundata]
 ref|XP_012137367.1| PREDICTED: V-type proton ATPase subunit C [Megachile rotundata]
 ref|XP_012137368.1| PREDICTED: V-type proton ATPase subunit C [Megachile rotundata]
 ref|XP_012137369.1| PREDICTED: V-type proton ATPase subunit C [Megachile rotundata]
Length=386

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 111/181 (61%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT+ +VPRS++ + +D +Y L+TVTLF +  D F++ ARE+ F +RDF YN E  
Sbjct  199  SGYEKLTNMIVPRSTQLITQDADYGLFTVTLFKKVIDEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            ++L P  K  +R+R +L  L    DSS  S+    +D   +   G G  +  PYV + IN
Sbjct  319  ILLHPHKKCARRLRDVLNQLYAHLDSSATSSTQGNQDSVDIPGLGFGQNDYFPYVYYKIN  378

Query  290  L  288
            +
Sbjct  379  V  379



>ref|XP_011144745.1| PREDICTED: V-type proton ATPase subunit C [Harpegnathos saltator]
 ref|XP_011144746.1| PREDICTED: V-type proton ATPase subunit C [Harpegnathos saltator]
 gb|EFN81041.1| Vacuolar proton pump subunit C [Harpegnathos saltator]
Length=388

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 112/183 (61%), Gaps = 7/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPR+++ + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E  
Sbjct  199  SGYEKLTDMIVPRTTQLITQDSEYGLFTVTLFKKVIDEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFT  297
            ++L P  K  +R+R +L  L    DSS   ++     +D   +   G G ++  PYV + 
Sbjct  319  ILLHPHKKCARRLRDVLNQLYAHLDSSATASTAAQHNQDNVDIPGLGFGQSDYFPYVYYK  378

Query  296  INL  288
            IN+
Sbjct  379  INV  381



>gb|ETN59245.1| vacuolar ATP synthase subunit C [Anopheles darlingi]
Length=635

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 112/180 (62%), Gaps = 4/180 (2%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE +T  +VPRSS+ + +D +YAL +VTLF +  D F++ ARER F +R+F YN E  
Sbjct  449  AHYEKITDMIVPRSSQMITQDADYALCSVTLFKKVVDEFKLHARERKFVVREFVYNEEEL  508

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  509  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFGAWVHVKALRVFVESVLRYGLPVNFQA  568

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            +++ P+ KS KR+R +L+ L    D S ++     D   +   G G +E  PYV + +N+
Sbjct  569  ILIHPNKKSTKRLRDVLQQLYGHLDGSAASSGGNADNVDIPGLGFGQSEYFPYVYYKLNV  628



>ref|XP_011631232.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Pogonomyrmex 
barbatus]
Length=386

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 111/181 (61%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E  
Sbjct  199  SCYEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            ++L P  K  +R+R  L  L    DSS  ++    +D   +   G G ++  PYV + IN
Sbjct  319  ILLHPHKKCARRLRDALNQLYAHLDSSATASTVHNQDNVDIPGLGFGQSDYFPYVYYKIN  378

Query  290  L  288
            +
Sbjct  379  V  379



>ref|XP_007249407.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Astyanax 
mexicanus]
Length=380

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 113/178 (63%), Gaps = 5/178 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL+  VVPRSS  L+ED +  L++VTLF +  D+F+ +ARE  F +RDF+YN E  +
Sbjct  199  TYETLSEMVVPRSSNLLFEDQDSGLFSVTLFRKAIDDFKHQARENKFAVRDFQYNEEEMK  258

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  259  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFTESVLRYGLPVNFQAM  318

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            +L P+ K+ K++R +L+ L    DSS +    + D    G      E +PYV + I+L
Sbjct  319  LLQPNKKNMKKLREVLQELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKIDL  374



>gb|EFX90034.1| hypothetical protein DAPPUDRAFT_205240 [Daphnia pulex]
Length=385

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 106/176 (60%), Gaps = 2/176 (1%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE LT  VVPRSS+ + +D E AL TVTLF +  D F+  ARE  F +RDF YN E   +
Sbjct  201  YEKLTPMVVPRSSQLVTQDGENALVTVTLFRKVVDEFKHHAREHKFVVRDFTYNEEELAA  260

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E+ KL  D++     L++W   ++ E F++W+H  A+RVF ES+LRYGLP +F +++
Sbjct  261  GKNEITKLATDKKKQFGPLVRWLKVNFSEGFTAWVHVKALRVFVESVLRYGLPVNFQAML  320

Query  449  lspsvkSEKRVRSILESL-CDSSNSTYWKTEDEGAV-GAFGGDAEVHPYVSFTINL  288
            L P+ KS KR+R +L  L     NS      D   + G   G +E +PYV + IN+
Sbjct  321  LQPNKKSTKRLREVLSQLYIHLDNSALQSAHDNVDIPGLVFGQSEYYPYVYYKINI  376



>gb|EZA45856.1| S-methyl-5'-thioadenosine phosphorylase-like protein-3 [Microplitis 
demolitor]
Length=556

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 112/182 (62%), Gaps = 6/182 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRS++ + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E  
Sbjct  368  AIYEKLTDMIVPRSTQLITQDAEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEEL  427

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  428  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  487

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFG---GDAEVHPYVSFTI  294
            ++L P  K  KR+R +L  L    DSS ++   + ++ +V   G   G  E  PYV + I
Sbjct  488  ILLHPHKKCTKRLRDVLNQLYAHLDSSAASGGHSANQDSVDIPGLGFGQNEYFPYVYYKI  547

Query  293  NL  288
            N+
Sbjct  548  NV  549



>emb|CDJ90591.1| ATPase domain containing protein, partial [Haemonchus contortus]
Length=225

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 116/178 (65%), Gaps = 5/178 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            Y T TS VVP S++ + E+ E+ALY+VTLF +  D F+  ARE  F +RDF Y+ E+ ++
Sbjct  43   YSTFTSMVVPGSTQLITEEGEHALYSVTLFKKVIDEFKNIARENKFIVRDFVYDEESMKA  102

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E +KL+ +++   + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + +
Sbjct  103  GKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQAAL  162

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            + P+  S+K++R+ L  L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  163  VEPTKGSQKKLRAELHKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKVNL  219



>ref|XP_011268884.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011268972.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011269062.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
 ref|XP_011269145.1| PREDICTED: V-type proton ATPase subunit C [Camponotus floridanus]
Length=387

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 111/182 (61%), Gaps = 6/182 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+T+TLF +  D F++ ARE+ F +RDF YN E  
Sbjct  199  SCYEKLTDMIVPRSTQLITQDSEYGLFTITLFKKVMDEFKLHAREKKFIVRDFIYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS--NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTI  294
            ++L P  K  +R+R +L  L    DSS   +     +D   +   G G ++  PYV + I
Sbjct  319  ILLHPHKKCARRLRDVLNQLYAHLDSSATGTPAQHNQDNLDIPGLGFGQSDYFPYVYYKI  378

Query  293  NL  288
            N+
Sbjct  379  NV  380



>gb|EFN75043.1| Vacuolar proton pump subunit C [Camponotus floridanus]
Length=402

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 111/182 (61%), Gaps = 6/182 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+T+TLF +  D F++ ARE+ F +RDF YN E  
Sbjct  214  SCYEKLTDMIVPRSTQLITQDSEYGLFTITLFKKVMDEFKLHAREKKFIVRDFIYNEEEL  273

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  274  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  333

Query  455  vvlspsvkSEKRVRSILESL---CDSS--NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTI  294
            ++L P  K  +R+R +L  L    DSS   +     +D   +   G G ++  PYV + I
Sbjct  334  ILLHPHKKCARRLRDVLNQLYAHLDSSATGTPAQHNQDNLDIPGLGFGQSDYFPYVYYKI  393

Query  293  NL  288
            N+
Sbjct  394  NV  395



>ref|XP_010771260.1| PREDICTED: V-type proton ATPase subunit C 1 [Notothenia coriiceps]
Length=382

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE+L+  VVPRS+K L+EDN+  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYESLSEMVVPRSTKLLFEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +      D    G      E +PYV + ++
Sbjct  320  LLQPNKKNMKKLREVLNELYKHLDSSAAIIDAVMD--IPGLNLSQQEYYPYVYYKLD  374



>ref|XP_011414828.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
 ref|XP_011414829.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
Length=383

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 112/180 (62%), Gaps = 6/180 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE+LT  VVPRSS+ L+ED+E  L +VTLF + A++FR + RE  F +RDF YN +  
Sbjct  199  AKYESLTDMVVPRSSRTLFEDDENCLCSVTLFRKVAEDFRNRCRENRFMVRDFTYNEKDI  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
               K E+ KL  D++     L++W   ++GE FS+W+H  A+R+F ES+LRYGLP +FL+
Sbjct  259  ADGKMEISKLEDDKKKQYGPLVKWLKVNFGEAFSAWIHVKALRIFVESVLRYGLPVNFLA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSSNST-YWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            V++ P  K+ +++R ++  L    DS  S    + E  G VG    + + +PYV + I L
Sbjct  319  VLIQPHKKTTRKLREVMNQLYAHLDSPASQDAGQMEIPGLVGI--SNVDYYPYVYYKIGL  376



>gb|ACO11255.1| Vacuolar proton pump subunit C [Caligus rogercresseyi]
Length=384

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 109/174 (63%), Gaps = 0/174 (0%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE LT  + PRSS+ +++D+++AL  V+LF +  D+F+ KARE  F +RDF Y+P+  E+
Sbjct  202  YEKLTPMIAPRSSQLIFQDSDHALVNVSLFRKVVDDFKFKAREHKFIVRDFVYDPDELEA  261

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E+ KL  D++     L++W   ++ E F S +H  A+RVF ES+LR+GLP +F +++
Sbjct  262  GKCEITKLTTDKKKQFGPLVRWLRVNFSEAFISCIHVKALRVFVESVLRFGLPVNFQAML  321

Query  449  lspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            L P  K++K++R +L +L    +S+    E        G + E +PYV + IN+
Sbjct  322  LLPQKKTQKKLRDVLNNLYSHLDSSGGVNEPMDIPAGLGFNQEYYPYVYYKINI  375



>ref|XP_002940167.1| PREDICTED: V-type proton ATPase subunit C 2 [Xenopus (Silurana) 
tropicalis]
Length=381

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 108/178 (61%), Gaps = 3/178 (2%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE+L+  VVPRS+K + ED E  L+TVTLF +  D+F+ KARE  F +R+F +N +  +
Sbjct  199  TYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQ  258

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            S K E+ KL  D++     LL+W   ++ E F  W+H  A+RVF ES+LRYGLP +F +V
Sbjct  259  SEKAEIVKLAADKKQLYGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAV  318

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            VL P+ KS KR+R +L ++    D + +   K       G      + +PYV F I+L
Sbjct  319  VLQPNKKSMKRLRDVLNAIFRHLDENAAANMKDIGMEIPGLQLSSQDYYPYVCFKIDL  376



>ref|XP_008329974.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Cynoglossus 
semilaevis]
Length=382

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K L+EDN+  L++VTLF +  D+F+ KARE  F +RDF YN E  +
Sbjct  200  TYETLAEMVVPRSTKLLFEDNDNGLFSVTLFRKAVDDFKHKARENKFTVRDFYYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_003055517.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
 gb|EEH60769.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
Length=365

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 104/177 (59%), Gaps = 7/177 (4%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            SYETL  +VVPRSSK + ED EYALYTVTLF R  D F+  A E+ FQ+R+F YN ET +
Sbjct  194  SYETLAHFVVPRSSKLIKEDEEYALYTVTLFHRVVDAFKSAAHEKSFQVREFHYNAETIQ  253

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            S   E    +++ E   ++L   C   Y  V S W+H CA+R+F ES+LRYGLPP+FL+ 
Sbjct  254  SEASERNDRVREVEERSAALDSLCRACYRNVISDWIHVCAIRIFVESVLRYGLPPNFLAC  313

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKT--EDEGAVGAFGGDAEVHPYVSFTINL  288
            ++ P  KSE ++R IL+          W    EDE            +PYVSF + L
Sbjct  314  IIKPHKKSEIKLRWILQDWLGHGALLNWDIFPEDEKR-----NMERSYPYVSFALIL  365



>gb|EKC32287.1| V-type proton ATPase subunit C 1 [Crassostrea gigas]
Length=419

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 112/180 (62%), Gaps = 6/180 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE+LT  VVPRSS+ L+ED+E  L +VTLF + A++FR + RE  F +RDF YN +  
Sbjct  235  AKYESLTDMVVPRSSRTLFEDDENCLCSVTLFRKVAEDFRNRCRENRFMVRDFTYNEKDI  294

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
               K E+ KL  D++     L++W   ++GE FS+W+H  A+R+F ES+LRYGLP +FL+
Sbjct  295  ADGKMEISKLEDDKKKQYGPLVKWLKVNFGEAFSAWIHVKALRIFVESVLRYGLPVNFLA  354

Query  455  vvlspsvkSEKRVRSILESL---CDSSNST-YWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            V++ P  K+ +++R ++  L    DS  S    + E  G VG    + + +PYV + I L
Sbjct  355  VLIQPHKKTTRKLREVMNQLYAHLDSPASQDAGQMEIPGLVGI--SNVDYYPYVYYKIGL  412



>ref|XP_008321927.1| PREDICTED: V-type proton ATPase subunit C 1 [Cynoglossus semilaevis]
Length=383

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  L+EDN+  L+ VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSSNLLFEDNDSGLFCVTLFRKALDDFKHKARENKFIVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLCTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_011067212.1| PREDICTED: V-type proton ATPase subunit C [Acromyrmex echinatior]
Length=387

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 110/181 (61%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E  
Sbjct  200  SCYEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFTYNEEEL  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  260  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  319

Query  455  vvlspsvkSEKRVRSILESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            ++L P  K  +R+R  L  L    DSS  ++    +D   +   G G  +  PYV + IN
Sbjct  320  ILLHPHKKCARRLRDALNQLYAHLDSSATASTAHNQDNVDIPGLGFGQNDYFPYVYYKIN  379

Query  290  L  288
            +
Sbjct  380  V  380



>ref|XP_009170324.1| hypothetical protein T265_06723 [Opisthorchis viverrini]
 gb|KER25916.1| hypothetical protein T265_06723 [Opisthorchis viverrini]
Length=413

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 112/179 (63%), Gaps = 5/179 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            +SY TLT  VVP SS+ L+ED +  L+TVTLF +  ++F+ + RER F +RDFEY+ +  
Sbjct  231  SSYATLTDMVVPNSSELLFEDQDNGLWTVTLFRKMIEDFKNRCRERRFIVRDFEYDEKKI  290

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  K EL KL  D++   + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +
Sbjct  291  EEGKTELSKLESDKKRQFAPLFRWLKINFGEAFSAMVHTKALRVFVESVLRYGLPVDFQA  350

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            V++ P+ K+ KR+R +L  L    DS+ S+    E+   VG      + +PYVSF + L
Sbjct  351  VLIQPNKKAHKRLRELLRQLYSHLDSTASSNVVDEEIALVGV--SPVDYYPYVSFKVEL  407



>gb|EGI57447.1| V-type proton ATPase subunit C [Acromyrmex echinatior]
Length=386

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 110/181 (61%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E  
Sbjct  199  SCYEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            ++L P  K  +R+R  L  L    DSS  ++    +D   +   G G  +  PYV + IN
Sbjct  319  ILLHPHKKCARRLRDALNQLYAHLDSSATASTAHNQDNVDIPGLGFGQNDYFPYVYYKIN  378

Query  290  L  288
            +
Sbjct  379  V  379



>gb|EGT48628.1| CBN-VHA-11 protein [Caenorhabditis brenneri]
Length=384

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 114/178 (64%), Gaps = 5/178 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            Y TL+S VVP SSK L E+ E+ALYTVTLF +  D F+  ARE  F +RDF Y+ E  ++
Sbjct  203  YATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARESKFIVRDFVYDEEALKA  262

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             + E +KL+ +++   + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V
Sbjct  263  GRTERDKLLSEKQRQYAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAV  322

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            + P+   +K++R  L  L    D S +    T ED  A+ + G + E +PYV F +N+
Sbjct  323  IEPAKGQQKKLRQELNKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNI  379



>ref|XP_005917491.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Haplochromis 
burtoni]
Length=382

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKLLFEDSDSGLFSVTLFRKAVDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_010883498.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Esox 
lucius]
Length=307

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+  L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN +   
Sbjct  125  TYETLAEMVVPRSTNLLFEDNDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEQEMN  184

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H   +RVF ES+LRYGLP +F ++
Sbjct  185  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKGLRVFVESVLRYGLPVNFQAM  244

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  245  LLQPNKKNLKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  300



>gb|EPB69204.1| v-ATPase subunit C [Ancylostoma ceylanicum]
 gb|EYC06044.1| hypothetical protein Y032_0078g1163 [Ancylostoma ceylanicum]
Length=384

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            Y T TS VVP SS+ + E+ E+ALY+VTLF +  D F++ ARE  F +RDF Y+ E+ ++
Sbjct  202  YATFTSMVVPGSSRLITEEGEHALYSVTLFKKVIDEFKMVARENKFIVRDFVYDEESLKA  261

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E +KL+ +++   + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V
Sbjct  262  GKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQAAV  321

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            + PS  S+K++R+ L  L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  322  VEPSKGSQKKLRAELHKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNL  378



>ref|XP_005728447.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pundamilia 
nyererei]
 ref|XP_006787870.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Neolamprologus 
brichardi]
Length=382

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKLLFEDSDSGLFSVTLFRKAVDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYDLYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_010898239.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Esox lucius]
Length=381

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 110/176 (63%), Gaps = 5/176 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETL+  VVPRS+  L+ED++  L++VTLF +  D+FR KARE  F +RDF+YN +   +
Sbjct  201  YETLSEMVVPRSTNLLFEDHDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEQEMNA  260

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +++
Sbjct  261  DKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAML  320

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            L P+ K+ K++R +L  L    DSS S    T D    G      E +PYV + I+
Sbjct  321  LQPNKKNIKKLREVLSELYKHLDSSASIIDATMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_010744926.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Larimichthys 
crocea]
Length=383

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  L+ED +  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSSHLLFEDQDSGLFSVTLFMKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPNKKTMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_008304955.1| PREDICTED: V-type proton ATPase subunit C 1-A [Stegastes partitus]
Length=382

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTKLLFEDHDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    DSS +    + D    G      E +PYV + I+
Sbjct  320  LLQPNKKNMKKLREVLYELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKID  374



>ref|XP_006219905.1| PREDICTED: V-type proton ATPase subunit C-like, partial [Vicugna 
pacos]
Length=375

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 117/180 (65%), Gaps = 5/180 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A Y T TS VVP S++ + E+ E+ALY+VTLF +  D F+  ARE  F +RDF Y+ E+ 
Sbjct  195  ARYSTFTSMVVPGSTQLITEEGEHALYSVTLFKKVIDEFKTIARENKFVVRDFVYDEESL  254

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            ++ K E +KL+ +++   + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F +
Sbjct  255  KAGKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQA  314

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
             ++ P+  S+K++R+ L  L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  315  ALVEPTKGSQKKLRAELHKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKVNL  373



>ref|XP_011332476.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Cerapachys 
biroi]
Length=339

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 111/183 (61%), Gaps = 7/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ +RE+ F +RDF YN E  
Sbjct  150  SGYEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVIDEFKLHSREKKFIVRDFTYNEEEL  209

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  210  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  269

Query  455  vvlspsvkSEKRVRSILESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFT  297
            ++L P  K  +R+R  L  L    DSS   ++     +D   +   G G ++  PYV + 
Sbjct  270  ILLHPHKKCARRLRDALNQLYAHLDSSATASTAAQHNQDNVDIPGLGFGQSDYFPYVYYK  329

Query  296  INL  288
            IN+
Sbjct  330  INV  332



>ref|XP_005803508.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=383

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSSNLLFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L PS K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPSKKTMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_007550566.1| PREDICTED: V-type proton ATPase subunit C 1-A isoform X1 [Poecilia 
formosa]
Length=383

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSSNLLFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L PS K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPSKKTMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_007550565.1| PREDICTED: V-type proton ATPase subunit C 1-A [Poecilia formosa]
 ref|XP_007550567.1| PREDICTED: V-type proton ATPase subunit C 1-A isoform X2 [Poecilia 
formosa]
Length=383

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSSNLLFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L PS K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPSKKTMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_003965909.1| PREDICTED: V-type proton ATPase subunit C 1 [Takifugu rubripes]
Length=383

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 108/175 (62%), Gaps = 2/175 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE+L   VVPRSS  L+ED++  LY+VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  TYESLAEMVVPRSSDLLFEDSDSGLYSVTLFMKAVDDFKHKARENKFIVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMARLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTI  294
            +L P+ K+ K++R +L  L    +S+     D      G      E +PYV + I
Sbjct  320  LLQPNKKTMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKI  374



>gb|EYC06045.1| hypothetical protein Y032_0078g1163 [Ancylostoma ceylanicum]
Length=423

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            Y T TS VVP SS+ + E+ E+ALY+VTLF +  D F++ ARE  F +RDF Y+ E+ ++
Sbjct  241  YATFTSMVVPGSSRLITEEGEHALYSVTLFKKVIDEFKMVARENKFIVRDFVYDEESLKA  300

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E +KL+ +++   + L++W   ++GE+F++++H  A+RVF ES+LRYGLP +F + V
Sbjct  301  GKSERDKLVAEKQRQYAPLIRWLKINFGEIFAAYIHVKALRVFVESVLRYGLPVNFQAAV  360

Query  449  lspsvkSEKRVRSILESL---CDSSNSTYWKT-EDEGAVGAFGGDAEVHPYVSFTINL  288
            + PS  S+K++R+ L  L    D S +    T ED  A+ + G + E +PYV F +NL
Sbjct  361  VEPSKGSQKKLRAELHKLYIHLDGSAAGPIDTLEDSPALMSLGVN-EYYPYVFFKLNL  417



>ref|XP_011332474.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Cerapachys 
biroi]
 ref|XP_011332475.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Cerapachys 
biroi]
 gb|EZA58381.1| V-type proton ATPase subunit C [Cerapachys biroi]
Length=388

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 111/183 (61%), Gaps = 7/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ +RE+ F +RDF YN E  
Sbjct  199  SGYEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVIDEFKLHSREKKFIVRDFTYNEEEL  258

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  259  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  318

Query  455  vvlspsvkSEKRVRSILESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFT  297
            ++L P  K  +R+R  L  L    DSS   ++     +D   +   G G ++  PYV + 
Sbjct  319  ILLHPHKKCARRLRDALNQLYAHLDSSATASTAAQHNQDNVDIPGLGFGQSDYFPYVYYK  378

Query  296  INL  288
            IN+
Sbjct  379  INV  381



>ref|XP_011631231.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Pogonomyrmex 
barbatus]
Length=504

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 111/181 (61%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            + YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E  
Sbjct  317  SCYEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFTYNEEEL  376

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  377  AAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  436

Query  455  vvlspsvkSEKRVRSILESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            ++L P  K  +R+R  L  L    DSS  ++    +D   +   G G ++  PYV + IN
Sbjct  437  ILLHPHKKCARRLRDALNQLYAHLDSSATASTVHNQDNVDIPGLGFGQSDYFPYVYYKIN  496

Query  290  L  288
            +
Sbjct  497  V  497



>ref|XP_003459431.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004560058.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Maylandia 
zebra]
 ref|XP_005464958.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005742954.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pundamilia 
nyererei]
 ref|XP_005930197.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005930198.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Haplochromis burtoni]
Length=383

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRSS  L+ED++  L++VTLF +  D+F+ KARE  F +RDF+YN E  +
Sbjct  200  AYETLAEMVVPRSSHLLFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPNKKTMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_002015982.1| GL11349 [Drosophila persimilis]
 gb|EDW31872.1| GL11349 [Drosophila persimilis]
Length=388

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 111/181 (61%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRS++ + ED++Y L+ VTLF +  + F++ ARER F +RDF YN E  
Sbjct  200  ANYEKITDMIVPRSTQLIQEDSDYCLFNVTLFKKVTEEFKLHARERKFIVRDFVYNEEEL  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KLM D++     L++W   ++ E F + +H  A+RVF ES+LRYGLP +F +
Sbjct  260  AAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQA  319

Query  455  vvlspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            +++ P+ KS KR+R +L  L      +S      + D   +   G G +E +PYV + +N
Sbjct  320  ILIEPNKKSVKRLRDVLNQLYGHLDGASAGGQVSSADNVDIPGLGFGQSEYYPYVFYKVN  379

Query  290  L  288
            +
Sbjct  380  I  380



>ref|XP_008211656.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Nasonia 
vitripennis]
 ref|XP_008211657.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Nasonia 
vitripennis]
Length=655

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 111/183 (61%), Gaps = 7/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  +VPRSS+ + +D EY L+TVTLF +  + F++ ARE+ F +RDF YN E  
Sbjct  466  AMYEKLTDMIVPRSSQLINQDQEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEEL  525

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KL+ D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F +
Sbjct  526  AAGKNEMTKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQA  585

Query  455  vvlspsvkSEKRVRSILESL---CDSS---NSTYWKTEDEGAVGAFG-GDAEVHPYVSFT  297
            ++L P  KS KR+R +L  L    DSS     +    +D   +   G G ++  PYV + 
Sbjct  586  ILLRPHKKSTKRLRDVLNQLYAHLDSSATAGGSQSGNQDSVDIPGLGFGQSDYFPYVYYK  645

Query  296  INL  288
            IN+
Sbjct  646  INV  648



>gb|AAB62571.1| V-ATPase C subunit [Drosophila melanogaster]
Length=388

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 109/180 (61%), Gaps = 5/180 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE +T  +VPRSS+ + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   
Sbjct  201  NYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELA  260

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ KLM D++     L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++
Sbjct  261  AGKNEMPKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAI  320

Query  452  vlspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            ++ P+ KS KR+R +L  L      +S      + D   +   G G +E  PYV + +N+
Sbjct  321  LIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  380



>gb|KFH72569.1| hypothetical protein MVEG_02858 [Mortierella verticillata NRRL 
6337]
Length=392

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 113/183 (62%), Gaps = 9/183 (5%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETLT  VVPRSS K+ ED+EY L+TVTLFTR  ++F  K RE  F +RDF+Y+ +  E 
Sbjct  204  YETLTQMVVPRSSTKIAEDDEYGLFTVTLFTRIVEDFTNKCREERFIVRDFKYSEDAIEE  263

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
            +K+EL+++   ++   +++L+   T++GEVF +W H  ++RVF ES+LRYGLPP F+   
Sbjct  264  QKRELQEMDASEKELWATILRLAKTNFGEVFQAWTHLKSLRVFVESVLRYGLPPDFVGFT  323

Query  449  lspsvkSEKRVRSILES----LCDSSNS---TYWKTEDEGAVGAFGG--DAEVHPYVSFT  297
            + P  K E ++  IL +    L  S ++       +++E A  A  G  D +  P+V F 
Sbjct  324  IKPKPKQEAKILDILTAQYGHLGGSPSNRGGISKGSQEESAEDAIAGFNDKDYRPFVFFA  383

Query  296  INL  288
            + L
Sbjct  384  LRL  386



>ref|XP_002107808.1| hypothetical protein TRIADDRAFT_19844 [Trichoplax adhaerens]
 gb|EDV28606.1| hypothetical protein TRIADDRAFT_19844 [Trichoplax adhaerens]
Length=379

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 109/177 (62%), Gaps = 2/177 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE L   +VPRSSKK+YEDNE+AL++VTLF +  D F+  AR+  F +RDF+YN    +
Sbjct  197  NYEKLCDMIVPRSSKKIYEDNEHALFSVTLFNKVIDEFKHHARDNRFIVRDFKYNEAEVQ  256

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ +L  D++     L++W  T++GE   +++H   +R+F ES+LRYGLP +F + 
Sbjct  257  AGKSEITRLEADKKKQFGPLMRWLKTNFGECVIAFVHIKVLRLFVESVLRYGLPVNFQAA  316

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEG--AVGAFGGDAEVHPYVSFTINL  288
            +L P+ KS KR+R  L +L    +ST     D G    G      + +PYV F +N+
Sbjct  317  LLLPTKKSSKRLREALMNLYRHLDSTANTNLDIGFEIPGVTTQQGDYYPYVYFPVNV  373



>ref|XP_001360460.2| GA20788 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL25035.2| GA20788 [Drosophila pseudoobscura pseudoobscura]
Length=448

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 111/181 (61%), Gaps = 5/181 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE +T  +VPRS++ + ED++Y L+ VTLF +  + F++ ARER F +RDF YN E  
Sbjct  260  ANYEKITDMIVPRSTQLIQEDSDYCLFNVTLFKKVTEEFKLHARERKFIVRDFVYNEEEL  319

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K E+ KLM D++     L++W   ++ E F + +H  A+RVF ES+LRYGLP +F +
Sbjct  320  AAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQA  379

Query  455  vvlspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTIN  291
            +++ P+ KS KR+R +L  L      +S      + D   +   G G +E +PYV + +N
Sbjct  380  ILIEPNKKSVKRLRDVLNQLYGHLDGASAGGQVSSADNVDIPGLGFGQSEYYPYVFYKVN  439

Query  290  L  288
            +
Sbjct  440  I  440



>ref|XP_010883497.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Esox 
lucius]
Length=382

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+  L+EDN+  L++VTLF +  D+FR KARE  F +RDF+YN +   
Sbjct  200  TYETLAEMVVPRSTNLLFEDNDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEQEMN  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H   +RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKGLRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L P+ K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPNKKNLKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLNLSQQEYYPYVYYKID  375



>emb|CEG71831.1| hypothetical protein RMATCC62417_07500 [Rhizopus microsporus]
Length=382

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE+LT  VVPRSS K+ ED+E+ L+TVT+F R AD F  KARE  F  RDF+YN +  ++
Sbjct  197  YESLTDMVVPRSSIKITEDDEFGLFTVTVFQRVADEFCHKAREERFIPRDFKYNEDALQT  256

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYG  477
            +++ELE+ +Q +    + LL+   T++GEVF+SW+H  A+RVF ES+LRYG
Sbjct  257  QQRELEETIQTEREQHAELLRLAKTNFGEVFASWLHLKALRVFVESVLRYG  307



>emb|CDJ04792.1| V type proton ATPase subunit C 1 A [Echinococcus multilocularis]
 emb|CDS42074.1| V type proton ATPase subunit C 1 A [Echinococcus multilocularis]
Length=382

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 1/175 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE+L   VVPRSS+ ++ED +  L+TVTLF +  ++F ++ARE+ F +RDF Y+ +  
Sbjct  200  ATYESLVDMVVPRSSELIFEDQDNGLWTVTLFQKMLNDFTLRAREKRFIVRDFVYDEKAI  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  K    KL  D++     L +W   ++GE FS   H  A+R+F ES+LRYGLP  F +
Sbjct  260  EESKNMFSKLEADKKKQFPPLFRWLRVNFGEAFSVMTHIKALRIFVESVLRYGLPVDFEA  319

Query  455  vvlspsvkSEKRVRSILESLCDS-SNSTYWKTEDEGAVGAFGGDAEVHPYVSFTI  294
            +++ P+ K+ KR+R +L ++ +   N     T DE  VGA     E +PYVS ++
Sbjct  320  ILIVPNRKNYKRLREVLHNMYEHLDNLALSSTTDEEIVGAGMSHGEYYPYVSISV  374



>ref|XP_006636047.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Lepisosteus 
oculatus]
Length=382

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 108/176 (61%), Gaps = 2/176 (1%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+  L+ED E  L++VTLF +  D+FR KARE  F +RDF+YN E  +
Sbjct  200  TYETLAEMVVPRSTNLLFEDQESGLFSVTLFRKAVDDFRHKARENKFTVRDFQYNEEEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEGFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGA--VGAFGGDAEVHPYVSFTIN  291
            +L PS K+ K++R +L  L    +S+     D      G      E +PYV + I+
Sbjct  320  LLQPSKKTMKKLREVLYDLYKHLDSSAAAIIDASMDIPGLNLSQQEYYPYVYYKID  375



>ref|XP_003080507.1| putative vacuolar ATP synthase subunit C (ISS) [Ostreococcus 
tauri]
 emb|CAL54674.1| ATPase, V1 complex, subunit C [Ostreococcus tauri]
Length=376

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 110/177 (62%), Gaps = 1/177 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++YETL+++VVPRSSK LY + +  L TV LF R  D F   ARE G   R++ ++PE  
Sbjct  200  SNYETLSNFVVPRSSKVLYAEGDTELRTVVLFRRVVDAFINAAREIGCTAREYSHDPEAS  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
             + K + + L ++    + SL +WC  SYGE+FS+ MH C VR+F ESILRYGLPP F +
Sbjct  260  RAAKDQKDALEREFAERKESLTEWCEISYGEIFSTMMHLCTVRIFVESILRYGLPPDFQT  319

Query  455  vvlspsvkSEKRVRSILESLCDSSNSTYWKTEDEGAVGAFGGDAE-VHPYVSFTINL  288
            V++ P++K+  ++R +L        S++W  +  G     G +AE ++ YVS T+ +
Sbjct  320  VLMRPNMKNATKLRKVLNQEFGKDASSHWDDDGGGDEERTGLNAEDMYSYVSLTLKV  376



>dbj|GAA48137.1| V-type proton ATPase subunit C 1-A [Clonorchis sinensis]
Length=574

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 112/179 (63%), Gaps = 5/179 (3%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            ++Y TLT  VVP SS+ L+ED +  L+TVTLF +  ++F+ + RER F +RDFEY+ +  
Sbjct  392  SNYATLTDMVVPNSSELLFEDQDNGLWTVTLFRKMIEDFKNRCRERRFIVRDFEYDEKKI  451

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  K EL KL  D++   + L +W   ++GE FS+ +H  A+RVF ES+LRYGLP  F +
Sbjct  452  EEGKTELSKLESDKKRQFAPLFRWLKINFGEAFSAMVHTKALRVFVESVLRYGLPVDFQA  511

Query  455  vvlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTINL  288
            V++ P+ K+ KR+R +L  L    DS+ S+    E+   VG      + +PYVSF + L
Sbjct  512  VLIQPNKKAHKRLRELLRQLYSHLDSTASSNVVDEEVALVGV--SPVDYYPYVSFKVEL  568



>ref|XP_003968986.1| PREDICTED: V-type proton ATPase subunit C 1-A [Takifugu rubripes]
Length=382

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 110/177 (62%), Gaps = 5/177 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YETL   VVPRS+K L+EDN+  L++VTLF +  D+FR +ARE  F +RDF+YN    +
Sbjct  200  TYETLAEMVVPRSTKLLFEDNDSGLFSVTLFRKAIDDFRHQARENKFMVRDFQYNEVEMK  259

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K+E+ +L  D++     L++W   ++ E F +W+H  A+RVF ES+LRYGLP +F ++
Sbjct  260  ADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAM  319

Query  452  vlspsvkSEKRVRSILESL---CDSSNSTYWKTEDEGAVGAFGGDAEVHPYVSFTIN  291
            +L P  K+ K++R +L  L    DSS +    + D    G      E +PYV + ++
Sbjct  320  LLQPHKKNMKKLREVLYELYKHLDSSAAIIDASMD--IPGLNLSQQEYYPYVYYKVD  374



>emb|CDH57929.1| vacuolar atp synthase subunit c [Lichtheimia corymbifera JMRC:FSU:9682]
Length=389

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETLTS VVPRSS K+ ED+EY L++VTLF R AD F  KARE  F +RDF+Y+ +  + 
Sbjct  200  YETLTSMVVPRSSVKIAEDDEYGLFSVTLFQRVADEFVHKAREERFIVRDFKYDEDALQK  259

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYG  477
            +K EL++ +  ++  +  L +   T++GEVF+SW+H  A+RVF ES+LRYG
Sbjct  260  QKHELDETVAVEKEQQMELFRLARTNFGEVFASWIHLKALRVFVESVLRYG  310



>ref|NP_477266.1| vacuolar H[+] ATPase 44kD subunit, isoform A [Drosophila melanogaster]
 ref|NP_599140.1| vacuolar H[+] ATPase 44kD subunit, isoform B [Drosophila melanogaster]
 ref|XP_002034118.1| GM20063 [Drosophila sechellia]
 ref|XP_002081761.1| GD25545 [Drosophila simulans]
 gb|AAF58011.1| vacuolar H[+] ATPase 44kD subunit, isoform A [Drosophila melanogaster]
 gb|AAL28586.1| HL07758p [Drosophila melanogaster]
 gb|AAM27505.1| LD12844p [Drosophila melanogaster]
 gb|AAM68515.1| vacuolar H[+] ATPase 44kD subunit, isoform B [Drosophila melanogaster]
 gb|EDW48131.1| GM20063 [Drosophila sechellia]
 gb|EDX07346.1| GD25545 [Drosophila simulans]
 gb|ACL84134.1| Vha44-PA, partial [synthetic construct]
 gb|ACL89238.1| Vha44-PA [synthetic construct]
Length=388

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 109/180 (61%), Gaps = 5/180 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE +T  +VPRSS+ + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   
Sbjct  201  NYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELA  260

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ KLM D++     L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++
Sbjct  261  AGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAI  320

Query  452  vlspsvkSEKRVRSILESLC----DSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            ++ P+ KS KR+R +L  L      +S      + D   +   G G +E  PYV + +N+
Sbjct  321  LIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  380



>emb|CDH57928.1| vacuolar atp synthase subunit c [Lichtheimia corymbifera JMRC:FSU:9682]
Length=378

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YETLTS VVPRSS K+ ED+EY L++VTLF R AD F  KARE  F +RDF+Y+ +  + 
Sbjct  189  YETLTSMVVPRSSVKIAEDDEYGLFSVTLFQRVADEFVHKAREERFIVRDFKYDEDALQK  248

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYG  477
            +K EL++ +  ++  +  L +   T++GEVF+SW+H  A+RVF ES+LRYG
Sbjct  249  QKHELDETVAVEKEQQMELFRLARTNFGEVFASWIHLKALRVFVESVLRYG  299



>emb|CDS17048.1| V type proton ATPase subunit C 1 A [Echinococcus granulosus]
Length=382

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 108/175 (62%), Gaps = 1/175 (1%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A+YE+L   VVPRS++ ++ED +  L+TVTLF +  ++F ++ARE+ F +RDF Y+ +  
Sbjct  200  ATYESLVDMVVPRSTELIFEDQDNGLWTVTLFQKMLNDFTLRAREKRFIVRDFVYDEKAI  259

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsfls  456
            E  K    KL  D++     L +W   ++GE FS   H  A+R+F ES+LRYGLP  F +
Sbjct  260  EESKNMFSKLEADKKKQFPPLFRWLRVNFGEAFSVMTHIKALRIFVESVLRYGLPVDFEA  319

Query  455  vvlspsvkSEKRVRSILESLCDS-SNSTYWKTEDEGAVGAFGGDAEVHPYVSFTI  294
            +++ P+ K+ KR+R +L ++ +   N +   T DE  VGA     E +PYVS ++
Sbjct  320  ILIVPNRKNYKRLREVLHNMYEHLDNLSLSSTTDEEIVGAGMSHGEYYPYVSISV  374



>ref|XP_012061168.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C [Atta cephalotes]
Length=438

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 110/179 (61%), Gaps = 5/179 (3%)
 Frame = -1

Query  809  YETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHES  630
            YE LT  +VPRS++ + +D+EY L+TVTLF +  D F++ ARE+ F +RDF YN E   +
Sbjct  253  YEKLTDMIVPRSTQLITQDSEYGLFTVTLFKKVMDEFKLHAREKKFIVRDFIYNEEELAA  312

Query  629  RKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsvv  450
             K E+ KL+ D++     L++W   ++  +F +W+H  A+RVF ES+LRYGLP +F +++
Sbjct  313  GKNEITKLVTDKKKQFGPLVRWLKVNFXXMFCAWIHVKALRVFVESVLRYGLPVNFQAIL  372

Query  449  lspsvkSEKRVRSILESL---CDSS-NSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            L P  K  +R+R  L  L    DSS  ++    +D   +   G G ++  PYV + IN+
Sbjct  373  LHPHKKCARRLRDALNQLYAHLDSSATASTAHNQDNVDIPGLGFGQSDYFPYVYYKINV  431



>ref|NP_725564.1| vacuolar H[+] ATPase 44kD subunit, isoform C [Drosophila melanogaster]
 gb|AAF58012.1| vacuolar H[+] ATPase 44kD subunit, isoform C [Drosophila melanogaster]
Length=442

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 109/180 (61%), Gaps = 5/180 (3%)
 Frame = -1

Query  812  SYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETHE  633
            +YE +T  +VPRSS+ + ED +Y L+ VTLF + A+ F++ ARER F +RDF YN E   
Sbjct  255  NYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELA  314

Query  632  SRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlppsflsv  453
            + K E+ KLM D++     L++W   ++ E F + +H  A+RVF ES+LRYGLP +F ++
Sbjct  315  AGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAI  374

Query  452  vlspsvkSEKRVRSILES----LCDSSNSTYWKTEDEGAVGAFG-GDAEVHPYVSFTINL  288
            ++ P+ KS KR+R +L      L  +S      + D   +   G G +E  PYV + +N+
Sbjct  375  LIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNI  434



>ref|XP_003375717.1| vacuolar proton pump subunit C [Trichinella spiralis]
 gb|EFV54740.1| vacuolar proton pump subunit C [Trichinella spiralis]
Length=389

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 102/183 (56%), Gaps = 8/183 (4%)
 Frame = -1

Query  815  ASYETLTSYVVPRSSKKLYEDNEYALYTVTLFTRDADNFRIKARERGFQIRDFEYNPETH  636
            A YE LT  VVPRSSK L+EDNE  L+ VTLF +  D FR +ARE  F +RDF Y+    
Sbjct  197  AKYEGLTMMVVPRSSKLLFEDNENGLFAVTLFKKVLDEFRNRARENKFFVRDFVYDENAL  256

Query  635  ESRKQELEKLMQDQETFRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGlpps-fl  459
               K E  +L  ++      L++W   ++ E+FS+W+H  A+RVF ES+LRYGLP +   
Sbjct  257  AQGKNERNRLAAEKNKQFGPLVRWLKINFSELFSAWIHVKALRVFVESVLRYGLPVNFQA  316

Query  458  svvlspsvkSEKRVRSILESL---CDSSN---STYWKTEDEGAVGAFGGDAEVHPYVSFT  297
             ++        KR+R +L  L    D  N     +  +ED   + +F G  + +PYV F 
Sbjct  317  VLLQPNKRTFTKRLRDVLSQLYAHLDVGNLGAGNFEMSEDVSGLLSF-GQQDYYPYVFFK  375

Query  296  INL  288
            IN+
Sbjct  376  INI  378



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500