BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13662

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010108425.1|  Magnesium-chelatase subunit chlI                   299   6e-96   Morus notabilis
emb|CDP04687.1|  unnamed protein product                                296   1e-94   Coffea canephora [robusta coffee]
ref|XP_006377560.1|  hypothetical protein POPTR_0011s07720g             292   1e-94   
ref|XP_002316838.1|  Magnesium-chelatase subunit chlI family protein    292   2e-93   Populus trichocarpa [western balsam poplar]
ref|XP_011620831.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    291   2e-93   
ref|XP_010529186.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    292   4e-93   Tarenaya hassleriana [spider flower]
ref|XP_004955063.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    288   8e-93   
gb|KEH30930.1|  magnesium-chelatase subunit ChlI                        291   1e-92   Medicago truncatula
ref|XP_004977284.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    289   6e-92   Setaria italica
ref|XP_010052233.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    288   1e-91   Eucalyptus grandis [rose gum]
ref|XP_004977283.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    288   2e-91   Setaria italica
gb|KCW76166.1|  hypothetical protein EUGRSUZ_D00551                     288   2e-91   Eucalyptus grandis [rose gum]
ref|XP_010915593.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    286   5e-91   Elaeis guineensis
ref|XP_011096413.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    283   9e-90   Sesamum indicum [beniseed]
ref|XP_007025454.1|  P-loop containing nucleoside triphosphate hy...    283   1e-89   
ref|XP_009592218.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    283   2e-89   Nicotiana tomentosiformis
ref|XP_009592217.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    282   2e-89   Nicotiana tomentosiformis
gb|KJB69597.1|  hypothetical protein B456_011G032900                    276   2e-89   Gossypium raimondii
ref|XP_009804859.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    282   3e-89   Nicotiana sylvestris
ref|XP_009804860.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    282   3e-89   Nicotiana sylvestris
sp|O22436.1|CHLI_TOBAC  RecName: Full=Magnesium-chelatase subunit...    281   5e-89   Nicotiana tabacum [American tobacco]
ref|XP_002276262.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    281   8e-89   Vitis vinifera
ref|XP_012091733.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    280   1e-88   Jatropha curcas
gb|KJB69598.1|  hypothetical protein B456_011G032900                    276   3e-88   Gossypium raimondii
ref|XP_011027718.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    278   5e-88   Populus euphratica
ref|XP_006361060.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    279   5e-88   Solanum tuberosum [potatoes]
gb|KJB68387.1|  hypothetical protein B456_010G242400                    278   5e-88   Gossypium raimondii
ref|XP_004248139.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    278   8e-88   Solanum lycopersicum
ref|XP_006449465.1|  hypothetical protein CICLE_v10015348mg             276   1e-87   
gb|KJB68386.1|  hypothetical protein B456_010G242400                    277   2e-87   Gossypium raimondii
ref|XP_006449467.1|  hypothetical protein CICLE_v10015348mg             277   3e-87   Citrus clementina [clementine]
gb|KJB69599.1|  hypothetical protein B456_011G032900                    277   3e-87   Gossypium raimondii
ref|XP_009405672.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    280   3e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHF97570.1|  Magnesium-chelatase subunit chlI, chloroplastic         276   3e-87   Gossypium arboreum [tree cotton]
gb|KDO77798.1|  hypothetical protein CISIN_1g014510mg                   275   4e-87   Citrus sinensis [apfelsine]
ref|XP_009383480.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    276   4e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010249286.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    276   8e-87   Nelumbo nucifera [Indian lotus]
ref|XP_006467679.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    275   1e-86   Citrus sinensis [apfelsine]
ref|XP_006384056.1|  hypothetical protein POPTR_0004s05270g             275   1e-86   Populus trichocarpa [western balsam poplar]
ref|XP_009383479.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    275   1e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002305090.1|  Magnesium-chelatase subunit chlI family protein    275   2e-86   
ref|XP_008439769.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    275   2e-86   Cucumis melo [Oriental melon]
ref|XP_011086016.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    275   2e-86   Sesamum indicum [beniseed]
ref|XP_011086015.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    275   2e-86   Sesamum indicum [beniseed]
gb|ACU23498.1|  unknown                                                 275   2e-86   Glycine max [soybeans]
gb|AAM98163.1|  magnesium chelatase subunit of protochlorophyllid...    274   4e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925689.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    273   8e-86   
ref|XP_003543008.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    272   3e-85   
ref|XP_007211734.1|  hypothetical protein PRUPE_ppa006200mg             271   3e-85   Prunus persica
ref|XP_008225200.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    271   3e-85   Prunus mume [ume]
ref|XP_002522534.1|  Magnesium-chelatase subunit chlI, chloroplas...    271   4e-85   
ref|XP_008383653.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    271   5e-85   Malus domestica [apple tree]
ref|XP_009352812.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    271   5e-85   Pyrus x bretschneideri [bai li]
ref|XP_002442883.1|  hypothetical protein SORBIDRAFT_08g004300          271   6e-85   Sorghum bicolor [broomcorn]
gb|ACN32024.1|  unknown                                                 270   6e-85   Zea mays [maize]
gb|ACF85806.1|  unknown                                                 271   7e-85   Zea mays [maize]
ref|NP_001105917.1|  oil yellow1                                        270   7e-85   
gb|ACF87583.1|  unknown                                                 270   8e-85   Zea mays [maize]
ref|XP_003528479.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    270   9e-85   Glycine max [soybeans]
ref|XP_008662350.1|  PREDICTED: oil yellow1 isoform X1                  271   2e-84   Zea mays [maize]
gb|ACF83077.1|  unknown                                                 270   2e-84   Zea mays [maize]
gb|AFW56174.1|  oil yellow1                                             270   2e-84   
ref|XP_003593716.1|  Magnesium-chelatase subunit chlI                   269   2e-84   Medicago truncatula
ref|XP_003557120.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    269   3e-84   Brachypodium distachyon [annual false brome]
sp|A2XIK9.1|CHLI_ORYSI  RecName: Full=Magnesium-chelatase subunit...    269   3e-84   Oryza sativa Indica Group [Indian rice]
ref|NP_001050493.1|  Os03g0563300                                       269   3e-84   
gb|ACU19212.1|  unknown                                                 269   3e-84   Glycine max [soybeans]
gb|EPS68275.1|  hypothetical protein M569_06494                         266   3e-84   Genlisea aurea
ref|XP_006650249.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    269   4e-84   Oryza brachyantha
ref|XP_003546019.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    269   4e-84   Glycine max [soybeans]
gb|AFK38677.1|  unknown                                                 269   4e-84   Lotus japonicus
ref|XP_007148073.1|  hypothetical protein PHAVU_006G178400g             267   1e-83   Phaseolus vulgaris [French bean]
ref|XP_010686344.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    267   2e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010686345.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    267   2e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004293922.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    267   2e-83   Fragaria vesca subsp. vesca
ref|XP_008371445.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    266   4e-83   
gb|EYU28056.1|  hypothetical protein MIMGU_mgv1a006884mg                266   4e-83   Erythranthe guttata [common monkey flower]
ref|XP_009347550.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    266   5e-83   Pyrus x bretschneideri [bai li]
ref|XP_003542705.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    266   6e-83   Glycine max [soybeans]
ref|XP_004134671.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    265   1e-82   Cucumis sativus [cucumbers]
gb|AET86637.1|  chloroplast magnesium chelatase I subunit               264   2e-82   Pisum sativum [garden pea]
ref|XP_008783919.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    264   4e-82   Phoenix dactylifera
dbj|BAJ84973.1|  predicted protein                                      263   4e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ERM99293.1|  hypothetical protein AMTR_s00092p00167540               258   5e-82   Amborella trichopoda
gb|EMT16090.1|  Magnesium-chelatase subunit chlI, chloroplastic         260   5e-82   
ref|XP_004505124.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    263   6e-82   Cicer arietinum [garbanzo]
ref|XP_004505122.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    263   6e-82   Cicer arietinum [garbanzo]
ref|XP_006280536.1|  hypothetical protein CARUB_v10026479mg             263   8e-82   
ref|XP_007153702.1|  hypothetical protein PHAVU_003G057600g             262   1e-81   Phaseolus vulgaris [French bean]
ref|XP_010441650.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    262   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_004485870.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    261   2e-81   Cicer arietinum [garbanzo]
gb|EMS53132.1|  Magnesium-chelatase subunit chlI, chloroplastic         261   5e-81   Triticum urartu
gb|KFK28521.1|  magnesium-chelatase subunit chli                        259   1e-80   Arabis alpina [alpine rockcress]
ref|XP_009136933.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    259   2e-80   Brassica rapa
ref|XP_006414096.1|  hypothetical protein EUTSA_v10025291mg             259   3e-80   Eutrema salsugineum [saltwater cress]
gb|KFK31505.1|  hypothetical protein AALP_AA6G121400                    258   3e-80   Arabis alpina [alpine rockcress]
ref|XP_010494748.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    258   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006398276.1|  hypothetical protein EUTSA_v10000878mg             259   5e-80   
ref|XP_010540495.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    258   6e-80   Tarenaya hassleriana [spider flower]
ref|XP_010540494.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    258   7e-80   Tarenaya hassleriana [spider flower]
emb|CDY55641.1|  BnaA03g58320D                                          257   1e-79   Brassica napus [oilseed rape]
ref|XP_009131778.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    257   1e-79   Brassica rapa
emb|CDX78860.1|  BnaA01g09270D                                          257   1e-79   
emb|CDX99465.1|  BnaC01g10870D                                          257   1e-79   
emb|CDY01542.1|  BnaC07g35320D                                          257   2e-79   
ref|NP_199405.2|  magnesium chelatase subunit I2                        256   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865216.1|  Mg chelatase subunit I                             256   3e-79   Arabidopsis lyrata subsp. lyrata
dbj|BAB09321.1|  magnesium chelatase subunit of protochlorophylli...    256   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496228.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    255   6e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010439849.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    255   7e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010434526.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    255   7e-79   Camelina sativa [gold-of-pleasure]
emb|CAI38864.1|  Mg chelatase subunit I                                 254   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128828.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    254   2e-78   Brassica rapa
ref|NP_193583.1|  magnesium-chelatase subunit chlI                      254   2e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AAA99720.1|  Mg-chelatase subunit                                    251   2e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006283787.1|  hypothetical protein CARUB_v10004877mg             253   4e-78   Capsella rubella
ref|XP_002867988.1|  hypothetical protein ARALYDRAFT_914833             253   4e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_002989492.1|  hypothetical protein SELMODRAFT_235795             251   9e-78   
ref|NP_683790.1|  Mg-protoporyphyrin IX chelatase                       246   2e-76   Chaetosphaeridium globosum
gb|KHN47199.1|  Magnesium-chelatase subunit chlI, chloroplastic         244   6e-76   Glycine soja [wild soybean]
ref|YP_636541.1|  Mg-protoporyphyrin IX chelatase                       244   3e-75   Zygnema circumcarinatum
ref|YP_009033847.1|  magnesium chelatase subunit of protochloroph...    243   5e-75   Mesotaenium endlicherianum
ref|XP_001761873.1|  predicted protein                                  242   2e-74   
ref|XP_001758041.1|  predicted protein                                  241   2e-74   
emb|CDY50485.1|  BnaA02g24150D                                          238   4e-73   Brassica napus [oilseed rape]
ref|YP_009033686.1|  magnesium chelatase subunit of protochloroph...    236   3e-72   Roya anglica
gb|AIT94137.1|  magnesium chelatase subunit of protochlorophyllid...    236   3e-72   Marsupiomonas sp. NIES 1824
gb|AFK44500.1|  unknown                                                 235   4e-71   Medicago truncatula
emb|CDX87756.1|  BnaC02g31930D                                          232   5e-71   
ref|YP_009106170.1|  magnesium chelatase subunit of protochloroph...    232   1e-70   Paradoxia multiseta
ref|YP_009106316.1|  magnesium chelatase subunit of protochloroph...    230   5e-70   Interfilum terricola
ref|YP_635727.1|  Mg-protoporyphyrin IX chelatase                       229   1e-69   Chara vulgaris
ref|YP_006234199.1|  Mg-protoporyphyrin IX chelatase                    228   2e-69   Eutreptiella gymnastica
ref|YP_009105764.1|  magnesium chelatase subunit of protochloroph...    228   2e-69   Koliella corcontica
gb|ABX82652.1|  magnesium chelatase subunit of protochlorophyllide      226   3e-69   Trebouxia aggregata
ref|NP_050837.1|  Mg-protoporyphyrin IX chelatase                       228   3e-69   Nephroselmis olivacea
ref|YP_636458.1|  Mg-protoporyphyrin IX chelatase                       228   3e-69   Staurastrum punctulatum
ref|YP_009105900.1|  magnesium chelatase subunit of protochloroph...    228   5e-69   Microthamnion kuetzingianum
ref|YP_009105984.1|  magnesium chelatase subunit of protochloroph...    228   6e-69   Gloeotilopsis sterilis
ref|YP_009106193.1|  magnesium chelatase subunit of protochloroph...    227   6e-69   Planctonema lauterbornii
ref|YP_006666490.1|  photochlorophyllide reductase subunit L            227   1e-68   Trebouxiophyceae sp. MX-AZ01
ref|YP_009104898.1|  magnesium chelatase subunit of protochloroph...    226   2e-68   Myrmecia israeliensis
ref|YP_009105211.1|  magnesium chelatase subunit of protochloroph...    226   2e-68   Pseudochlorella signiensis
ref|WP_010871795.1|  magnesium-chelatase subunit ChlI                   226   3e-68   Synechocystis
ref|YP_001019148.1|  magnesium chelatase subunit of protochloroph...    226   3e-68   Chlorokybus atmophyticus
ref|YP_009106384.1|  magnesium chelatase subunit of protochloroph...    226   3e-68   Fusochloris perforata
ref|WP_011057351.1|  magnesium chelatase                                226   3e-68   Thermosynechococcus
ref|WP_041429536.1|  magnesium chelatase                                226   3e-68   Thermosynechococcus sp. NK55a
ref|YP_009105376.1|  magnesium chelatase subunit of protochloroph...    225   3e-68   Koliella longiseta
ref|WP_028949018.1|  magnesium chelatase                                225   5e-68   Synechocystis sp. PCC 6714
gb|AHB88165.1|  Mg-protoporphyrin IX chelatase ATPase subunit ChlI      225   8e-68   Thermosynechococcus sp. NK55a
ref|YP_009106472.1|  magnesium chelatase subunit of protochloroph...    224   1e-67   Geminella minor
gb|AIT94561.1|  magnesium chelatase subunit of protochlorophyllid...    224   1e-67   Chlorosarcina brevispinosa
ref|YP_009105743.1|  magnesium chelatase subunit of protochloroph...    224   1e-67   Neocystis brevis
ref|YP_009105483.1|  magnesium chelatase subunit of protochloroph...    224   2e-67   Ettlia pseudoalveolaris
emb|CEO91133.1|  magnesium chelatase subunit of protochlorophylli...    224   2e-67   Tydemania expeditionis
ref|YP_009105311.1|  magnesium chelatase subunit of protochloroph...    223   2e-67   Pedinomonas tuberculata
ref|YP_009106625.1|  magnesium chelatase subunit of protochloroph...    224   2e-67   Dicloster acuatus
ref|YP_635908.1|  Mg-protoporyphyrin IX chelatase                       223   3e-67   Oltmannsiellopsis viridis
ref|YP_009057794.1|  magnesium chelatase subunit of protochloroph...    223   3e-67   Picocystis salinarum
ref|YP_004222055.1|  photochlorophyllide reductase subunit L            223   4e-67   Coccomyxa subellipsoidea C-169
ref|YP_009105582.1|  magnesium chelatase subunit of protochloroph...    223   4e-67   Xylochloris irregularis
ref|YP_009105570.1|  magnesium chelatase subunit of protochloroph...    223   4e-67   Lobosphaera incisa
gb|KIE08482.1|  magnesium chelatase                                     223   7e-67   Tolypothrix bouteillei VB521301
ref|YP_004347806.1|  photochlorophyllide reductase subunit L            222   9e-67   Chlorella variabilis
ref|WP_045053191.1|  magnesium chelatase                                222   1e-66   Aliterella atlantica
ref|NP_045914.1|  Mg-protoporyphyrin IX chelatase                       221   1e-66   Chlorella vulgaris
ref|YP_009020880.1|  magnesium-chelatase 38 kDa subunit                 221   1e-66   Chlorella sorokiniana
gb|AGZ19336.1|  magnesium-chelatase subunit chlI (chloroplast)          221   2e-66   Chlorella sp. ArM0029B
ref|YP_009057493.1|  magnesium chelatase subunit of protochloroph...    221   2e-66   Prasinoderma coloniale
ref|YP_005089911.1|  chlI gene product                                  221   2e-66   Pedinomonas minor
gb|AAC44138.1|  Mg-Protoporhyrin IX                                     221   2e-66   Synechocystis sp. PCC 6803
gb|AIY30226.1|  photochlorophyllide reductase subunit I                 221   3e-66   Lobosphaera incisa
ref|WP_002760148.1|  magnesium chelatase                                220   6e-66   Microcystis aeruginosa
ref|WP_002797227.1|  magnesium chelatase                                220   6e-66   Microcystis aeruginosa
ref|WP_002803387.1|  magnesium chelatase                                220   6e-66   Microcystis
ref|YP_009106080.1|  magnesium chelatase subunit of protochloroph...    219   6e-66   Choricystis parasitica
ref|WP_012598055.1|  magnesium chelatase                                219   7e-66   Cyanothece sp. PCC 7424
ref|WP_002778711.1|  magnesium chelatase                                219   7e-66   Microcystis aeruginosa
ref|WP_008200597.1|  magnesium chelatase                                219   7e-66   Microcystis
gb|AEQ94253.1|  chlorophyll biosynthesis                                219   8e-66   Eutreptia viridis
ref|WP_008189063.1|  magnesium chelatase                                219   8e-66   Moorea producens
ref|WP_045872636.1|  magnesium chelatase                                220   9e-66   Nostocales
ref|WP_015218333.1|  protoporphyrin IX magnesium-chelatase              219   1e-65   Cyanobacterium aponinum
gb|EKE99302.1|  magnesium chelatase ATPase subunit I                    219   1e-65   Tolypothrix sp. PCC 7601
ref|WP_009784802.1|  magnesium chelatase                                219   1e-65   Lyngbya sp. PCC 8106
ref|WP_016873528.1|  magnesium chelatase                                219   1e-65   Chlorogloeopsis fritschii
ref|YP_009057860.1|  magnesium chelatase subunit of protochloroph...    219   1e-65   Nephroselmis astigmatica
ref|YP_009106843.1|  magnesium chelatase subunit of protochloroph...    218   2e-65   Marvania geminata
emb|CDI27958.1|  magnesium-chelatase subunit chlI                       219   2e-65   Acetabularia acetabulum
ref|YP_009106822.1|  magnesium chelatase subunit of protochloroph...    218   2e-65   Elliptochloris bilobata
ref|WP_041032790.1|  magnesium chelatase                                219   2e-65   Tolypothrix campylonemoides
ref|WP_015141479.1|  magnesium chelatase ATPase subunit I               219   3e-65   Nostoc sp. PCC 7524
ref|WP_017314355.1|  magnesium chelatase                                219   3e-65   Mastigocladopsis repens
ref|WP_002791921.1|  magnesium chelatase                                218   3e-65   Microcystis aeruginosa
ref|WP_017745273.1|  magnesium chelatase                                218   3e-65   Scytonema hofmannii
ref|WP_002738384.1|  magnesium chelatase ATPase subunit I               218   3e-65   Microcystis aeruginosa
ref|WP_002770087.1|  magnesium chelatase                                218   3e-65   Microcystis aeruginosa
ref|YP_009104833.1|  magnesium chelatase subunit of protochloroph...    221   3e-65   Symbiochloris handae
ref|WP_015226200.1|  protoporphyrin IX magnesium-chelatase              218   3e-65   Halothece sp. PCC 7418
ref|WP_016516601.1|  magnesium chelatase                                218   3e-65   Microcystis aeruginosa
ref|WP_002780926.1|  magnesium chelatase                                218   3e-65   Microcystis aeruginosa
gb|AID67829.1|  magnesium chelatase subunit of protochlorophyllid...    218   3e-65   prasinophyte sp. MBIC10622
ref|WP_002747283.1|  magnesium chelatase ATPase subunit I               218   3e-65   Microcystis aeruginosa
ref|WP_002754885.1|  magnesium chelatase                                218   3e-65   Microcystis aeruginosa
ref|WP_039729931.1|  MULTISPECIES: magnesium chelatase                  218   4e-65   Lyngbya confervoides
gb|AID67423.1|  magnesium chelatase subunit of protochlorophyllid...    218   4e-65   Prasinococcus sp. CCMP1194
ref|WP_007353825.1|  MULTISPECIES: magnesium chelatase                  218   5e-65   Kamptonema
ref|WP_041780332.1|  magnesium chelatase                                218   6e-65   Microcoleus sp. PCC 7113
gb|AFZ16214.1|  protoporphyrin IX magnesium-chelatase                   218   8e-65   Microcoleus sp. PCC 7113
ref|WP_008274324.1|  magnesium chelatase                                217   8e-65   Cyanothece sp. CCY0110
ref|WP_023065952.1|  magnesium chelatase ATPase subunit I               217   8e-65   Lyngbya aestuarii
ref|WP_035156108.1|  magnesium chelatase                                217   9e-65   Calothrix sp. 336/3
ref|WP_009546697.1|  MULTISPECIES: magnesium chelatase                  216   1e-64   Cyanothece
ref|YP_007516996.1|  chlorophyll biosynthesis                           216   2e-64   Euglena viridis
gb|AHJ27963.1|  Protoporphyrin IX Mg-chelatase subunit I                216   2e-64   Nodularia spumigena CCY9414
ref|YP_009033617.1|  magnesium chelatase subunit of protochloroph...    216   2e-64   Klebsormidium flaccidum
ref|YP_002600945.1|  magnesium chelatase subunit of protochloroph...    215   2e-64   Pyramimonas parkeae
ref|YP_003058322.1|  Mg-protoporyphyrin IX chelatase                    216   2e-64   Parachlorella kessleri
ref|NP_038377.1|  Mg-protoporyphyrin IX chelatase                       216   3e-64   Mesostigma viride
ref|WP_015162113.1|  magnesium chelatase ATPase subunit I               216   3e-64   Chamaesiphon minutus
gb|KHG08167.1|  Magnesium-chelatase subunit chlI, chloroplastic         213   4e-64   Gossypium arboreum [tree cotton]
ref|WP_006197284.1|  magnesium chelatase                                216   4e-64   Nodularia spumigena
ref|YP_636198.1|  Mg-protoporyphyrin IX chelatase                       215   4e-64   Tupiella akineta
ref|WP_023074898.1|  protoporphyrin ix magnesium-chelatase              215   5e-64   Leptolyngbya sp. Heron Island J
ref|WP_015203363.1|  protoporphyrin IX magnesium-chelatase              215   5e-64   Crinalium epipsammum
ref|WP_027843787.1|  magnesium chelatase                                215   5e-64   Mastigocoleus testarum
ref|WP_041236613.1|  magnesium chelatase                                214   5e-64   
ref|YP_009019349.1|  Mg-protoporyphyrin IX chelatase                    211   6e-64   Auxenochlorella protothecoides
gb|KIJ82690.1|  magnesium chelatase                                     215   7e-64   Scytonema tolypothrichoides VB-61278
ref|WP_017713506.1|  magnesium chelatase                                214   7e-64   Prochlorothrix hollandica
ref|YP_009106670.1|  magnesium chelatase subunit of protochloroph...    214   7e-64   Pseudochloris wilhelmii
ref|WP_008233259.1|  Protoporphyrin IX Mg-chelatase subunit I           214   7e-64   Richelia intracellularis
ref|WP_015172950.1|  protoporphyrin IX magnesium-chelatase              215   8e-64   Geitlerinema sp. PCC 7407
gb|ACL43356.1|  magnesium chelatase ATPase subunit I                    214   8e-64   Cyanothece sp. PCC 7425
ref|WP_019498563.1|  magnesium chelatase                                214   1e-63   Pseudanabaena sp. PCC 6802
ref|YP_007317165.1|  Mg-protoporyphyrin IX chelatase                    214   1e-63   Monomorphina aenigmatica
ref|WP_017652974.1|  magnesium chelatase                                214   1e-63   Fortiea contorta
ref|WP_008317866.1|  magnesium chelatase ATPase subunit I               214   1e-63   
gb|KIY99379.1|  magnesium chelatase subunit I                           213   1e-63   Monoraphidium neglectum
ref|WP_015111597.1|  protoporphyrin IX magnesium-chelatase              214   1e-63   Nostoc sp. PCC 7107
ref|WP_012593827.1|  MULTISPECIES: magnesium chelatase                  213   2e-63   Cyanothece
ref|WP_009456321.1|  MULTISPECIES: magnesium chelatase                  214   2e-63   Fischerella
ref|WP_036002315.1|  magnesium chelatase                                214   2e-63   [Leptolyngbya] sp. JSC-1
ref|WP_013191980.1|  magnesium chelatase                                214   2e-63   Trichormus azollae
ref|WP_012165153.1|  magnesium chelatase                                213   2e-63   
ref|WP_015148601.1|  protoporphyrin IX magnesium-chelatase              213   2e-63   Oscillatoria acuminata
ref|WP_011243252.1|  MULTISPECIES: magnesium chelatase                  213   2e-63   Synechococcus
ref|WP_012412525.1|  magnesium chelatase                                214   2e-63   Nostoc punctiforme
ref|WP_019494089.1|  magnesium chelatase                                213   3e-63   Calothrix sp. PCC 7103
ref|WP_009633531.1|  magnesium chelatase ATPase subunit I               213   3e-63   Synechocystis sp. PCC 7509
dbj|BAQ59836.1|  protoporphyrin IX Mg-chelatase subunit I               213   3e-63   Geminocystis sp. NIES-3708
gb|ACM51422.1|  Mg-protoporphyrin IX chelatase                          213   3e-63   Caulerpa filiformis
ref|WP_036481487.1|  magnesium chelatase                                213   3e-63   Myxosarcina sp. GI1
emb|CEO91051.1|  Mg-protoporyphyrin IX chelatase                        213   3e-63   Bryopsis plumosa
ref|WP_041431092.1|  magnesium chelatase                                213   4e-63   Synechococcus sp. PCC 6312
ref|WP_013320725.1|  magnesium chelatase                                213   4e-63   Cyanothece sp. PCC 7822
ref|WP_017659838.1|  magnesium chelatase                                213   4e-63   Geitlerinema sp. PCC 7105
ref|WP_007303511.1|  magnesium chelatase                                213   4e-63   Crocosphaera watsonii
ref|WP_017304271.1|  magnesium chelatase                                213   4e-63   Spirulina subsalsa
gb|AGN72450.1|  Mg-protoporyphyrin IX chelatase                         212   5e-63   Auxenochlorella protothecoides
ref|WP_009556093.1|  protoporphyrin IX magnesium-chelatase              213   5e-63   Oscillatoriales cyanobacterium JSC-12
ref|WP_015165920.1|  magnesium chelatase ATPase subunit I               212   5e-63   Pseudanabaena sp. PCC 7367
ref|WP_015179225.1|  protoporphyrin IX magnesium-chelatase              213   5e-63   Oscillatoria nigro-viridis
ref|WP_006632953.1|  magnesium chelatase                                213   5e-63   Microcoleus vaginatus
sp|Q94FT3.1|CHLI_CHLRE  RecName: Full=Magnesium-chelatase subunit...    214   5e-63   Chlamydomonas reinhardtii
gb|AFY59990.1|  protoporphyrin IX magnesium-chelatase                   212   5e-63   Synechococcus sp. PCC 6312
ref|XP_001691232.1|  magnesium chelatase subunit I                      214   6e-63   Chlamydomonas reinhardtii
ref|WP_039741038.1|  magnesium chelatase                                212   8e-63   
gb|EDX76899.1|  magnesium chelatase ATPase subunit I                    211   8e-63   Coleofasciculus chthonoplastes PCC 7420
ref|WP_015192452.1|  magnesium chelatase ATPase subunit I               212   8e-63   Stanieria cyanosphaera
ref|WP_044137744.1|  magnesium chelatase                                212   9e-63   Trichodesmium erythraeum
emb|CDN11241.1|  Protoporphyrin IX Mg-chelatase subunit I               211   9e-63   Richelia intracellularis
ref|WP_017287156.1|  magnesium chelatase                                211   1e-62   Leptolyngbya boryana
ref|WP_010478001.1|  magnesium chelatase                                211   1e-62   
dbj|BAQ66172.1|  protoporphyrin IX Mg-chelatase subunit I               211   1e-62   Geminocystis sp. NIES-3709
ref|WP_018398578.1|  magnesium chelatase                                211   1e-62   filamentous cyanobacterium ESFC-1
ref|YP_009029300.1|  Mg chelatase subunit e                             211   1e-62   Leptocylindrus danicus
gb|AEW12943.2|  chlorophyll biosynthesis                                211   1e-62   Colacium vesiculosum
ref|WP_044205827.1|  magnesium chelatase                                211   1e-62   
ref|WP_037217496.1|  magnesium chelatase                                211   1e-62   
ref|WP_012953433.1|  magnesium chelatase                                211   2e-62   
ref|WP_017293979.1|  magnesium chelatase                                211   2e-62   
ref|WP_006618358.1|  magnesium chelatase                                211   2e-62   
gb|ABG52692.1|  protoporphyrin IX magnesium-chelatase                   212   2e-62   
ref|XP_002947010.1|  hypothetical protein VOLCADRAFT_79418              212   2e-62   
ref|WP_015214442.1|  protoporphyrin IX magnesium-chelatase              211   3e-62   
ref|WP_035759985.1|  magnesium chelatase                                211   3e-62   
ref|WP_039933513.1|  magnesium chelatase                                211   3e-62   
gb|EPS73474.1|  hypothetical protein M569_01255                         210   3e-62   
sp|Q44498.1|CHLI_ANAVA  RecName: Full=Magnesium-chelatase subunit...    210   3e-62   
ref|WP_011318336.1|  magnesium chelatase                                211   3e-62   
ref|WP_035985215.1|  magnesium chelatase                                210   4e-62   
gb|EKD09599.1|  magnesium chelatase ATPase subunit I                    211   4e-62   
ref|WP_015205904.1|  protoporphyrin IX magnesium-chelatase              210   4e-62   
gb|EDZ93252.1|  magnesium chelatase ATPase subunit I                    211   4e-62   
ref|WP_010994329.1|  magnesium-chelatase subunit ChlI                   210   4e-62   
ref|YP_003734544.1|  Mg-protoporphyrin IX chelatase                     210   4e-62   
ref|NP_043645.1|  Mg-protoporyphyrin IX chelatase                       210   4e-62   
ref|YP_009093341.1|  protochlorophyllide reductase magnesium chel...    209   5e-62   
ref|YP_009032717.1|  chlorophyll biosynthesis                           209   5e-62   
ref|YP_003002236.1|  magnesium chelatase subunit                        209   7e-62   
ref|WP_029634005.1|  magnesium chelatase [                              210   7e-62   
ref|YP_009029443.1|  Mg chelatase subunit e                             209   8e-62   
ref|WP_015222566.1|  protoporphyrin IX magnesium-chelatase              209   8e-62   
gb|AEW13007.1|  chlorophyll biosynthesis                                209   8e-62   
gb|ELS32221.1|  protoporphyrin IX magnesium-chelatase                   209   9e-62   
ref|NP_054004.1|  Mg-protoporyphyrin IX chelatase                       209   9e-62   
ref|WP_015126951.1|  protoporphyrin IX magnesium-chelatase              209   1e-61   
ref|WP_040688561.1|  magnesium chelatase                                209   1e-61   
ref|WP_040933123.1|  magnesium chelatase                                209   1e-61   
ref|YP_009105000.1|  magnesium chelatase subunit of protochloroph...    209   1e-61   
ref|YP_009029030.1|  Mg chelatase subunit e                             209   1e-61   
gb|ABF06656.1|  magnesium chelatas ChlI subunit                         208   1e-61   
ref|WP_036902617.1|  magnesium chelatase                                209   1e-61   
gb|ACQ90752.1|  magnesium chelatase subunit of protochlorophyllid...    208   1e-61   
ref|WP_026731287.1|  magnesium chelatase                                209   1e-61   
ref|YP_003734982.1|  magnesium-chelatase subunit I                      208   1e-61   
ref|WP_015168968.1|  magnesium chelatase ATPase subunit I               208   1e-61   
ref|WP_017297070.1|  magnesium chelatase                                209   2e-61   
ref|YP_009093021.1|  protochlorophyllide reductase magnesium chel...    208   2e-61   
ref|WP_016951573.1|  magnesium chelatase                                209   2e-61   
ref|YP_874532.1|  magnesium-chelatase subunit I                         208   2e-61   
ref|WP_015079938.1|  magnesium chelatase BchI                           208   3e-61   
ref|WP_027403495.1|  magnesium chelatase                                208   3e-61   
ref|WP_006512347.1|  magnesium chelatase ATPase subunit I               207   3e-61   
ref|NP_050702.1|  Mg-protoporyphyrin IX chelatase                       207   3e-61   
ref|YP_009106568.1|  magnesium chelatase subunit of protochloroph...    207   3e-61   
ref|WP_026796343.1|  MULTISPECIES: magnesium chelatase                  207   4e-61   
ref|WP_039202400.1|  magnesium chelatase                                207   5e-61   
gb|AFR24772.1|  Mg-protoporyphyrin IX chelatase                         207   5e-61   
gb|AIR75574.1|  protochlorophyllide reductase magnesium chelatase...    207   5e-61   
gb|AIA21420.1|  protochlorophyllide reductase magnesium chelatase...    206   5e-61   
ref|YP_002600814.1|  magnesium chelatase subunit of protochloroph...    207   6e-61   
ref|WP_028083523.1|  magnesium chelatase                                207   6e-61   
ref|WP_006518251.1|  protoporphyrin IX magnesium-chelatase              207   7e-61   
ref|WP_026785444.1|  magnesium chelatase                                207   7e-61   
ref|WP_011824109.1|  magnesium chelatase                                207   8e-61   
ref|YP_009059205.1|  Mg chelatase subunit e                             206   8e-61   
ref|WP_036831959.1|  MULTISPECIES: magnesium chelatase                  206   9e-61   
ref|NP_043214.1|  Mg-protoporyphyrin IX chelatase                       206   9e-61   
ref|YP_009028876.1|  Mg chelatase subunit e                             206   1e-60   
ref|YP_005090020.1|  chlI gene product                                  206   1e-60   
ref|YP_003289253.1|  Magnesium chelatase subunit I                      206   1e-60   
ref|YP_004376588.1|  magnesium-chelatase subunit I                      206   1e-60   
gb|KGG20075.1|  Protoporphyrin IX Mg-chelatase subunit I                206   1e-60   
ref|YP_009093449.1|  protochlorophyllide reductase magnesium chel...    206   1e-60   
ref|WP_025934433.1|  magnesium chelatase                                206   1e-60   
ref|WP_015197571.1|  protoporphyrin IX magnesium-chelatase              206   1e-60   
ref|WP_019500394.1|  hypothetical protein                               206   1e-60   
ref|YP_009028745.1|  Mg chelatase subunit e                             206   1e-60   
ref|WP_011132688.1|  magnesium chelatase                                206   2e-60   
ref|WP_017321915.1|  magnesium chelatase                                206   2e-60   
ref|WP_015121638.1|  protoporphyrin IX magnesium-chelatase              206   2e-60   
ref|WP_016868842.1|  magnesium chelatase                                206   2e-60   
ref|YP_002601047.1|  magnesium chelatase subunit of protochloroph...    205   2e-60   
ref|WP_025974661.1|  magnesium chelatase                                204   2e-60   
ref|WP_036906635.1|  magnesium chelatase                                206   2e-60   
ref|WP_019507431.1|  magnesium chelatase                                205   2e-60   
ref|WP_015142889.1|  magnesium chelatase ATPase subunit I               205   2e-60   
ref|WP_012195688.1|  magnesium chelatase                                206   2e-60   
ref|YP_007627492.1|  Mg-protoporphyrin IX chelatase                     205   2e-60   
ref|WP_025965644.1|  magnesium chelatase                                204   2e-60   
ref|YP_004072529.1|  magnesium chelatase ATPase subunit ChlI            205   3e-60   
gb|ABD01108.1|  magnesium chelatase, ATPase subunit I                   205   3e-60   
gb|AFC40062.1|  g-protoporyphyrin IX chelatase                          205   3e-60   
ref|WP_041436963.1|  magnesium chelatase                                205   3e-60   
ref|YP_009093176.1|  protochlorophyllide reductase magnesium chel...    205   4e-60   
ref|WP_011820453.1|  magnesium chelatase                                205   4e-60   
ref|WP_044450290.1|  magnesium chelatase                                201   4e-60   
ref|WP_025955853.1|  magnesium chelatase                                205   4e-60   
ref|WP_007100258.1|  magnesium chelatase                                205   4e-60   
ref|WP_042709757.1|  magnesium chelatase                                204   5e-60   
ref|WP_038543842.1|  magnesium chelatase                                204   5e-60   
ref|WP_025969884.1|  magnesium chelatase                                204   5e-60   
gb|AIU44593.1|  Mg-protoporyphyrin IX chelatase                         204   5e-60   
ref|YP_006639012.1|  magnesium-chelatase subunit I                      204   5e-60   
ref|WP_006276817.1|  magnesium chelatase                                205   6e-60   
ref|WP_040054435.1|  magnesium chelatase                                204   6e-60   
ref|WP_006911628.1|  magnesium chelatase                                204   7e-60   
ref|YP_003002095.1|  magnesium chelatase subunit                        204   7e-60   
gb|AIQ97686.1|  Protoporphyrin IX Mg-chelatase subunit I                203   8e-60   
ref|WP_025973350.1|  magnesium chelatase                                204   8e-60   
ref|WP_025925370.1|  MULTISPECIES: magnesium chelatase                  204   8e-60   
ref|WP_015187653.1|  magnesium chelatase ATPase subunit I               204   8e-60   
ref|WP_025893374.1|  MULTISPECIES: magnesium chelatase                  204   9e-60   
ref|WP_025894660.1|  MULTISPECIES: magnesium chelatase                  204   9e-60   
ref|WP_025881650.1|  MULTISPECIES: magnesium chelatase                  204   9e-60   
ref|WP_025963773.1|  magnesium chelatase                                204   9e-60   
emb|CBI30656.3|  unnamed protein product                                203   9e-60   
ref|WP_032525692.1|  magnesium chelatase                                204   9e-60   
ref|WP_028951552.1|  magnesium chelatase                                204   1e-59   
ref|WP_025952895.1|  magnesium chelatase                                204   1e-59   
ref|WP_032524621.1|  magnesium chelatase                                204   1e-59   
ref|WP_002806047.1|  magnesium chelatase                                204   1e-59   
ref|WP_011127583.1|  magnesium chelatase                                204   1e-59   
ref|WP_011863114.1|  magnesium chelatase                                204   1e-59   
ref|WP_011818593.1|  MULTISPECIES: magnesium chelatase                  204   1e-59   
ref|WP_025906602.1|  MULTISPECIES: magnesium chelatase                  204   1e-59   
ref|WP_025923328.1|  magnesium chelatase                                204   1e-59   
ref|WP_025972213.1|  magnesium chelatase                                204   1e-59   
ref|YP_009092935.1|  protochlorophyllide reductase magnesium chel...    203   1e-59   
ref|WP_032516717.1|  magnesium chelatase                                204   1e-59   
ref|WP_011294787.1|  magnesium chelatase                                204   1e-59   
ref|WP_011618897.1|  magnesium chelatase                                204   1e-59   
ref|YP_001936316.1|  Mg-protoporyphyrin IX chelatase                    202   1e-59   
ref|WP_006170340.1|  magnesium chelatase                                203   1e-59   
ref|WP_032514176.1|  magnesium chelatase                                203   1e-59   
ref|WP_011125298.1|  MULTISPECIES: magnesium chelatase                  203   1e-59   
ref|WP_038653588.1|  magnesium chelatase                                203   1e-59   
ref|WP_025933665.1|  magnesium chelatase                                203   1e-59   
ref|WP_015110789.1|  magnesium chelatase ATPase subunit I               203   2e-59   
gb|AIR75433.1|  protochlorophyllide reductase magnesium chelatase...    203   2e-59   
ref|WP_025929401.1|  magnesium chelatase                                203   2e-59   
ref|WP_032522633.1|  magnesium chelatase                                203   2e-59   
ref|WP_010317938.1|  magnesium chelatase                                203   2e-59   
ref|WP_017714876.1|  magnesium chelatase                                203   2e-59   
ref|YP_537075.1|  Mg-protoporyphyrin IX chelatase                       202   2e-59   
ref|WP_012007882.1|  magnesium chelatase                                203   2e-59   
ref|WP_009343328.1|  magnesium chelatase                                203   2e-59   
ref|YP_008145482.1|  Mg-protoporyphyrin IX chelatase                    202   3e-59   
ref|WP_010303690.1|  magnesium chelatase                                202   3e-59   
ref|WP_025944106.1|  magnesium chelatase                                202   3e-59   
ref|WP_025926642.1|  magnesium chelatase                                202   3e-59   
ref|WP_025942950.1|  magnesium chelatase                                202   3e-59   
ref|WP_028827698.1|  magnesium chelatase                                202   4e-59   
ref|WP_025928490.1|  magnesium chelatase                                202   4e-59   
ref|WP_006852251.1|  magnesium chelatase                                202   4e-59   
ref|WP_011364902.1|  magnesium chelatase                                202   4e-59   
ref|WP_015230865.1|  magnesium chelatase ATPase subunit I               202   5e-59   
ref|YP_009029187.1|  Mg chelatase subunit e                             202   5e-59   
gb|AIA21624.1|  protochlorophyllide reductase magnesium chelatase...    202   5e-59   
ref|YP_008144729.1|  magnesium-chelatase subunit ChlI                   201   6e-59   
ref|WP_011376616.1|  magnesium chelatase                                202   6e-59   
ref|YP_008965634.1|  magnesium chelatase subunit I                      201   6e-59   
ref|WP_042850529.1|  magnesium chelatase                                202   6e-59   
ref|WP_036920303.1|  magnesium chelatase                                202   7e-59   
ref|YP_007947924.1|  Mg-protoporyphyrin IX chelatase                    201   7e-59   
ref|WP_009790265.1|  magnesium chelatase                                201   9e-59   
ref|WP_017312410.1|  magnesium chelatase                                201   1e-58   
ref|YP_001293514.1|  protochlorophylide reductase magnesium subunit     201   1e-58   
gb|AHF64388.1|  Magnesium chelatase ATPase subunit I                    201   1e-58   
ref|WP_032519077.1|  magnesium chelatase                                201   1e-58   
ref|WP_025362445.1|  magnesium chelatase                                201   1e-58   
ref|WP_017325903.1|  magnesium chelatase                                201   1e-58   
ref|YP_007878331.1|  Mg-protoporphyrin IX chelatase                     200   2e-58   
ref|YP_009028617.1|  Mg chelatase subunit e                             200   2e-58   
ref|WP_035832887.1|  magnesium chelatase                                201   2e-58   
ref|WP_011359522.1|  magnesium chelatase                                201   2e-58   
ref|WP_007098271.1|  magnesium chelatase                                201   2e-58   
ref|WP_022608228.1|  magnesium chelatase ATPase subunit I               201   2e-58   
ref|WP_036917982.1|  MULTISPECIES: magnesium chelatase                  200   2e-58   
ref|YP_001936315.1|  Mg-protoporyphyrin IX chelatase                    202   2e-58   
ref|WP_036896834.1|  magnesium chelatase                                200   2e-58   
ref|WP_024544789.1|  magnesium chelatase                                200   2e-58   
ref|WP_011935147.1|  magnesium chelatase                                200   4e-58   
ref|WP_025930483.1|  magnesium chelatase                                200   4e-58   
gb|ABD00082.1|  magnesium chelatase, ATPase subunit I                   199   4e-58   
ref|WP_006041775.1|  magnesium chelatase                                199   4e-58   
ref|YP_009027678.1|  protochlorophyllide reductase magnesium chel...    199   5e-58   
gb|AIA20170.1|  protochlorophyllide reductase magnesium chelatase...    198   5e-58   
gb|AHB35380.1|  protochlorophyllide reductase magnesium chelatase...    198   5e-58   
gb|AHY04367.1|  Magnesium chelatase subunit                             199   5e-58   
ref|WP_030007326.1|  magnesium chelatase                                199   5e-58   
ref|WP_041438434.1|  magnesium chelatase                                199   5e-58   
ref|WP_012307853.1|  magnesium chelatase                                199   6e-58   
ref|WP_015153067.1|  protoporphyrin IX magnesium-chelatase              199   6e-58   
ref|WP_039713234.1|  magnesium chelatase                                199   7e-58   
gb|ABH07506.1|  Mg protoporphyrin IX chelatase                          193   1e-57   
ref|WP_016859854.1|  magnesium chelatase                                199   1e-57   
gb|AHB35172.1|  protochlorophyllide reductase magnesium chelatase...    198   1e-57   
ref|WP_043692082.1|  magnesium chelatase                                198   2e-57   
ref|WP_011933501.1|  magnesium chelatase                                198   2e-57   
gb|ADJ00025.1|  plastid Mg-protoporyphyrin IX chelatase                 192   2e-57   
gb|EDX87156.1|  magnesium chelatase ATPase subunit I                    197   3e-57   
gb|AIM52731.1|  Mg-protoporphyrin IX chelatase subunit ChlI             197   3e-57   
ref|WP_038556950.1|  magnesium chelatase                                197   3e-57   
ref|YP_009122268.1|  magnesium-chelatase subunit ChlI                   197   3e-57   
ref|WP_038015703.1|  magnesium chelatase                                197   4e-57   
gb|AII48794.1|  magnesium chelatase                                     197   4e-57   
ref|YP_009019716.1|  magnesium chelatase subunit                        197   4e-57   
ref|WP_026719454.1|  magnesium chelatase                                197   5e-57   
ref|WP_015134845.1|  protoporphyrin IX magnesium-chelatase              197   5e-57   
ref|YP_002049392.1|  Magnesium chelatase ATPase subunit I               196   8e-57   
gb|ADJ57447.1|  Mg-protoporyphyrin IX chelatase                         196   9e-57   
ref|NP_041888.1|  Mg-protoporyphyrin IX chelatase                       193   8e-56   
ref|WP_011141713.1|  magnesium chelatase                                194   8e-56   
gb|AJO68531.1|  Mg-protoporyphyrin IX chelatase                         192   1e-55   
ref|YP_874390.1|  magnesium-chelatase subunit I                         193   1e-55   
ref|YP_005089669.1|  chlI gene product                                  193   1e-55   
ref|YP_005088704.1|  Mg-protoporyphyrin IX chelatase                    192   2e-55   
ref|YP_063709.1|  Mg-protoporyphyrin IX chelatase                       192   3e-55   
ref|WP_006529681.1|  magnesium chelatase ATPase subunit I               188   7e-54   
ref|NP_848952.1|  Mg-protoporyphyrin IX chelatase                       187   1e-53   
ref|YP_277379.1|  Mg-protoporyphyrin IX chelatase                       186   5e-53   
ref|YP_009051162.1|  protochlorophyllide reductase magnesium chel...    184   2e-52   
ref|XP_001416388.1|  Magnesium-protoporyphyrin IX chelatase subun...    185   3e-52   
ref|XP_007509047.1|  Mg-protoporyphyrin IX chelatase                    185   3e-52   
ref|XP_003075047.1|  CHLI_CHLVU Magnesium-chelatase subunit chlI ...    185   3e-52   
ref|YP_007476320.1|  Mg chelatase subunit e                             184   4e-52   



>ref|XP_010108425.1| Magnesium-chelatase subunit chlI [Morus notabilis]
 gb|EXC19453.1| Magnesium-chelatase subunit chlI [Morus notabilis]
Length=418

 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDRNPKEFR  
Sbjct  253  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRNPKEFRNS  312

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QIA AR+SL SV IDHD +VKI KVCAELNVDGLRGDIVTNRAA+ALASL
Sbjct  313  YKEEQEKLQNQIASARSSLSSVQIDHDLKVKISKVCAELNVDGLRGDIVTNRAAKALASL  372

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+L+IEKFYEVF+
Sbjct  373  KGRDKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLIIEKFYEVFS  418



>emb|CDP04687.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQV TV+DAELRVK VE RARFDRNPKEFRE 
Sbjct  264  PARFILIGSGNPEEGELRPQLLDRFGMHAQVSTVKDAELRVKIVEERARFDRNPKEFRES  323

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI+ AR+SL +VTIDHD RVKI KVCAELNVDGLRGDIVTNR ARALA+L
Sbjct  324  YKAEQEKLQQQISSARSSLSAVTIDHDLRVKISKVCAELNVDGLRGDIVTNRGARALAAL  383

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR +VTAE+IATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  384  KGREKVTAEEIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  429



>ref|XP_006377560.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
 ref|XP_006377561.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
 gb|ERP55357.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
 gb|ERP55358.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
Length=326

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  161  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRHS  220

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKL+ QIA AR  L SV IDHD +VKI KVCAELNVDGLRGDIVTNRAA++LA+L
Sbjct  221  YKAEQEKLRQQIASARACLSSVQIDHDLKVKISKVCAELNVDGLRGDIVTNRAAKSLAAL  280

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  281  KGRDQVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  326



>ref|XP_002316838.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
 gb|EEE97450.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
Length=420

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRHS  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKL+ QIA AR  L SV IDHD +VKI KVCAELNVDGLRGDIVTNRAA++LA+L
Sbjct  315  YKAEQEKLRQQIASARACLSSVQIDHDLKVKISKVCAELNVDGLRGDIVTNRAAKSLAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  375  KGRDQVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  420



>ref|XP_011620831.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Amborella 
trichopoda]
Length=400

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE RARFD+NPKEFR+ 
Sbjct  235  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERARFDQNPKEFRDS  294

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR +L SV IDHD RVKI +VCAELNVDGLRGDIVTNRA++ALASL
Sbjct  295  YQAEQEKLQNQITKARETLSSVQIDHDLRVKISRVCAELNVDGLRGDIVTNRASKALASL  354

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  355  KGRDKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  400



>ref|XP_010529186.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic 
[Tarenaya hassleriana]
Length=426

 Score =   292 bits (747),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  261  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  320

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQEKLQ QI  ARN+L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALASL
Sbjct  321  YRTEQEKLQDQITSARNNLSSVRIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALASL  380

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+EVTAEDI TVIPNCLR RLRKDPLESIDSGVLV EKFYEVF+
Sbjct  381  KGRDEVTAEDIGTVIPNCLRHRLRKDPLESIDSGVLVTEKFYEVFS  426



>ref|XP_004955063.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Setaria italica]
Length=318

 Score =   288 bits (736),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FR+ 
Sbjct  153  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKAFRDS  212

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALASL
Sbjct  213  YKEEQEKLQDQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALASL  272

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  273  KGRDKVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  318



>gb|KEH30930.1| magnesium-chelatase subunit ChlI [Medicago truncatula]
Length=420

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  ARN L SV IDH+ +VKI KVCAELNVDGLRGDIVTNRAA+ALA L
Sbjct  315  YKAEQEKLQQQITAARNFLASVQIDHELKVKISKVCAELNVDGLRGDIVTNRAAKALAGL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG N+V+AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF 
Sbjct  375  KGINKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFT  420



>ref|XP_004977284.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Setaria italica]
Length=418

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FR+ 
Sbjct  253  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKAFRDS  312

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALASL
Sbjct  313  YKEEQEKLQDQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALASL  372

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  373  KGRDKVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  418



>ref|XP_010052233.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Eucalyptus 
grandis]
Length=411

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R+RFD+NPKEFR+ 
Sbjct  246  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERSRFDKNPKEFRDS  305

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  AR++L SV ID D +VKI KVCAELNVDGLRGDIV+NRAA+ALASL
Sbjct  306  YKAEQEKLQQQIRSARSNLSSVQIDQDLKVKISKVCAELNVDGLRGDIVSNRAAKALASL  365

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+L+IEKFYEVF 
Sbjct  366  KGRDNVTLEDIATVIPNCLRHRLRKDPLESIDSGLLIIEKFYEVFT  411



>ref|XP_004977283.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Setaria italica]
Length=447

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FR+ 
Sbjct  282  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKAFRDS  341

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALASL
Sbjct  342  YKEEQEKLQDQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALASL  401

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  402  KGRDKVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  447



>gb|KCW76166.1| hypothetical protein EUGRSUZ_D00551 [Eucalyptus grandis]
Length=452

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R+RFD+NPKEFR+ 
Sbjct  287  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERSRFDKNPKEFRDS  346

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  AR++L SV ID D +VKI KVCAELNVDGLRGDIV+NRAA+ALASL
Sbjct  347  YKAEQEKLQQQIRSARSNLSSVQIDQDLKVKISKVCAELNVDGLRGDIVSNRAAKALASL  406

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+L+IEKFYEVF 
Sbjct  407  KGRDNVTLEDIATVIPNCLRHRLRKDPLESIDSGLLIIEKFYEVFT  452



>ref|XP_010915593.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Elaeis 
guineensis]
Length=427

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RA FDR+P+ FRE 
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERAMFDRDPRGFRES  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKA+QEKL+ QIA AR++L SV IDHD RV I KVCAELNVDGLRGDIVTNRAA+ALASL
Sbjct  322  YKADQEKLRQQIASARSNLASVQIDHDLRVNISKVCAELNVDGLRGDIVTNRAAKALASL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTA+DIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  382  KGRDKVTADDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  427



>ref|XP_011096413.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Sesamum indicum]
Length=426

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE RARFDRNPKEFRE 
Sbjct  261  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERARFDRNPKEFRES  320

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ+KLQ QIA AR+ L SVTIDH+ RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  321  YKAEQDKLQQQIASARSGLSSVTIDHELRVKISKVCAELNVDGLRGDIVTNRAARALAAL  380

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  381  KGRDKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  426



>ref|XP_007025454.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY28076.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=423

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+SL SV IDHD +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKAEQEKLQQQIASARSSLSSVQIDHDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  378  KGRDKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  423



>ref|XP_009592218.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=425

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  260  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRES  319

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  ARN+L +VTIDHD RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  320  YKAEQEKLQNQIDSARNALSAVTIDHDLRVKISKVCAELNVDGLRGDIVTNRAARALAAL  379

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSGVLV+EKFYEVF
Sbjct  380  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGVLVVEKFYEVF  424



>ref|XP_009592217.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRES  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  ARN+L +VTIDHD RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  322  YKAEQEKLQNQIDSARNALSAVTIDHDLRVKISKVCAELNVDGLRGDIVTNRAARALAAL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSGVLV+EKFYEVF
Sbjct  382  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGVLVVEKFYEVF  426



>gb|KJB69597.1| hypothetical protein B456_011G032900 [Gossypium raimondii]
Length=250

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  85   PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  144

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+SL SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  145  YKAEQEKLQQQIASARSSLSSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  204

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++V AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF
Sbjct  205  KGRDKVIAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVF  249



>ref|XP_009804859.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=426

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  261  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRES  320

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  ARN+L +VTIDHD RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  321  YKAEQEKLQNQIDSARNALSAVTIDHDLRVKISKVCAELNVDGLRGDIVTNRAARALAAL  380

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSGVLV+EKFYEVF
Sbjct  381  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGVLVVEKFYEVF  425



>ref|XP_009804860.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X2 [Nicotiana sylvestris]
 gb|AAG35472.1|U67064_1 sulfur [Nicotiana tabacum]
Length=424

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRES  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  ARN+L +VTIDHD RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  319  YKAEQEKLQNQIDSARNALSAVTIDHDLRVKISKVCAELNVDGLRGDIVTNRAARALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSGVLV+EKFYEVF
Sbjct  379  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGVLVVEKFYEVF  423



>sp|O22436.1|CHLI_TOBAC RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I-1; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; Flags: Precursor [Nicotiana 
tabacum]
 gb|AAB97153.1| Mg protoporphyrin chelatase subunit [Nicotiana tabacum]
Length=426

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  261  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRES  320

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  ARN+L +VTIDHD RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  321  YKAEQEKLQNQIDSARNALSAVTIDHDLRVKISKVCAELNVDGLRGDIVTNRAARALAAL  380

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSGVLV+EKFYEVF
Sbjct  381  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGVLVVEKFYEVF  425



>ref|XP_002276262.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Vitis vinifera]
Length=426

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  261  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  320

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI+ AR+ L SV IDHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  321  YKAEQEKLQQQISSARSDLSSVQIDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  380

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  381  KGRDNVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  426



>ref|XP_012091733.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Jatropha 
curcas]
 gb|KDP21059.1| hypothetical protein JCGZ_21530 [Jatropha curcas]
Length=423

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QI+ AR SL SV IDHD +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKTEQEKLQQQISAARTSLSSVQIDHDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAED+ATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  378  KGRDKVTAEDVATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  423



>gb|KJB69598.1| hypothetical protein B456_011G032900 [Gossypium raimondii]
Length=326

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  161  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  220

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+SL SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  221  YKAEQEKLQQQIASARSSLSSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  280

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF 
Sbjct  281  KGRDKVIAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFG  326



>ref|XP_011027718.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Populus 
euphratica]
Length=417

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRES  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI+ AR+ L SV IDHD +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  312  YKAEQEKLQQQISSARSFLSSVQIDHDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  372  KGRDQVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVSEKFYEVFS  417



>ref|XP_006361060.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Solanum tuberosum]
Length=427

 Score =   279 bits (713),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFRE 
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRES  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QI  AR+ L SVTIDHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  322  YKGEQEKLQSQITSARSGLSSVTIDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  382  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFG  427



>gb|KJB68387.1| hypothetical protein B456_010G242400 [Gossypium raimondii]
Length=396

 Score =   278 bits (710),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  231  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  290

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+SL SV ID D +VKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  291  YKAEQEKLQQQIASARSSLSSVQIDQDLKVKISRVCAELNVDGLRGDIVTNRAAKALAAL  350

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  351  KGRDCVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  396



>ref|XP_004248139.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Solanum 
lycopersicum]
Length=427

 Score =   278 bits (712),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFRE 
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRES  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QI  AR+ L SVTIDHD RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  322  YKGEQEKLQSQITSARSGLSSVTIDHDLRVKISKVCAELNVDGLRGDIVTNRAARALAAL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  382  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFG  427



>ref|XP_006449465.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 ref|XP_006449466.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 gb|ESR62705.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 gb|ESR62706.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
Length=369

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  204  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  263

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ KLQ QIA AR+SL +V IDHD +VKI KVCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  264  YKAEQAKLQQQIASARSSLPAVQIDHDLKVKISKVCAELNVDGLRGDIVSNRAAKALAAL  323

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  324  KGRDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  369



>gb|KJB68386.1| hypothetical protein B456_010G242400 [Gossypium raimondii]
Length=424

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+SL SV ID D +VKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  319  YKAEQEKLQQQIASARSSLSSVQIDQDLKVKISRVCAELNVDGLRGDIVTNRAAKALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  379  KGRDCVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  424



>ref|XP_006449467.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 gb|ESR62707.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
Length=423

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ KLQ QIA AR+SL +V IDHD +VKI KVCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  318  YKAEQAKLQQQIASARSSLPAVQIDHDLKVKISKVCAELNVDGLRGDIVSNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  378  KGRDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  423



>gb|KJB69599.1| hypothetical protein B456_011G032900 [Gossypium raimondii]
Length=422

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+SL SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  317  YKAEQEKLQQQIASARSSLSSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF 
Sbjct  377  KGRDKVIAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFG  422



>ref|XP_009405672.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=529

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  364  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKGFRES  423

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR+SL SV IDHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  424  YRAEQEKLQRQITSARSSLASVQIDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  483

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  484  KGRDKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  529



>gb|KHF97570.1| Magnesium-chelatase subunit chlI, chloroplastic [Gossypium arboreum]
Length=424

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ Q+A AR+SL SV ID D +VKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  319  YKAEQEKLQQQMASARSSLSSVQIDRDLKVKISRVCAELNVDGLRGDIVTNRAAKALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  379  KGRDRVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  424



>gb|KDO77798.1| hypothetical protein CISIN_1g014510mg [Citrus sinensis]
Length=369

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  204  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  263

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ KLQ QIA AR+SL +V IDHD +VKI KVCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  264  YKAEQAKLQQQIASARSSLPAVQIDHDLKVKISKVCAELNVDGLRGDIVSNRAAKALAAL  323

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIATV+PNCLR RLRKDPLESIDSG+L+IEKFYEVF+
Sbjct  324  KGRDKVSAEDIATVMPNCLRHRLRKDPLESIDSGLLIIEKFYEVFS  369



>ref|XP_009383480.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RA FD++PK FRE 
Sbjct  242  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERAGFDQDPKGFRET  301

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QIA AR+SL SV IDHD RVKI KVCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  302  YRAEQEKLQQQIASARSSLASVQIDHDLRVKISKVCAELNVDGLRGDIVSNRAAKALAAL  361

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  362  KGRDKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  407



>ref|XP_010249286.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Nelumbo nucifera]
Length=423

 Score =   276 bits (705),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R+RFDRNPKEFRE 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERSRFDRNPKEFRES  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+ L  V IDHD RVKI KVCAELNVDGLRGDIVTNRAARALA+L
Sbjct  318  YKAEQEKLQQQIASARSYLSFVQIDHDLRVKISKVCAELNVDGLRGDIVTNRAARALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V  EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  378  KGRDKVAPEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  423



>ref|XP_006467679.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Citrus sinensis]
 gb|KDO77797.1| hypothetical protein CISIN_1g014510mg [Citrus sinensis]
Length=423

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR+ 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDS  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ KLQ QIA AR+SL +V IDHD +VKI KVCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  318  YKAEQAKLQQQIASARSSLPAVQIDHDLKVKISKVCAELNVDGLRGDIVSNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIATV+PNCLR RLRKDPLESIDSG+L+IEKFYEVF+
Sbjct  378  KGRDKVSAEDIATVMPNCLRHRLRKDPLESIDSGLLIIEKFYEVFS  423



>ref|XP_006384056.1| hypothetical protein POPTR_0004s05270g [Populus trichocarpa]
 gb|ABK95697.1| unknown [Populus trichocarpa]
 gb|ERP61853.1| hypothetical protein POPTR_0004s05270g [Populus trichocarpa]
Length=417

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RA+FD+NPKEFRE 
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERAQFDKNPKEFRES  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK+EQEKLQ QI+ AR+ L SV IDHD +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  312  YKSEQEKLQQQISSARSFLSSVKIDHDLKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  372  KGRDQVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVSEKFYEVFS  417



>ref|XP_009383479.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RA FD++PK FRE 
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERAGFDQDPKGFRET  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QIA AR+SL SV IDHD RVKI KVCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  319  YRAEQEKLQQQIASARSSLASVQIDHDLRVKISKVCAELNVDGLRGDIVSNRAAKALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  379  KGRDKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  424



>ref|XP_002305090.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
 gb|EEE85601.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
Length=422

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RA+FD+NPKEFRE 
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERAQFDKNPKEFRES  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK+EQEKLQ QI+ AR+ L SV IDHD +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  317  YKSEQEKLQQQISSARSFLSSVKIDHDLKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  377  KGRDQVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVSEKFYEVFS  422



>ref|XP_008439769.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Cucumis melo]
Length=420

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDQNPKEFRES  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI+ AR SL SV ID D +VKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  315  YKAEQEKLQQQISSARCSLSSVQIDQDLKVKISRVCAELNVDGLRGDIVTNRAAKALAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  375  KGRDKVAAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  420



>ref|XP_011086016.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=424

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE RARFDRNPKEFRE 
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERARFDRNPKEFRES  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKA QEKLQ QIA AR+SL +VTID D +VKI +VCAELNVDGLRGDIVTNRAARALA+L
Sbjct  319  YKAAQEKLQRQIASARSSLSAVTIDQDLKVKISEVCAELNVDGLRGDIVTNRAARALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++EV AEDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  379  KGKDEVAAEDIATVIPNCLRHRLRKDPLESIDSGLLVLEKFYEVFT  424



>ref|XP_011086015.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=428

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE RARFDRNPKEFRE 
Sbjct  263  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERARFDRNPKEFRES  322

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKA QEKLQ QIA AR+SL +VTID D +VKI +VCAELNVDGLRGDIVTNRAARALA+L
Sbjct  323  YKAAQEKLQRQIASARSSLSAVTIDQDLKVKISEVCAELNVDGLRGDIVTNRAARALAAL  382

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++EV AEDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  383  KGKDEVAAEDIATVIPNCLRHRLRKDPLESIDSGLLVLEKFYEVFT  428



>gb|ACU23498.1| unknown [Glycine max]
Length=421

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFR+ 
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRDS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  AR+ LFSV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YKAEQEKLQQQITSARSVLFSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ V+AEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  376  KGRDNVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVFS  421



>gb|AAM98163.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Arabidopsis thaliana]
Length=418

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  253  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRET  312

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ KLQ QI  AR++L +V ID D +VKI KVCAEL+VDGLRGD+V NRAARALA+L
Sbjct  313  YQEEQLKLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDMVINRAARALATL  372

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVF 
Sbjct  373  QGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFT  418



>ref|XP_010925689.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Elaeis guineensis]
Length=427

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RA FDR+PK FRE 
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERAMFDRDPKGFRES  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QIA ARN+L S+ IDHD RVKI KVCAELNVDGLRGDIV NRAA+ALA+L
Sbjct  322  YRAEQEKLQRQIASARNNLGSIQIDHDLRVKISKVCAELNVDGLRGDIVANRAAKALAAL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTA+DIATVIPNCLR RLRKDPLESIDSG+L+IEKFYEVF+
Sbjct  382  KGRDKVTADDIATVIPNCLRHRLRKDPLESIDSGLLIIEKFYEVFS  427



>ref|XP_003543008.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Glycine 
max]
 sp|P93162.1|CHLI_SOYBN RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I-1; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; Flags: Precursor [Glycine max]
 dbj|BAA08291.1| Mg chelatase subunit (46 kD) [Glycine max]
 gb|KHN08462.1| Magnesium-chelatase subunit chlI, chloroplastic [Glycine soja]
Length=421

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFR+ 
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRDS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YKAEQEKLQQQITSARSVLSSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ V+AEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  376  KGRDNVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVFS  421



>ref|XP_007211734.1| hypothetical protein PRUPE_ppa006200mg [Prunus persica]
 gb|EMJ12933.1| hypothetical protein PRUPE_ppa006200mg [Prunus persica]
Length=422

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRGS  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  317  YQAEQEKLQQQIGSARSYLPSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  377  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  422



>ref|XP_008225200.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Prunus 
mume]
Length=422

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRGS  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  317  YQAEQEKLQQQIGSARSYLPSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  377  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  422



>ref|XP_002522534.1| Magnesium-chelatase subunit chlI, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF39834.1| Magnesium-chelatase subunit chlI, chloroplast precursor, putative 
[Ricinus communis]
Length=419

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R+RFD+NPKEFR+ 
Sbjct  254  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERSRFDKNPKEFRDS  313

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI+ AR +L  V ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  314  YKAEQEKLQQQISSARTALSQVQIDRDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  373

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIATVIPNCLR RLRKDPLES+DSG+LVIEKFYEVF+
Sbjct  374  KGRDKVSAEDIATVIPNCLRHRLRKDPLESVDSGLLVIEKFYEVFS  419



>ref|XP_008383653.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Malus 
domestica]
Length=421

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRVS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YEAEQEKLQEQIGAARSYLPSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  376  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  421



>ref|XP_009352812.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Pyrus x bretschneideri]
Length=421

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRVS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YEAEQEKLQEQIGAARSYLPSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  376  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  421



>ref|XP_002442883.1| hypothetical protein SORBIDRAFT_08g004300 [Sorghum bicolor]
 gb|EES16721.1| hypothetical protein SORBIDRAFT_08g004300 [Sorghum bicolor]
Length=422

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  317  YNEEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  377  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  422



>gb|ACN32024.1| unknown [Zea mays]
Length=413

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  248  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  307

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  308  YHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  367

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  368  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  413



>gb|ACF85806.1| unknown [Zea mays]
Length=424

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  319  YHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  379  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  424



>ref|NP_001105917.1| oil yellow1 [Zea mays]
 gb|AAZ14052.1| magnesium chelatase subunit I precursor [Zea mays]
 gb|AAZ14053.1| magnesium chelatase subunit I precursor [Zea mays]
 gb|ACG35191.1| magnesium-chelatase subunit chlI [Zea mays]
Length=415

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  250  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  309

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  310  YHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  369

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  370  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  415



>gb|ACF87583.1| unknown [Zea mays]
 gb|ACG34535.1| magnesium-chelatase subunit chlI [Zea mays]
 gb|AFW56173.1| oil yellow1 [Zea mays]
Length=422

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  317  YHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  377  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  422



>ref|XP_003528479.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Glycine max]
 gb|KHN30997.1| Magnesium-chelatase subunit chlI, chloroplastic [Glycine soja]
Length=414

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPK FR+ 
Sbjct  249  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKVFRDS  308

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QIA AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  309  YKAEQEKLQQQIASARSFLSSVQIDRDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  368

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++V+AEDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF
Sbjct  369  KGRDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVLEKFYEVF  413



>ref|XP_008662350.1| PREDICTED: oil yellow1 isoform X1 [Zea mays]
 gb|AFW56172.1| oil yellow1 [Zea mays]
Length=459

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  294  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  353

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  354  YHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  413

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  414  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  459



>gb|ACF83077.1| unknown [Zea mays]
Length=450

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  285  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  344

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  345  YHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  404

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  405  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  450



>gb|AFW56174.1| oil yellow1 [Zea mays]
Length=443

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  278  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRES  337

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  338  YHDEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGLRGDIVTNRAAKALAAL  397

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  398  KGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  443



>ref|XP_003593716.1| Magnesium-chelatase subunit chlI [Medicago truncatula]
 gb|AES63967.1| magnesium-chelatase subunit ChlI [Medicago truncatula]
Length=422

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRET  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKL  QI  AR  L SV ID D +VKI +VCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  317  YKAEQEKLTDQITSARKILSSVQIDQDLKVKISRVCAELNVDGLRGDIVSNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  377  KGRDQVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVFS  422



>ref|XP_003557120.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Brachypodium 
distachyon]
Length=417

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FR+ 
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKSFRQS  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI  AR +L SV +DHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  312  YLEEQEKLQEQITSARGNLGSVQLDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  372  KGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  417



>sp|A2XIK9.1|CHLI_ORYSI RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; AltName: Full=Protein CHLORINA 
9; Flags: Precursor [Oryza sativa Indica Group]
 gb|EAY90669.1| hypothetical protein OsI_12270 [Oryza sativa Indica Group]
Length=415

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  250  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKAFRES  309

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQ+KLQ QI+ AR++L +V IDHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  310  YLEEQDKLQQQISSARSNLGAVQIDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  369

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  370  KGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFT  415



>ref|NP_001050493.1| Os03g0563300 [Oryza sativa Japonica Group]
 sp|Q53RM0.1|CHLI_ORYSJ RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; AltName: Full=Protein CHLORINA 
9; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAX95610.1| magnesium chelatase ATPase subunit I [Oryza sativa Japonica Group]
 gb|ABF97128.1| Magnesium-chelatase subunit chlI, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12407.1| Os03g0563300 [Oryza sativa Japonica Group]
 gb|ABK58608.1| magnesium chelatase subunit I [Oryza sativa Japonica Group]
 gb|ABK58609.1| magnesium chelatase subunit I [Oryza sativa Japonica Group]
 gb|EAZ27502.1| hypothetical protein OsJ_11451 [Oryza sativa Japonica Group]
 dbj|BAG92109.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96680.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  250  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKAFRES  309

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQ+KLQ QI+ AR++L +V IDHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  310  YLEEQDKLQQQISSARSNLGAVQIDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  369

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  370  KGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFT  415



>gb|ACU19212.1| unknown [Glycine max]
Length=421

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFR+ 
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRDS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YKAEQEKLQQQITSARSVLSSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            K R++V+AEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  376  KERDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVFS  421



>gb|EPS68275.1| hypothetical protein M569_06494, partial [Genlisea aurea]
Length=344

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE RARFDRNPKEFR  
Sbjct  180  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERARFDRNPKEFRAG  239

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y AEQEKLQ QI+ AR  L SV ID D RVKI +VCAELNVDGLRGDIVTNRAARALA+L
Sbjct  240  YAAEQEKLQDQISSARGRLSSVAIDRDLRVKISRVCAELNVDGLRGDIVTNRAARALAAL  299

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR+EV AEDIATVIPNCLR RLRKDPLESIDSG+LV EKFY+VF
Sbjct  300  KGRDEVKAEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYQVF  344



>ref|XP_006650249.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Oryza brachyantha]
Length=417

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FRE 
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKAFRES  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKLQ QI+ AR++L +V IDHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  312  YLEEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  372  KGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFT  417



>ref|XP_003546019.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Glycine max]
 gb|KHN18928.1| Magnesium-chelatase subunit chlI, chloroplastic [Glycine soja]
Length=421

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFR+ 
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRDS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YKAEQEKLQQQITSARSVLSSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            K R++V+AEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  376  KERDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVFS  421



>gb|AFK38677.1| unknown [Lotus japonicus]
Length=421

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFRE 
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRET  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ+KL  QI  AR+ L +V ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YKAEQQKLTDQITAARSVLSAVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  376  KGRDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVFS  421



>ref|XP_007148073.1| hypothetical protein PHAVU_006G178400g [Phaseolus vulgaris]
 gb|ESW20067.1| hypothetical protein PHAVU_006G178400g [Phaseolus vulgaris]
Length=417

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NPKEFR+ 
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPKEFRDT  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ+KLQ QI  AR+ L SV ID D +VKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  312  YKAEQDKLQDQITSARSILSSVQIDQDLKVKISRVCAELNVDGLRGDIVTNRAAKALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+ EDIATVIPNCLR RLRKDPLESIDSG+LV EKFYEVF+
Sbjct  372  KGRDKVSTEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVFS  417



>ref|XP_010686344.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=425

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R  FD+NPKEFR  
Sbjct  260  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERGSFDKNPKEFRSS  319

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKL  QI+ AR+ L SV IDH+ RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  320  YKEEQEKLTTQISSARSMLSSVQIDHELRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  379

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF 
Sbjct  380  KGRDKVTTEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFG  425



>ref|XP_010686345.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=424

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R  FD+NPKEFR  
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERGSFDKNPKEFRSS  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKL  QI+ AR+ L SV IDH+ RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  319  YKEEQEKLTTQISSARSMLSSVQIDHELRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF 
Sbjct  379  KGRDKVTTEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFG  424



>ref|XP_004293922.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=421

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRVS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ+KLQ QI  AR+ L SV ID D +VKI +VC++LNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YEAEQDKLQQQITSARSGLSSVQIDQDLKVKISRVCSDLNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYE+F+
Sbjct  376  KGRDKVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEIFS  421



>ref|XP_008371445.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Malus domestica]
Length=421

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRVS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YEAEQEKLQEQIGSARSYLPSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG ++V+ EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF+
Sbjct  376  KGSDKVSPEDIATVIPNCLRHRLRKDPLESIDSGLLVMEKFYEVFS  421



>gb|EYU28056.1| hypothetical protein MIMGU_mgv1a006884mg [Erythranthe guttata]
Length=427

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDRNPKEFR  
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRNPKEFRVS  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ KLQ QI  AR  L  VTIDH+ RVKI +VC+ELNVDGLRGDIV+NRAA+ALA+L
Sbjct  322  YEAEQNKLQEQITAARKCLSKVTIDHELRVKISRVCSELNVDGLRGDIVSNRAAKALAAL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR++VT EDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF
Sbjct  382  RGRDKVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVF  426



>ref|XP_009347550.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Pyrus 
x bretschneideri]
Length=421

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFR  
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRVS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQEKLQ QI  AR+ L SV ID D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YEAEQEKLQEQIGSARSYLPSVQIDQDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG ++V+ EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF+
Sbjct  376  KGSDKVSPEDIATVIPNCLRHRLRKDPLESIDSGLLVMEKFYEVFS  421



>ref|XP_003542705.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Glycine max]
Length=421

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPK FR+ 
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKVFRDS  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ+ LQ QIA AR+ L SV ID + +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YKAEQQNLQQQIASARSFLSSVQIDRNLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KGR++V+AEDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF
Sbjct  376  KGRDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVLEKFYEVF  420



>ref|XP_004134671.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49283.1| hypothetical protein Csa_6G518380 [Cucumis sativus]
Length=420

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDQNPKEFRES  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ QI+ AR+SL SV ID D +VKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  315  YKAEQEKLQQQISSARSSLSSVQIDQDLKVKISRVCAELNVDGLRGDIVTNRAAKALAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V AEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  375  KGRDKVAAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  420



>gb|AET86637.1| chloroplast magnesium chelatase I subunit [Pisum sativum]
Length=422

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRET  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y AEQEKL  QI  AR+ L SV ID D +VKI +VCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  317  YNAEQEKLTEQITSARSLLSSVQIDQDLKVKISRVCAELNVDGLRGDIVSNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+ EDIATVIPNCLR RLRKDPLESIDSG+LV EKFYE+F+
Sbjct  377  KGRDKVSVEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEIFS  422



>ref|XP_008783919.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Phoenix 
dactylifera]
Length=427

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQV TVRDAELRVK VE RARFDR+PK FRE 
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVVTVRDAELRVKIVEERARFDRDPKGFRES  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+A+QEKL+ QIA AR+SL SV IDHD RVKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  322  YRADQEKLRQQIASARSSLASVQIDHDLRVKISKVCAELNVDGLRGDIVTNRAAKALAAL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            K R++VTA+DIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF 
Sbjct  382  KARDKVTADDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFG  427



>dbj|BAJ84973.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|ABF72535.3| magnesium chelatase 40-kDa subunit [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FR+ 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRQS  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQ+KLQ QI  AR++L SV +DHD RVKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  315  YLEEQDKLQEQITSARSNLGSVQLDHDLRVKISQVCSELNVDGLRGDIVTNRAAKALAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  375  KGRDVVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFG  420



>gb|ERM99293.1| hypothetical protein AMTR_s00092p00167540 [Amborella trichopoda]
Length=254

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = -3

Query  718  FILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREFYKA  539
             I+   G  +   +RPQLLDRFGMHAQVGTV+DAELRVK VE RARFD+NPKEFR+ Y+A
Sbjct  92   MIMGDRGTGKSTAVRPQLLDRFGMHAQVGTVKDAELRVKIVEERARFDQNPKEFRDSYQA  151

Query  538  EQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASLKGR  359
            EQEKLQ QI  AR +L SV IDHD RVKI +VCAELNVDGLRGDIVTNRA++ALASLKGR
Sbjct  152  EQEKLQNQITKARETLSSVQIDHDLRVKISRVCAELNVDGLRGDIVTNRASKALASLKGR  211

Query  358  NEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            ++VTAEDIATVIPNCLR RLRKDPLESIDSG+LVIEKFYEVF+
Sbjct  212  DKVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEVFS  254



>gb|EMT16090.1| Magnesium-chelatase subunit chlI, chloroplastic [Aegilops tauschii]
Length=326

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD++PK FR+ 
Sbjct  161  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKDPKTFRQS  220

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQ KLQ QI  AR++L SV +DHD RVKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  221  YLEEQGKLQDQITSARSNLGSVQLDHDLRVKISQVCSELNVDGLRGDIVTNRAAKALAAL  280

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  281  KGRDIVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFG  326



>ref|XP_004505124.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X3 [Cicer arietinum]
 ref|XP_004505125.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X4 [Cicer arietinum]
Length=417

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NP+EFR+ 
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPREFRDS  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ KLQ QI  AR+ L SV++D + +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  312  YKAEQAKLQQQITAARSFLSSVSMDRELKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIA VIPNCLR RLRKDPLESIDSG+LV+EKFYEVF+
Sbjct  372  KGRDKVSAEDIAIVIPNCLRHRLRKDPLESIDSGLLVMEKFYEVFS  417



>ref|XP_004505122.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004505123.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=420

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R RFD+NP+EFR+ 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERGRFDKNPREFRDS  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQ KLQ QI  AR+ L SV++D + +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  315  YKAEQAKLQQQITAARSFLSSVSMDRELKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++V+AEDIA VIPNCLR RLRKDPLESIDSG+LV+EKFYEVF+
Sbjct  375  KGRDKVSAEDIAIVIPNCLRHRLRKDPLESIDSGLLVMEKFYEVFS  420



>ref|XP_006280536.1| hypothetical protein CARUB_v10026479mg [Capsella rubella]
 gb|EOA13434.1| hypothetical protein CARUB_v10026479mg [Capsella rubella]
Length=419

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  254  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  313

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ KLQ QI  AR++L +V ID D +VKI KVCAEL+VDGLRGDIVTNRAARALA+L
Sbjct  314  YEAEQLKLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDIVTNRAARALAAL  373

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVF+
Sbjct  374  KGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFS  419



>ref|XP_007153702.1| hypothetical protein PHAVU_003G057600g [Phaseolus vulgaris]
 gb|ESW25696.1| hypothetical protein PHAVU_003G057600g [Phaseolus vulgaris]
Length=418

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RA FD+N   FR  
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERACFDKNSTGFRHS  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKLQ  IALAR+ L SV IDHD +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  312  YKAEQEKLQQVIALARSFLPSVQIDHDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            KG ++V+AEDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF
Sbjct  372  KGNDKVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVLEKFYEVF  416



>ref|XP_010441650.1| PREDICTED: magnesium-chelatase subunit ChlI-2, chloroplastic-like 
[Camelina sativa]
Length=420

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y AEQ +LQ QI  AR++L +V ID D +VKI KVCAEL+VDGLRGDIVTNRAARALA+L
Sbjct  315  YLAEQLQLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDIVTNRAARALAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVFN
Sbjct  375  KGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFN  420



>ref|XP_004485870.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Cicer arietinum]
Length=415

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE R+RFD NPKEFR  
Sbjct  250  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERSRFDMNPKEFRSS  309

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQEKL  QI LAR+ L SV ID D +VKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  310  YITEQEKLTEQITLARSVLSSVQIDQDLKVKISRVCAELNVDGLRGDIVTNRAAKALAAL  369

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ V+ EDIATVIPNCLR RLRKDPLESIDSG+LV EKFYE+F+
Sbjct  370  KGRDNVSIEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEIFS  415



>gb|EMS53132.1| Magnesium-chelatase subunit chlI, chloroplastic [Triticum urartu]
Length=419

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD++PK FR+ 
Sbjct  254  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKDPKTFRQS  313

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQ KLQ QI  AR++L SV +DHD RVKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  314  YLEEQGKLQDQITSARSNLGSVQLDHDLRVKISQVCSELNVDGLRGDIVTNRAAKALAAL  373

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  374  KGRDIVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFG  419



>gb|KFK28521.1| magnesium-chelatase subunit chli [Arabis alpina]
Length=421

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NPK+FRE 
Sbjct  256  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPKDFRET  315

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR++L SV ID + +VKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  316  YKTEQDKLQDQISTARSNLSSVQIDRELKVKISRVCSELNVDGLRGDIVTNRAAKALAAL  375

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTAED+ATVIPNCLR RLRKDPLESIDSGVLV EKF E+F+
Sbjct  376  KGKDRVTAEDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEIFS  421



>ref|XP_009136933.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic-like 
[Brassica rapa]
Length=423

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD +PKEFR+ 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSDPKEFRDT  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQEKLQ QI+ AR+ L SV ID + +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKTEQEKLQDQISNARSCLSSVQIDRELKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTA+D+ATVIPNCLR RLRKDPLESIDSGVLV EKF EVF+
Sbjct  378  KGKDRVTADDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEVFS  423



>ref|XP_006414096.1| hypothetical protein EUTSA_v10025291mg [Eutrema salsugineum]
 gb|ESQ55549.1| hypothetical protein EUTSA_v10025291mg [Eutrema salsugineum]
Length=423

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NPKEFR+ 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPKEFRDT  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ+KLQ QI+ AR++L SV ID + +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YRTEQDKLQDQISTARSNLSSVQIDRELKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTA+D+ATVIPNCLR RLRKDPLESIDSGVLV EKF EVF+
Sbjct  378  KGKDRVTADDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEVFS  423



>gb|KFK31505.1| hypothetical protein AALP_AA6G121400 [Arabis alpina]
Length=417

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  252  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  311

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ KLQ QI  AR++L  V ID D +VKI KVCAEL+VDGLRGDIVTNRAARALA+L
Sbjct  312  YEAEQLKLQEQITTARSNLSQVQIDQDLKVKISKVCAELDVDGLRGDIVTNRAARALAAL  371

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAED+  VI NCLR RLRKDPLES+DSG+LV EKFYEVF+
Sbjct  372  KGRDQVTAEDVGIVILNCLRHRLRKDPLESMDSGILVTEKFYEVFS  417



>ref|XP_010494748.1| PREDICTED: magnesium-chelatase subunit ChlI-2, chloroplastic 
[Camelina sativa]
Length=420

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y AEQ +LQ QI  AR++L +V ID D +VKI KVC+EL+VDGLRGDIVTNRAARALA+L
Sbjct  315  YLAEQLELQEQITTARSNLSAVQIDQDLKVKISKVCSELDVDGLRGDIVTNRAARALAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVF+
Sbjct  375  KGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFS  420



>ref|XP_006398276.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
 ref|XP_006398277.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
 gb|ESQ39729.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
 gb|ESQ39730.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
Length=466

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  301  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  360

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y AEQ KLQ QI  AR++L  V ID D +VKI +VCAEL+VDGLRGDIVTNRAARALA+L
Sbjct  361  YLAEQMKLQEQITNARSNLSQVQIDQDLKVKISRVCAELDVDGLRGDIVTNRAARALAAL  420

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVF+
Sbjct  421  KGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFS  466



>ref|XP_010540495.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=423

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+FILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R+RFD NPKEFR  
Sbjct  258  PAKFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKVVEERSRFDENPKEFRAS  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ+K++ QI LAR +L SV  D D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YEVEQDKMKRQITLARYNLLSVRTDRDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFY+VF+
Sbjct  378  KGRDRVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVMEKFYKVFS  423



>ref|XP_010540494.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=424

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+FILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R+RFD NPKEFR  
Sbjct  259  PAKFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKVVEERSRFDENPKEFRAS  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ+K++ QI LAR +L SV  D D +VKI KVCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  319  YEVEQDKMKRQITLARYNLLSVRTDRDLKVKISKVCAELNVDGLRGDIVTNRAAKALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VT EDIATVIPNCLR RLRKDPLESIDSG+LV+EKFY+VF+
Sbjct  379  KGRDRVTPEDIATVIPNCLRHRLRKDPLESIDSGLLVMEKFYKVFS  424



>emb|CDY55641.1| BnaA03g58320D [Brassica napus]
Length=423

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD +PKEFR+ 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSDPKEFRDT  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQEKLQ QI+ AR+ L SV ID + +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YETEQEKLQDQISNARSCLSSVQIDRELKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTA+D+ATVIPNCLR RLRKDPLESIDSGVLV EKF EVF+
Sbjct  378  KGKDRVTADDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEVFS  423



>ref|XP_009131778.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic 
[Brassica rapa]
Length=423

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NP++FRE 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPQDFRET  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR++L SV ID + +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKTEQDKLQDQISNARSNLSSVQIDRELKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTA+D+ATVIPNCLR RLRKDPLESIDSGVLV EKF EVF+
Sbjct  378  KGKDRVTADDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEVFS  423



>emb|CDX78860.1| BnaA01g09270D [Brassica napus]
Length=423

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NP++FRE 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPQDFRET  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR++L SV ID + +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKTEQDKLQDQISNARSNLASVQIDRELKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTA+D+ATVIPNCLR RLRKDPLESIDSGVLV EKF EVF+
Sbjct  378  KGKDRVTADDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEVFS  423



>emb|CDX99465.1| BnaC01g10870D [Brassica napus]
Length=423

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NP++FRE 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPQDFRET  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR++L SV ID + +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKTEQDKLQDQISNARSNLSSVQIDRELKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTA+D+ATVIPNCLR RLRKDPLESIDSGVLV EKF EVF+
Sbjct  378  KGKDRVTADDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEVFS  423



>emb|CDY01542.1| BnaC07g35320D [Brassica napus]
Length=427

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD +PKEFR+ 
Sbjct  262  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSDPKEFRDT  321

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR+ L SV ID   +VKI KVC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  322  YKTEQDKLQDQISNARSCLSSVQIDRQLKVKISKVCSELNVDGLRGDIVTNRAAKALAAL  381

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VTA+D+ATVIPNCLR RLRKDPLESIDSGVLV EKF EVF+
Sbjct  382  KGKDRVTADDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEVFS  427



>ref|NP_199405.2| magnesium chelatase subunit I2 [Arabidopsis thaliana]
 sp|Q5XF33.1|CHLI2_ARATH RecName: Full=Magnesium-chelatase subunit ChlI-2, chloroplastic; 
Short=Mg-chelatase subunit I-2; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI-2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAU90073.1| At5g45930 [Arabidopsis thaliana]
 gb|AED95316.1| magnesium chelatase subunit I2 [Arabidopsis thaliana]
Length=418

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  253  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRET  312

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ KLQ QI  AR++L +V ID D +VKI KVCAEL+VDGLRGD+V NRAARALA+L
Sbjct  313  YQEEQLKLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDMVINRAARALAAL  372

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVF 
Sbjct  373  QGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFT  418



>ref|XP_002865216.1| Mg chelatase subunit I [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41475.1| Mg chelatase subunit I [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  253  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  312

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ KLQ QI  AR++L +V ID D +VKI KVCAEL+VDGLRGD+V NRAARALA+L
Sbjct  313  YQAEQLKLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDMVINRAARALAAL  372

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFY+VF+
Sbjct  373  QGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYKVFS  418



>dbj|BAB09321.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Arabidopsis thaliana]
Length=423

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRET  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ KLQ QI  AR++L +V ID D +VKI KVCAEL+VDGLRGD+V NRAARALA+L
Sbjct  318  YQEEQLKLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDMVINRAARALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVF 
Sbjct  378  QGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFT  423



>ref|XP_010496228.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic 
[Camelina sativa]
Length=423

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NPK+FRE 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPKDFRET  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR +L SV ID + +VKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKTEQDKLQDQISTARANLASVQIDRELKVKISRVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VT +D+ATVIPNCLR RLRKDPLESIDSGVLV EKF E+F+
Sbjct  378  KGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEIFS  423



>ref|XP_010439849.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic-like 
[Camelina sativa]
Length=430

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NPK+FRE 
Sbjct  265  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPKDFRET  324

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR +L SV ID + +VKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  325  YKTEQDKLQDQISTARANLASVQIDRELKVKISRVCSELNVDGLRGDIVTNRAAKALAAL  384

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VT +D+ATVIPNCLR RLRKDPLESIDSGVLV EKF E+F+
Sbjct  385  KGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEIFS  430



>ref|XP_010434526.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic-like 
[Camelina sativa]
Length=430

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NPK+FRE 
Sbjct  265  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPKDFRET  324

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR +L SV ID + +VKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  325  YKTEQDKLQDQISTARANLSSVQIDRELKVKISRVCSELNVDGLRGDIVTNRAAKALAAL  384

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VT +D+ATVIPNCLR RLRKDPLESIDSGVLV EKF E+F+
Sbjct  385  KGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEIFS  430



>emb|CAI38864.1| Mg chelatase subunit I [Arabidopsis thaliana]
Length=418

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD +PKEFRE 
Sbjct  253  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSSPKEFRES  312

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ KLQ QI  AR++L +V ID D +VKI KVCAEL+VDGLRGD+V NRAARALA+L
Sbjct  313  YQEEQLKLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDMVINRAARALAAL  372

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR++VTAED+  VIPNCLR RLRKDPLES+DSG+LV EKFYEVF 
Sbjct  373  QGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYEVFT  418



>ref|XP_009128828.1| PREDICTED: magnesium-chelatase subunit ChlI-2, chloroplastic 
[Brassica rapa]
Length=420

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE 
Sbjct  255  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRES  314

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQ KLQ QI  AR++L  V I+ D +VKI +VCAEL+VDGLRGDIVTNRAARALA+L
Sbjct  315  YLEEQMKLQEQITSARSNLSGVEINQDLKVKISRVCAELDVDGLRGDIVTNRAARALAAL  374

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KGR+ VTAED+  VIPNCLR RLRKDPLES+DSG++V EKFYEVF+
Sbjct  375  KGRDHVTAEDVGIVIPNCLRHRLRKDPLESMDSGIVVTEKFYEVFS  420



>ref|NP_193583.1| magnesium-chelatase subunit chlI [Arabidopsis thaliana]
 sp|P16127.1|CHLI1_ARATH RecName: Full=Magnesium-chelatase subunit ChlI-1, chloroplastic; 
Short=Mg-chelatase subunit I-1; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI-1; AltName: Full=Protein CHLORINA 
42; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA62754.1| protoporphyrin-IX Mg-chetalase [Arabidopsis thaliana]
 emb|CAA16728.1| protein ch-42 precursor, chloroplast [Arabidopsis thaliana]
 emb|CAB38561.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAB78850.1| protein ch-42 precursor, chloroplast [Arabidopsis thaliana]
 gb|AAM13191.1| protein ch-42 precursor, chloroplast [Arabidopsis thaliana]
 gb|AAQ22598.1| At4g18480 [Arabidopsis thaliana]
 dbj|BAE99191.1| protein ch-42 precursor [Arabidopsis thaliana]
 gb|ACG24204.1| magnesium-chelatase subunit chlI [Zea mays]
 gb|AEE84051.1| magnesium-chelatase subunit chlI [Arabidopsis thaliana]
 prf||1811226A ccsA gene
Length=424

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD NPK+FR+ 
Sbjct  259  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSNPKDFRDT  318

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR +L SV ID + +VKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  319  YKTEQDKLQDQISTARANLSSVQIDRELKVKISRVCSELNVDGLRGDIVTNRAAKALAAL  378

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VT +D+ATVIPNCLR RLRKDPLESIDSGVLV EKF E+F+
Sbjct  379  KGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEIFS  424



>gb|AAA99720.1| Mg-chelatase subunit, partial [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFDR+PK FR+ 
Sbjct  165  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDRDPKTFRQS  224

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNR-AARALAS  371
            Y  EQ+KLQ QI  AR++L SV +DHD RVKI +VC+ELNVDGLRGDIVTNR  A+ALA+
Sbjct  225  YLEEQDKLQEQITSARSNLGSVQLDHDLRVKISQVCSELNVDGLRGDIVTNRAYAKALAA  284

Query  370  LKGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            LKG++ VT EDI+TVIP  LR RLRKDPLESIDSG+LV+EKFYEVF 
Sbjct  285  LKGKDVVTVEDISTVIPTVLRHRLRKDPLESIDSGLLVVEKFYEVFG  331



>ref|XP_006283787.1| hypothetical protein CARUB_v10004877mg [Capsella rubella]
 gb|EOA16685.1| hypothetical protein CARUB_v10004877mg [Capsella rubella]
Length=425

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD +PK+FRE 
Sbjct  260  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSDPKDFRET  319

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR +L SV ID + +VKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  320  YKTEQDKLQDQISTARANLSSVQIDRELKVKISRVCSELNVDGLRGDIVTNRAAKALAAL  379

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VT +D+ATVIPNCLR RLRKDPLESIDSGVLV EKF E+F+
Sbjct  380  KGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEIFS  425



>ref|XP_002867988.1| hypothetical protein ARALYDRAFT_914833 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44247.1| hypothetical protein ARALYDRAFT_914833 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDA+LRVK VE RARFD +PK+FRE 
Sbjct  258  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKIVEERARFDSDPKDFRET  317

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+KLQ QI+ AR +L SV ID + +VKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  318  YKTEQDKLQDQISTARANLSSVQIDRELKVKISRVCSELNVDGLRGDIVTNRAAKALAAL  377

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            KG++ VT +D+ATVIPNCLR RLRKDPLESIDSGVLV EKF E+F+
Sbjct  378  KGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAEIFS  423



>ref|XP_002989492.1| hypothetical protein SELMODRAFT_235795 [Selaginella moellendorffii]
 gb|EFJ09368.1| hypothetical protein SELMODRAFT_235795 [Selaginella moellendorffii]
Length=365

 Score =   251 bits (640),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQV TV+DAELRVK VE R  FD++P EFRE 
Sbjct  197  PARFILIGSGNPEEGELRPQLLDRFGMHAQVTTVKDAELRVKIVEERGAFDQDPGEFREK  256

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +LQ QI  AR  L  V I+H+ RVKI +VCAEL+VDGLRGDIVTNRAA+ALA+L
Sbjct  257  YLGPQSELQRQITEARVRLPGVKIEHELRVKISRVCAELDVDGLRGDIVTNRAAKALAAL  316

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR+EV+ +DI TVIPNCLR RLRKDPLESIDSG+LV+EKF EVF 
Sbjct  317  QGRDEVSPKDILTVIPNCLRHRLRKDPLESIDSGLLVVEKFSEVFG  362



>ref|NP_683790.1| Mg-protoporyphyrin IX chelatase [Chaetosphaeridium globosum]
 gb|AAM96508.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chaetosphaeridium globosum]
Length=354

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R  FD+NPK FR+ 
Sbjct  185  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEQRTSFDQNPKVFRDS  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y++ Q+ L  QI  AR  L  V ID+  RV I ++CAELNVDGLRGDIVTNRA++ALA+L
Sbjct  245  YQSSQDNLSSQINEARERLPKVKIDYALRVNISRICAELNVDGLRGDIVTNRASKALAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN*GT  221
            +GR EVT +DI TVIP CLR RLRKDPLESIDSG+LV+EKF ++F   T
Sbjct  305  RGRFEVTPKDIMTVIPLCLRHRLRKDPLESIDSGLLVLEKFSQIFGYST  353



>gb|KHN47199.1| Magnesium-chelatase subunit chlI, chloroplastic [Glycine soja]
Length=317

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  697  NPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREFYKAEQEKLQX  518
            NPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPK FR+ YKAEQ+ LQ 
Sbjct  162  NPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKVFRDSYKAEQQNLQQ  221

Query  517  QIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASLKGRNEVTAED  338
            QIA AR+ L SV ID + +VKI KVCAELNVDGLRGDIVTNRAA+ALA+LKGR++V+AED
Sbjct  222  QIASARSFLSSVQIDRNLKVKISKVCAELNVDGLRGDIVTNRAAKALAALKGRDKVSAED  281

Query  337  IATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            IATVIPNCLR RLRKDPLESIDSG+LV+EKFYEVF
Sbjct  282  IATVIPNCLRHRLRKDPLESIDSGLLVLEKFYEVF  316



>ref|YP_636541.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Zygnema circumcarinatum]
 gb|AAX45804.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Zygnema circumcarinatum]
Length=357

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R+RFD+NPK FR+ 
Sbjct  185  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERSRFDQNPKSFRDA  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q+ L+ QI  AR  L +V ID++ RV I K+CAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  245  YNLAQDNLRQQIMQARERLPNVKIDYELRVNISKICAELNVDGLRGDIVTNRAAKALAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
              R+ V  +DI T+IP CLR RLRKDPLESIDSG+LV EKF +VF
Sbjct  305  GNRDNVIPKDILTIIPLCLRHRLRKDPLESIDSGLLVKEKFSQVF  349



>ref|YP_009033847.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Mesotaenium endlicherianum]
 gb|AHZ11230.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Mesotaenium endlicherianum]
Length=354

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+D ELRVK VE R+ FDR+P  FR  
Sbjct  186  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDPELRVKIVEERSSFDRDPGAFRTA  245

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q+ L+ QI+ +R  L  + +D+D RVKI +VCAELNVDGLRGDIVTNRAA+ALA+L
Sbjct  246  YRVPQDHLREQISHSRERLSQIHLDYDLRVKISQVCAELNVDGLRGDIVTNRAAKALAAL  305

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN*GT  221
              R+EVT +DI TVIP CLR RLRKDPLESIDSG+LV EKF +VF   T
Sbjct  306  GDRSEVTVKDIWTVIPLCLRHRLRKDPLESIDSGLLVQEKFSKVFGYST  354



>ref|XP_001761873.1| predicted protein [Physcomitrella patens]
 gb|EDQ73314.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R  FD NPK FR  
Sbjct  190  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEERGMFDANPKSFRVN  249

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L+ +I  AR  L  V + HD RVKI +VC+EL+VDGLRGDIV+NRAA+A A+ 
Sbjct  250  YDITQKELRDRIDNARAILSGVKVPHDLRVKISQVCSELDVDGLRGDIVSNRAAKAFAAF  309

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVTAEDI  V+PNCLR RLRKDPLESIDSG LV++KF EVF 
Sbjct  310  QGRTEVTAEDIRAVMPNCLRHRLRKDPLESIDSGTLVVDKFNEVFG  355



>ref|XP_001758041.1| predicted protein [Physcomitrella patens]
 gb|EDQ77283.1| predicted protein [Physcomitrella patens]
Length=354

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+D ELRVK VE R  FD NPK FR  
Sbjct  186  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDPELRVKIVEERGMFDANPKSFRVN  245

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L+ +I  AR  L SV + HD RVKI +VC+EL+VDGLRGDIV+NRA++A A+ 
Sbjct  246  YDTTQKELRDRIDNARAILSSVKVPHDLRVKISQVCSELDVDGLRGDIVSNRASKAFAAF  305

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN*GT  221
            +GR EVTAEDI  V+PNCLR RLRKDPLESIDSG LV++KF EVF   T
Sbjct  306  QGRTEVTAEDIRAVMPNCLRHRLRKDPLESIDSGTLVVDKFNEVFGYST  354



>emb|CDY50485.1| BnaA02g24150D [Brassica napus]
Length=338

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  700  GNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREFYKAEQEKLQ  521
            GNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD NPKEFRE Y  EQ KLQ
Sbjct  182  GNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDSNPKEFRESYLEEQMKLQ  241

Query  520  XQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASLKGRNEVTAE  341
             QI  AR++L  V ID D +VKI +VCAEL+VDGLRGDIVTNRAARALA+LKGR+ VTAE
Sbjct  242  EQITSARSNLSGVEIDQDLKVKISRVCAELDVDGLRGDIVTNRAARALAALKGRDHVTAE  301

Query  340  DIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            D+  VIPNCLR RLRKDPLES+DSG++V EKFYEVF+
Sbjct  302  DVGIVIPNCLRHRLRKDPLESMDSGIVVTEKFYEVFS  338



>ref|YP_009033686.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Roya anglica]
 gb|AHZ11069.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Roya anglica]
Length=357

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRVK VE R+ FD++PKEFR+ 
Sbjct  185  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEQRSSFDQDPKEFRDA  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK  QE L  QI  AR  L SV +D+D RV I K+C+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  245  YKLSQENLSQQIRQARECLPSVKLDYDLRVNISKICSELNVDGLRGDIVTNRAAKALAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
             GR++VT +DI TVIP CLR RLRKDPLESIDSG+LV EKF +VF
Sbjct  305  GGRDQVTPKDILTVIPLCLRHRLRKDPLESIDSGLLVKEKFSQVF  349



>gb|AIT94137.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Marsupiomonas sp. NIES 1824]
Length=353

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++ ELRV+ VE RA+FD NP  FR  
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPELRVQIVEQRAKFDENPTSFRSL  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q  L  +IA AR  L  +TID+D+RVKI ++C+ELNVDGLRGD+VTNRAA+ALA  
Sbjct  245  YNESQSTLSEKIADARRRLKEITIDYDYRVKISQICSELNVDGLRGDLVTNRAAKALACF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GRNEVT +DI  VIP CLR RLRKDPLE+IDSG  V E F EVF
Sbjct  305  EGRNEVTVDDIYRVIPLCLRHRLRKDPLETIDSGDKVRETFCEVF  349



>gb|AFK44500.1| unknown [Medicago truncatula]
Length=418

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVK VE RARFD+NPKEFRE 
Sbjct  257  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRET  316

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YKAEQEKL  QI  AR  L SV ID D +VKI +VCAELNVDGLRGDIV+NRAA+ALA+L
Sbjct  317  YKAEQEKLTDQITSARKILSSVRIDQDLKVKISRVCAELNVDGLRGDIVSNRAAKALAAL  376

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPL  284
            KGR++VT EDIATVIPNCLR RLRKDP 
Sbjct  377  KGRDQVTVEDIATVIPNCLRHRLRKDPF  404



>emb|CDX87756.1| BnaC02g31930D [Brassica napus]
Length=338

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  700  GNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREFYKAEQEKLQ  521
            GNPEEGELRPQLLDRFGMHAQV TVRDAELRVK VE RA FD NPKEFRE Y  EQ KLQ
Sbjct  182  GNPEEGELRPQLLDRFGMHAQVSTVRDAELRVKIVEERACFDSNPKEFRESYLEEQMKLQ  241

Query  520  XQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASLKGRNEVTAE  341
             QI  AR++L  V ID D +VKI +VCAEL+VDGLRGDIVTNRAARALA+LKGR+ VTAE
Sbjct  242  EQITSARSNLSGVEIDQDLKVKISRVCAELDVDGLRGDIVTNRAARALAALKGRDHVTAE  301

Query  340  DIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            D+  VIPNCLR RLRKDPLES+DSG++V EKFYEVF+
Sbjct  302  DVGIVIPNCLRHRLRKDPLESMDSGIVVTEKFYEVFS  338



>ref|YP_009106170.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Paradoxia multiseta]
 gb|AIT94906.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Paradoxia multiseta]
Length=351

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DAELRVK VE RA FD +P  FR  
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDAELRVKIVEQRASFDESPVGFRNH  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q++L  +I  AR  L  V+ID+DFRVKI ++C+EL+VDGLRGDIVTNRA++ALA+L
Sbjct  245  YQGSQQELTDRIVAARKLLEKVSIDYDFRVKISQICSELDVDGLRGDIVTNRASQALAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI  +IP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  EGRMEVTPQDIFRIIPLCLRHRLRKDPLESIDSGDKVREAFKKVF  349



>ref|YP_009106316.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Interfilum terricola]
 gb|AIT95078.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Interfilum terricola]
Length=352

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DA LRVK VE RA FD +P  FR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDANLRVKIVEQRANFDESPLNFRQN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q +L+ +I  ARN L +V I++D+R+KI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  245  YEESQNELRERIITARNLLKNVNIEYDYRIKISQICSELNVDGLRGDIVTNRASKALAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI  VIP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  EGRTEVTPQDIFRVIPLCLRHRLRKDPLESIDSGDKVRETFKKVF  349



>ref|YP_635727.1| Mg-protoporyphyrin IX chelatase [Chara vulgaris]
 gb|ABA61906.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chara vulgaris]
Length=358

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            P+RFILIGSGNPEEGELRPQLLDRFGMH  V TV++  LRVK VE R+ FD++P +FR+ 
Sbjct  185  PSRFILIGSGNPEEGELRPQLLDRFGMHVNVSTVKEPNLRVKIVEQRSNFDKDPIQFRDI  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK+ QE L  QI  AR  L  V ID++ R+KI ++CAELN+DGLRGDIVTNRAA+AL + 
Sbjct  245  YKSSQENLSQQIKDARTKLSEVEIDYELRIKISQICAELNIDGLRGDIVTNRAAKALTAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            K   +VT ++I TVIP CLR RLRKDPLESIDSG+LV EKF EVF
Sbjct  305  KNSQKVTPKEIFTVIPLCLRHRLRKDPLESIDSGLLVQEKFSEVF  349



>ref|YP_006234199.1| Mg-protoporyphyrin IX chelatase [Eutreptiella gymnastica]
 emb|CCE26486.1| Mg-protoporyphyrin IX chelatase [Eutreptiella gymnastica]
Length=349

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTVR+ +LRVK VE RA FD+NPKEFR+ 
Sbjct  182  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVREPDLRVKIVEQRALFDQNPKEFRDK  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
               +Q+KL  QI  AR  L  V ID+D R+KI ++C+ELNVDGLRGD+VTNRAA+AL + 
Sbjct  242  CLTDQQKLMKQIVDARQQLKEVNIDYDLRLKISEICSELNVDGLRGDMVTNRAAKALVAF  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR+EVT +DI T+I  CLR RLRKDPLE+IDSGV V E F   F
Sbjct  302  EGRSEVTPKDIYTIITLCLRHRLRKDPLETIDSGVKVQEVFNRAF  346



>ref|YP_009105764.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella corcontica]
 gb|AIT94472.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella corcontica]
Length=352

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++ +LRVK VE RA FD++P +FR +
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEQRANFDKSPVDFRSY  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q  L+ +I  ARN L  V++ +DFR+KI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  245  YEKSQNDLKNKIITARNLLKEVSLKYDFRIKISQICSELNVDGLRGDIVTNRASKALAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + RNEVT +DI  +IP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  ENRNEVTPQDIFRIIPLCLRHRLRKDPLESIDSGEKVREVFKKVF  349



>gb|ABX82652.1| magnesium chelatase subunit of protochlorophyllide [Trebouxia 
aggregata]
Length=290

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++A LRVK VE RA FD +P +FRE 
Sbjct  124  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEANLRVKIVEERANFDESPLDFREN  183

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  ++  AR  L  V ID+DFR+KI ++C+ELNVDGLRGDIVTNRA++A+AS 
Sbjct  184  YNESQKELTKKLTQARELLKKVEIDYDFRIKISQICSELNVDGLRGDIVTNRASKAIASF  243

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR +VT +DI  +IP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  244  EGRTQVTPQDIFRIIPLCLRHRLRKDPLESIDSGEKVREVFKKVF  288



>ref|NP_050837.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Nephroselmis olivacea]
 sp|Q9TL08.1|CHLI_NEPOL RecName: Full=Magnesium-chelatase subunit ChlI; Short=Mg-chelatase 
subunit I-1; AltName: Full=Mg-protoporphyrin IX chelatase 
subunit ChlI (chloroplast) [Nephroselmis olivacea]
 gb|AAD54808.1|AF137379_31 magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Nephroselmis olivacea]
Length=355

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTVR+ ELRVK VE RA FD NPKEFR+ 
Sbjct  186  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVREPELRVKIVEQRATFDENPKEFRQS  245

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q  L  Q+  AR  L  V  D+  RVKI +VC+ELNVDGLRGDIVTNRAA+ALA+L
Sbjct  246  YETSQASLTSQLTEARARLRQVQTDYSLRVKISQVCSELNVDGLRGDIVTNRAAKALAAL  305

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR  V+ EDI  +I  CLR RLRKDPLESIDSG  V E F  VF 
Sbjct  306  EGRTSVSVEDIGRIITLCLRHRLRKDPLESIDSGEKVQEVFSIVFG  351



>ref|YP_636458.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Staurastrum punctulatum]
 gb|AAX45691.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Staurastrum punctulatum]
Length=357

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV+DAELRV+ VE RA FD++P  FRE 
Sbjct  185  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVQIVEQRANFDKDPVSFREM  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q  L+ QI  AR  L +V ++HD RV I K+CAELN+DGLRGDIVTNRAA+ALA+L
Sbjct  245  YEKAQSNLREQIKQARERLPNVQLEHDLRVNISKICAELNIDGLRGDIVTNRAAKALAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
             GR +VT +DI TVIP CLR RLRKDPLESIDSG+LV EKF +VF
Sbjct  305  GGRLQVTPKDILTVIPLCLRHRLRKDPLESIDSGLLVKEKFSQVF  349



>ref|YP_009105900.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Microthamnion kuetzingianum]
 gb|AIT94671.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Microthamnion kuetzingianum]
Length=353

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DA LRVK VE RA FD +P +FR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDANLRVKIVEQRASFDESPVDFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y A QE+L  ++  AR+ L  V +D+DFRVKI ++C+ELNVDGLRGDIVTNRA++AL + 
Sbjct  245  YNASQEELTLKLGRARDLLKKVEMDYDFRVKISQICSELNVDGLRGDIVTNRASKALTAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR +VT EDI  VIP CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  305  EGRVQVTPEDIFRVIPLCLRHRLRKDPLESIDSGDKVRDMFKKVFG  350



>ref|YP_009105984.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Gloeotilopsis sterilis]
 gb|AIT94746.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Gloeotilopsis sterilis]
Length=352

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DA LRVK VE RA FD +P  FR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDANLRVKIVEQRANFDESPLNFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L+ +I  AR+ L +V I++D+R+KI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  245  YDESQNELREKIITARHILKNVNIEYDYRIKISQICSELNVDGLRGDIVTNRASKALAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI  VIP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  EGRTEVTPQDIFRVIPLCLRHRLRKDPLESIDSGDKVRETFKKVF  349



>ref|YP_009106193.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Planctonema lauterbornii]
 gb|AIT94996.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Planctonema lauterbornii]
Length=351

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTVRD +LRV+ VE RA FD +P EFRE 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVRDPQLRVQIVEQRASFDESPLEFREN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L+ ++  AR  L  V ID+++RVKI ++C+ELNVDGLRGDIVTNRA+++LA+ 
Sbjct  245  YNDSQSELRQKLIEARELLKEVEIDYEYRVKISEICSELNVDGLRGDIVTNRASKSLAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GRN+VTA+DI  VIP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  EGRNQVTAQDIFRVIPLCLRHRLRKDPLESIDSGDKVREIFKKVF  349



>ref|YP_006666490.1| photochlorophyllide reductase subunit L (chloroplast) [Trebouxiophyceae 
sp. MX-AZ01]
 gb|AFQ93845.1| photochlorophyllide reductase subunit L (chloroplast) [Trebouxiophyceae 
sp. MX-AZ01]
Length=351

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+D ELRVK VE RA FD +P  FR  
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDPELRVKIVEQRASFDESPVGFRSH  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  +I  AR  L  VTID+D R+KI ++C+EL+VDGLRGDIVTNRA++ALA+ 
Sbjct  245  YLGSQQELAERIVSARALLEGVTIDYDARIKISQICSELDVDGLRGDIVTNRASKALAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVTA+DI  VIP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  EGRTEVTAQDIFRVIPLCLRHRLRKDPLESIDSGDKVREVFRKVF  349



>ref|YP_009104898.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Myrmecia israelensis]
 gb|AIT93395.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Myrmecia israelensis]
Length=347

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DA LRVK VE R+ FD +P EFR  
Sbjct  182  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDAVLRVKIVEQRSNFDESPLEFRNN  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  ++  AR  L  V ID+DFRVKI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  242  YNQSQQELTKKLIQARELLKKVEIDYDFRVKISQICSELNVDGLRGDIVTNRASKALAAF  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +D+  VIP CLR RLRKDPLESIDSG  V E F ++F
Sbjct  302  EGRTEVTPQDVFRVIPLCLRHRLRKDPLESIDSGDKVREVFKKIF  346



>ref|YP_009105211.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pabia signiensis]
 gb|AIT93806.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pabia signiensis]
Length=352

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+++ LRV+ VE RA FD  P EFR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKESNLRVQIVEQRASFDEAPLEFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK  Q++L  ++  AR +L +V ID+DFR+KI ++C+ELNVDGLRGDIVTNRA++A+A+ 
Sbjct  245  YKDSQKELTEKLTQARKNLKNVEIDYDFRIKISQICSELNVDGLRGDIVTNRASKAIAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R EVT EDI  VIP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  ENRTEVTPEDIFRVIPLCLRHRLRKDPLESIDSGDKVRETFKKVF  349



>ref|WP_010871795.1| magnesium-chelatase subunit ChlI [Synechocystis sp. PCC 6803]
 ref|NP_440486.1| Mg chelatase subunit ChlI [Synechocystis sp. PCC 6803]
 sp|P51634.2|CHLI_SYNY3 RecName: Full=Magnesium-chelatase subunit ChlI; AltName: Full=Mg-protoporphyrin 
IX chelatase [Synechocystis sp. PCC 6803 
substr. Kazusa]
 dbj|BAA17166.1| Mg chelatase subunit; ChlI [Synechocystis sp. PCC 6803]
 dbj|BAK49339.1| Mg chelatase subunit [Synechocystis sp. PCC 6803]
 dbj|BAL28338.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL31508.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL34677.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM50885.1| Mg chelatase subunit ChlI [Synechocystis sp. PCC 6803] [Synechocystis 
sp. PCC 6803]
 gb|AGF50856.1| Mg chelatase subunit ChlI [Synechocystis sp. PCC 6803]
Length=357

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TVR+ ELRVK VE R  FD+NP  F + 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPELRVKIVEQRTEFDQNPHPFCDQ  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQE LQ +I  A+N L  VTID+D+RVK+ +VCAEL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  247  YQTEQEALQAKIVNAQNLLPQVTIDYDYRVKVSEVCAELDVDGLRGDIVTNRAAKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI+ VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDISRVIVLCLRHRLRKDPLESIDSGSKVEKVFKRVFG  352



>ref|YP_001019148.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chlorokybus atmophyticus]
 gb|ABM87951.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chlorokybus atmophyticus]
Length=358

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+FILIGSGNPEEGELRPQLLDRFGMHA++ TV+DA+LRVK VE R+ FD+N  +FRE 
Sbjct  186  PAKFILIGSGNPEEGELRPQLLDRFGMHAEIRTVKDADLRVKIVEKRSSFDKNATQFREL  245

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK  QE+++ QI  AR+ L++V ++ D RVK+ ++CAEL+VDGLRGD+VTNRAARALA+ 
Sbjct  246  YKQSQEQVKDQIIEARSRLYTVEMERDLRVKVSQICAELDVDGLRGDLVTNRAARALAAF  305

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR++V   DI  +I  CLR RLRKDPLESIDSG  V EKF++VF
Sbjct  306  EGRDQVVPRDIYRIIVLCLRHRLRKDPLESIDSGSRVEEKFFQVF  350



>ref|YP_009106384.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Fusochloris perforata]
 gb|AIT95159.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Fusochloris perforata]
Length=353

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DA LRVK VE RA FD +P +FR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDANLRVKIVEQRASFDESPVDFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  ++  AR  L  V ID+DFR+KI ++C+ELNVDGLRGDIVTNRA++ALAS 
Sbjct  245  YNESQQELTNKLDEARKLLKKVEIDYDFRIKISQICSELNVDGLRGDIVTNRASKALASF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR +VT +DI  VIP CLR RLRKDPLESIDSG  V + F ++F
Sbjct  305  EGRTQVTPQDIFRVIPLCLRHRLRKDPLESIDSGDKVRDVFKKIF  349



>ref|WP_011057351.1| magnesium chelatase [Thermosynechococcus elongatus]
 ref|NP_682301.1| magnesium-chelatase subunit [Thermosynechococcus elongatus BP-1]
 dbj|BAC09063.1| magnesium-chelatase subunit [Thermosynechococcus elongatus BP-1]
Length=367

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+D  LRV+ VE R++FD+NP+ F   
Sbjct  197  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPTLRVEIVEQRSQFDQNPEAFLAK  256

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+A+QE LQ ++  A+  L  VTIDH+ RVKI +VCAEL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  257  YQAQQEALQAKLVAAQALLPKVTIDHELRVKISQVCAELDVDGLRGDIVTNRAAKALAAF  316

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDIA VI  CLR RLRKDPLESIDSG  V + F EVF 
Sbjct  317  EGRTEVTVEDIARVIVLCLRHRLRKDPLESIDSGYKVGKVFQEVFG  362



>ref|WP_041429536.1| magnesium chelatase [Thermosynechococcus sp. NK55a]
Length=353

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+D  LRV+ VE R++FD+NP+ F   
Sbjct  183  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPSLRVEIVEQRSQFDQNPEAFLAK  242

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+A+QE LQ ++  A+  L  VTIDH+ RVKI +VCAEL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  243  YQAQQEALQAKLVAAQALLPKVTIDHELRVKISQVCAELDVDGLRGDIVTNRAAKALAAF  302

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR +VT EDIA VI  CLR RLRKDPLESIDSG  V + F EVF 
Sbjct  303  EGRTDVTVEDIARVIVLCLRHRLRKDPLESIDSGYKVGKVFQEVFG  348



>ref|YP_009105376.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella longiseta]
 gb|AIT93969.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella longiseta]
Length=352

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+D  LRVK VE RA FD  P EFR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDPNLRVKIVEQRASFDEAPLEFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  ++  AR++L  V ID+DFR+KI ++C+ELNVDGLRGDIVTNRA++A+A+ 
Sbjct  245  YNDSQKELTDKLTEARHNLKKVEIDYDFRIKISQICSELNVDGLRGDIVTNRASKAIAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + RNEVT +DI  VIP CLR RLRKDPLESIDSG  V + F +VF
Sbjct  305  ENRNEVTPQDIFRVIPLCLRHRLRKDPLESIDSGDKVRDTFKKVF  349



>ref|WP_028949018.1| magnesium chelatase [Synechocystis sp. PCC 6714]
 gb|AIE73447.1| Protoporphyrin IX Mg-chelatase subunit I [Synechocystis sp. PCC 
6714]
Length=357

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TVR+ ELRVK VE R  FD+NP+ F + 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPELRVKIVEQRTEFDQNPQPFCDH  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQE LQ +I  A+N L  VT+D+D+RVK+ +VCAEL+VDGLRGDIVTNRAA+A+A+ 
Sbjct  247  YQTEQEALQAKIVNAQNLLPQVTLDYDYRVKVSEVCAELDVDGLRGDIVTNRAAKAIAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI+ VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDISRVIVLCLRHRLRKDPLESIDSGSKVEKVFKRVFG  352



>gb|AHB88165.1| Mg-protoporphyrin IX chelatase ATPase subunit ChlI [Thermosynechococcus 
sp. NK55a]
Length=367

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+D  LRV+ VE R++FD+NP+ F   
Sbjct  197  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPSLRVEIVEQRSQFDQNPEAFLAK  256

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+A+QE LQ ++  A+  L  VTIDH+ RVKI +VCAEL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  257  YQAQQEALQAKLVAAQALLPKVTIDHELRVKISQVCAELDVDGLRGDIVTNRAAKALAAF  316

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR +VT EDIA VI  CLR RLRKDPLESIDSG  V + F EVF 
Sbjct  317  EGRTDVTVEDIARVIVLCLRHRLRKDPLESIDSGYKVGKVFQEVFG  362



>ref|YP_009106472.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Geminella minor]
 gb|AIT95234.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Geminella minor]
Length=352

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++A LRVK VE RA FD +P  FR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEANLRVKIVEQRASFDESPLSFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L+ +I  AR+ L +V +++D+R+KI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  245  YDESQNELRERIITARHILKNVNLEYDYRIKISQICSELNVDGLRGDIVTNRASKALAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI  VIP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  EGRTEVTPQDIFRVIPLCLRHRLRKDPLESIDSGDKVRETFKKVF  349



>gb|AIT94561.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Chlorosarcina brevispinosa]
Length=352

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRV+ VE RA FD +P EFR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPNLRVQIVEQRASFDESPLEFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q++L  +I  AR  L +V+ID+DFR+KI ++C+ELNVDGLRGDIVTNRA++AL + 
Sbjct  245  YEESQQELTKKIVEARERLKNVSIDYDFRIKISQICSELNVDGLRGDIVTNRASKALTAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT ED+  VIP CLR RLRKDPLESIDSG  V E F +++
Sbjct  305  EGRLEVTPEDVFRVIPLCLRHRLRKDPLESIDSGDKVREAFKKIW  349



>ref|YP_009105743.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Neocystis brevis]
 gb|AIT94389.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Neocystis brevis]
Length=352

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++ +LRVK VE RA FD +P EFR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEQRASFDESPLEFRQN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  ++  AR  L +V ID+DFR+KI ++C+EL+VDGLRGDIV+NRA++A+A+ 
Sbjct  245  YLESQQQLTKKLTEAREKLKTVQIDYDFRIKISQICSELDVDGLRGDIVSNRASKAIAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR+EVT +DI  VIP CLR RLRKDPLESIDSG  V E F  +F 
Sbjct  305  EGRSEVTPQDIFRVIPLCLRHRLRKDPLESIDSGDKVRETFKRIFG  350



>ref|YP_009105483.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Ettlia pseudoalveolaris]
 gb|AIT94110.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Ettlia pseudoalveolaris]
Length=353

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++ +LRVK VE RA FD +P +FR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEQRASFDESPLDFRKN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q++L  +++ AR  L +V ID+D+RVKI ++C+ELNVDGLRGDIVTNRA++A+A+ 
Sbjct  245  YQDSQDELTNKLSQARLLLKTVEIDYDYRVKISQICSELNVDGLRGDIVTNRASKAIAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR +VT +DI  VIP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  305  EGRTKVTPQDIFRVIPLCLRHRLRKDPLESIDSGDKVRETFKKVF  349



>emb|CEO91133.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Tydemania expeditionis]
Length=373

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            P+RFILIGSGNPEEGELRPQLLDRFG+HAQ+GTV+D +LRVK VE RA FD +P  FR+ 
Sbjct  207  PSRFILIGSGNPEEGELRPQLLDRFGLHAQIGTVQDPQLRVKIVEQRAAFDESPIGFRQK  266

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ +Q+KL   + LAR +L +V I  +FRV+I +VCA LN+DGLRGDIVTNRAA+ALA  
Sbjct  267  YQIQQQKLTNLLILARQNLKTVQISSEFRVQISQVCATLNIDGLRGDIVTNRAAKALACF  326

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR +VT  DI  VIP CLR RLRKDPLE+IDSG  V E F ++FN
Sbjct  327  EGRQQVTTADIFRVIPLCLRHRLRKDPLETIDSGEKVCETFQKIFN  372



>ref|YP_009105311.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pedinomonas tuberculata]
 gb|AIT93885.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pedinomonas tuberculata]
Length=349

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GT ++ ELRVK VE RA FD +P +FR+ 
Sbjct  182  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTTKEPELRVKIVEQRASFDESPADFRKN  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L+ +I  AR  L SV +D+D RVKI ++C+ELNVDGLRGDIVTNRAA+ALA  
Sbjct  242  YDQSQNELRQRIIDAREKLKSVELDYDLRVKISQICSELNVDGLRGDIVTNRAAKALAGF  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GRN+VT ED+  + P CLR RLRKDPLESIDSG  V + F +VF
Sbjct  302  EGRNQVTVEDVYRIAPLCLRHRLRKDPLESIDSGDKVRDVFKKVF  346



>ref|YP_009106625.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dicloster acuatus]
 gb|AIT95395.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dicloster acuatus]
Length=356

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+D  LRV+ VE RA FD  P EFRE 
Sbjct  187  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDPNLRVQIVEQRANFDAAPLEFRET  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L  QI  AR  +  V ID+D+RVKI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  247  YNDSQNQLANQIIQARQLVPKVEIDYDYRVKISQICSELNVDGLRGDIVTNRASKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +G  +VT EDI  VIP CLR RLRKDPLESIDSG  V + F  VF
Sbjct  307  EGHTQVTVEDIYRVIPLCLRHRLRKDPLESIDSGDKVRDVFKRVF  351



>ref|YP_635908.1| Mg-protoporyphyrin IX chelatase [Oltmannsiellopsis viridis]
 ref|YP_635854.1| Mg-protoporyphyrin IX chelatase [Oltmannsiellopsis viridis]
 gb|ABB81976.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Oltmannsiellopsis viridis]
 gb|ABB82015.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Oltmannsiellopsis viridis]
Length=357

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++ +LRVK VE RA FD  P  FR  
Sbjct  192  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEQRALFDEEPVSFRNN  251

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q+ L  +I  ARN L  V +D+D+RVKI ++C+ELNVDGLRGDIVTNRAA A+ + 
Sbjct  252  YDQSQQALTDKIVAARNLLKDVQLDYDYRVKISQICSELNVDGLRGDIVTNRAALAICAF  311

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VIP CLR RLRKDPLESIDSG  V + F EVF+
Sbjct  312  EGRTEVTPQDIYRVIPLCLRHRLRKDPLESIDSGDKVRDIFKEVFS  357



>ref|YP_009057794.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Picocystis salinarum]
 gb|AID67586.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Picocystis salinarum]
Length=349

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++ +LRVK VE R+ FD NP EFR  
Sbjct  182  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEQRSEFDANPNEFRAG  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q++L  +I  AR  L  V I +++RV+I ++C+ELNVDGLRGDIVTNRAA+A+A+ 
Sbjct  242  YQIAQDELTTKIIEARKLLSKVQISYEYRVQISQICSELNVDGLRGDIVTNRAAKAIAAF  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVTAEDI+ +I  CLR RLRKDPLE+IDSG  V + F ++F
Sbjct  302  EGRVEVTAEDISRIITLCLRHRLRKDPLETIDSGTKVQDTFRDIF  346



>ref|YP_004222055.1| photochlorophyllide reductase subunit L [Coccomyxa subellipsoidea 
C-169]
 gb|ADV29903.1| photochlorophyllide reductase subunit L [Coccomyxa subellipsoidea 
C-169]
Length=365

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DAELRVK VE RA FD +P  FR  
Sbjct  199  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDAELRVKIVEQRASFDESPIGFRNH  258

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  +I  AR  L  V+ID+D RVKI ++C+EL+VDGLRGDIVTNRA++ALA+ 
Sbjct  259  YLGSQQELTDRIVAARALLEKVSIDYDSRVKISQICSELDVDGLRGDIVTNRASQALAAF  318

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR + T +DI  +IP CLR RLRKDPLESIDSG  V E F +VF
Sbjct  319  EGRTQATPQDIFRIIPLCLRHRLRKDPLESIDSGDKVREAFKKVF  363



>ref|YP_009105582.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Xylochloris irregularis]
 gb|AIT94293.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Xylochloris irregularis]
Length=355

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DA LRV+ VE R+ FD++P EFR+ 
Sbjct  189  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDANLRVQIVEQRSHFDQSPFEFRKN  248

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   QEKL  +I  AR  L  V +D+++R+KI ++C++L+VDGLRGDIVTNRA++ALA+ 
Sbjct  249  YTESQEKLTEKITQARAILKEVNLDYNYRIKISQICSDLDVDGLRGDIVTNRASKALAAF  308

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R EVT EDI  VIP CLR RLRKDPLE+IDSG  V E F +VF
Sbjct  309  ENRREVTPEDIYRVIPLCLRHRLRKDPLETIDSGDKVKEAFRKVF  353



>ref|YP_009105570.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Lobosphaera incisa]
 gb|AIT94215.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Lobosphaera incisa]
Length=353

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++AELRVK VE RA FD +P +FR  
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEAELRVKIVEQRASFDESPVDFRNN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  ++  AR+ L  V ID++ R+KI ++C+ELNVDGLRGDIVTNRA++A+A+L
Sbjct  245  YSESQQELTKKLIAARSLLKQVEIDYESRIKISQICSELNVDGLRGDIVTNRASKAIAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R  VTAEDI  VIP CLR RLRKDPLESIDSG  V E F ++F
Sbjct  305  ENRTTVTAEDIFRVIPLCLRHRLRKDPLESIDSGDKVREVFKKIF  349



>gb|KIE08482.1| magnesium chelatase [Tolypothrix bouteillei VB521301]
Length=371

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE RA FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRAEFDQNPPAFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK++QE+LQ +I  A+  L SVTID+D RVKI +VC+EL+VDGLRGDIVTNRAA+A+ + 
Sbjct  247  YKSQQEELQQKIVNAQQLLPSVTIDYDLRVKISEVCSELDVDGLRGDIVTNRAAKAITAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GRNEVT +DI  +I  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRNEVTVDDIRRIITLCLRHRLRKDPLESIDSGYKVEKAFGRVFG  352



>ref|YP_004347806.1| photochlorophyllide reductase subunit L [Chlorella variabilis]
 gb|ADZ05054.1| photochlorophyllide reductase subunit L [Chlorella variabilis]
 gb|AIH00140.1| protochlorophyllide reductase magnesium chelatase subunit (chloroplast) 
[Chlorella variabilis]
 gb|AJP09470.1| protochlorophyllide reductase magnesium chelatase subunit (chloroplast) 
[Chlorella variabilis]
Length=354

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRV+ VE RA FD  P EFR+ 
Sbjct  187  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPNLRVQIVEQRASFDAAPLEFRQT  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q +L  QI  ARN L ++ +D+D+RVKI ++C+EL+VDGLRGD+VTNRA++++A+ 
Sbjct  247  YQESQTQLGNQIIAARNLLPTIQLDYDYRVKISQICSELDVDGLRGDLVTNRASKSIAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDI  VIP CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTPEDIFRVIPLCLRHRLRKDPLESIDSGDKVRDVFKRVFG  352



>ref|WP_045053191.1| magnesium chelatase [Chroococcales cyanobacterium CENA595]
 gb|KJH73095.1| magnesium chelatase [Chroococcales cyanobacterium CENA595]
Length=368

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R  FD+NP EF E 
Sbjct  183  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPALRVQIVEQRTEFDQNPPEFVEH  242

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +++EQ  LQ QI  A+N L SVTID+D RVKI +VC+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  243  HQSEQAALQQQIVNAQNLLPSVTIDYDLRVKISQVCSELDVDGLRGDIVTNRAAKALTAF  302

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  V+  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  303  EGRTEVTVDDIRRVMTLCLRHRLRKDPLESIDSGYKVEKSFNRVFG  348



>ref|NP_045914.1| Mg-protoporyphyrin IX chelatase [Chlorella vulgaris]
 sp|P56304.1|CHLI_CHLVU RecName: Full=Magnesium-chelatase subunit ChlI; Short=Mg-chelatase 
subunit I-1; AltName: Full=Mg-protoporphyrin IX chelatase 
subunit ChlI (chloroplast) [Chlorella vulgaris]
 dbj|BAA57990.1| Mg-protoporhyrin IX [Chlorella vulgaris]
Length=354

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRV+ VE RA FD  P EFRE 
Sbjct  187  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPNLRVQIVEQRANFDAAPLEFRET  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q +L  QI  ARN L  + +++D+RVKI ++C+EL+VDGLRGD+VTNRA++A+AS 
Sbjct  247  YQDSQAQLGNQILEARNLLPQIQLEYDYRVKISQICSELDVDGLRGDLVTNRASKAIASF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDI  VIP CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTPEDIFRVIPLCLRHRLRKDPLESIDSGDKVRDIFKRVFG  352



>ref|YP_009020880.1| magnesium-chelatase 38 kDa subunit (chloroplast) [Chlorella sorokiniana]
 gb|AHM23754.1| magnesium-chelatase 38 kDa subunit (chloroplast) [Chlorella sorokiniana]
 gb|AII02048.1| protochlorophyllide reductase magnesium chelatase subunit (chloroplast) 
[Chlorella sorokiniana]
Length=354

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+D  LRV+ VE RA FD  P EFR+ 
Sbjct  187  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDPNLRVQIVEQRASFDAAPLEFRQT  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q +L  QI  AR  L  V +D+D+RVKI ++C+EL+VDGLRGD+VTNRA++A+A+ 
Sbjct  247  YQESQTQLANQIIEARKLLSKVQLDYDYRVKISQICSELDVDGLRGDLVTNRASKAIAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDI  VIP CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRAEVTPEDIFRVIPLCLRHRLRKDPLESIDSGDKVRDIFKRVFG  352



>gb|AGZ19336.1| magnesium-chelatase subunit chlI (chloroplast) (chloroplast) 
[Chlorella sp. ArM0029B]
Length=354

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+D  LRV+ VE RA FD  P EFR+ 
Sbjct  187  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDPNLRVQIVEQRASFDAAPLEFRQT  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L  QI  AR  L  V +D+D+RVKI ++C+EL+VDGLRGD+VTNRA++A+A+ 
Sbjct  247  YLDSQTQLGTQIVEARTILSKVQLDYDYRVKISQICSELDVDGLRGDLVTNRASKAIAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDI  VIP CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTPEDIFRVIPLCLRHRLRKDPLESIDSGDKVRDIFKRVFG  352



>ref|YP_009057493.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinoderma coloniale]
 gb|AID67510.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinoderma coloniale]
Length=352

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQ+GTV++ +LRVK VE RA+FD NP EFR  
Sbjct  184  PARFILIGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEERAQFDTNPGEFRGL  243

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q +L+ ++  A+  L  +T+  ++R KI +VC+EL+VDGLRGDIVTNRAARALA+ 
Sbjct  244  YEGSQSELRKRVTDAQALLKDITLSEEYRTKISQVCSELDVDGLRGDIVTNRAARALAAF  303

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN*G  224
             G  EVT + IA ++  CLR RLRKDPLESIDSG  V E F  VFN G
Sbjct  304  DGATEVTTKHIAAIVTLCLRHRLRKDPLESIDSGTKVQEVFDAVFNMG  351



>ref|YP_005089911.1| chlI gene product (chloroplast) [Pedinomonas minor]
 gb|ACQ90834.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Pedinomonas minor]
Length=368

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GT +D ELRVK VE RA FD +P +FR+ 
Sbjct  201  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTTKDPELRVKIVEQRASFDESPADFRKN  260

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L+ +I  AR  L +V++++D RVKI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  261  YDDSQNELRQRIVDARERLKTVSLEYDLRVKISQICSELNVDGLRGDIVTNRASKALAAF  320

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT ED+  + P CLR RLRKDPLESIDSG  V + F +VF
Sbjct  321  EGRTEVTIEDVYRIAPLCLRHRLRKDPLESIDSGDKVRDVFKKVF  365



>gb|AAC44138.1| Mg-Protoporhyrin IX [Synechocystis sp. PCC 6803]
Length=357

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TVR+ ELRVK VE R  FD+NP  F + 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPELRVKIVEQRTEFDQNPHPFCDQ  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQE LQ +I  A+N L  VTID+D+RVK+ +VCAEL+VDGLRGDIVTNRAA+    L
Sbjct  247  YQTEQEALQAKIVNAQNLLPQVTIDYDYRVKVSEVCAELDVDGLRGDIVTNRAAKPWPLL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI+ VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDISRVIVLCLRHRLRKDPLESIDSGSKVEKVFKRVFG  352



>gb|AIY30226.1| photochlorophyllide reductase subunit I (chloroplast) [Lobosphaera 
incisa]
Length=353

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++AELRVK VE RA FD +P +FR  
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEAELRVKIVEQRASFDESPVDFRNN  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  ++  AR+ L  V ID++ R+KI ++C+ELNVDGLRGDIVTNRA++A+A+L
Sbjct  245  YSESQQELTKKLIAARSLLKQVEIDYESRIKISQICSELNVDGLRGDIVTNRASKAIAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R  VT EDI  VIP CLR RLRKDPLESIDSG  V E F ++F
Sbjct  305  ENRTTVTPEDIFRVIPLCLRHRLRKDPLESIDSGDKVREVFKKIF  349



>ref|WP_002760148.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCH97553.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9717]
Length=357

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_002797227.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCI25061.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9809]
Length=357

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_002803387.1| magnesium chelatase [Microcystis aeruginosa]
 dbj|BAG04710.1| magnesium protoporphyrin IX chelatase subunit I [Microcystis 
aeruginosa NIES-843]
 emb|CCI37732.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9701]
Length=357

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|YP_009106080.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Choricystis parasitica]
 gb|AIT94827.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Choricystis parasitica]
Length=354

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRV+ VE R++FD +P EFR  
Sbjct  186  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPNLRVQIVEQRSQFDESPAEFRST  245

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L  QI+ AR  L  VTI++D RVKI ++C+EL+VDGLRGDIVTNRA+ AL + 
Sbjct  246  YLVSQQELTNQISAARARLKDVTINYDLRVKISQICSELDVDGLRGDIVTNRASIALTAF  305

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI  +IP CLR RLRKDPL +IDSG  V+E F  VF
Sbjct  306  EGRTEVTEQDIFRIIPLCLRHRLRKDPLATIDSGDRVLEVFKRVF  350



>ref|WP_012598055.1| magnesium chelatase [Cyanothece sp. PCC 7424]
 gb|ACK69108.1| magnesium chelatase ATPase subunit I [Cyanothece sp. PCC 7424]
Length=357

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD++P +F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDQDPLKFCEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ+ LQ Q+  A+N L  V ID+D RVKI +VC+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  247  YQAEQDNLQQQLVNAQNLLPQVNIDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDIKRVITLCLRHRLRKDPLESIDSGYKVQKAFGRVFG  352



>ref|WP_002778711.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCI08811.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
7941]
 dbj|GAL94057.1| protoporphyrin IX Mg-chelatase subunit I [Microcystis aeruginosa 
NIES-44]
Length=357

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPISFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_008200597.1| magnesium chelatase [Microcystis sp. T1-4]
 emb|CCI32041.1| Magnesium-chelatase subunit ChlI [Microcystis sp. T1-4]
Length=357

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>gb|AEQ94253.1| chlorophyll biosynthesis (chloroplast) [Eutreptia viridis]
Length=350

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+ TV++ ELRVK VE RA F++NPKEFR  
Sbjct  183  PARFILVGSGNPEEGELRPQLLDRFGMHAQIRTVKNPELRVKIVEQRALFEQNPKEFRTS  242

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   QE+L  +I  A+  + ++ I HD ++KI ++C+ELNVDGLRGD+VTNRAA+A  + 
Sbjct  243  YMQSQEELANKIIEAQKKINNIEISHDDQIKISQICSELNVDGLRGDMVTNRAAKAFVAF  302

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR+++T +DI TVI  CLR RLRKDPLESIDSG  V EKF ++F
Sbjct  303  EGRDKITPQDIFTVITLCLRHRLRKDPLESIDSGFQVQEKFKKIF  347



>ref|WP_008189063.1| magnesium chelatase [Moorea producens]
 gb|EGJ29694.1| protoporphyrin IX magnesium-chelatase [Moorea producens 3L]
Length=355

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE R  FD+NP ++ E 
Sbjct  183  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPVLRVKIVEERGYFDQNPHKYIEQ  242

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +++EQE LQ QI +A+  L  V +D+DFRVKI +VC+EL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  243  HQSEQEVLQKQIVMAQERLAEVEMDYDFRVKISEVCSELDVDGLRGDIVTNRAAKALAAF  302

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  303  EGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVQKSFNRVFG  348



>ref|WP_045872636.1| magnesium chelatase [Tolypothrix sp. PCC 7601]
Length=374

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNPPGFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y++EQE LQ +I  A+N L  VT D+D RVKI ++C+EL+VDGLRGDIVTNRAA+AL +L
Sbjct  247  YQSEQEALQQKIVNAQNLLPQVTSDYDLRVKISEICSELDVDGLRGDIVTNRAAKALTAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVFG  352



>ref|WP_015218333.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium aponinum]
 gb|AFZ52602.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium aponinum 
PCC 10605]
Length=357

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++ +LRV+ VE RA FDRNP+EF   
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPDLRVQIVEQRAEFDRNPQEFMAK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK +QE+LQ ++  A+N L  VTID+D RVKI ++C+EL+VDGLRGDIVTNRAA+A+A+ 
Sbjct  247  YKEKQEELQRKLVDAQNLLPQVTIDYDIRVKISEICSELDVDGLRGDIVTNRAAKAIAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R EVT +DI  V+P CLR RLRKDPLE+IDSG  V +    VF
Sbjct  307  ESRTEVTVDDIRRVMPLCLRHRLRKDPLETIDSGYKVEKSINRVF  351



>gb|EKE99302.1| magnesium chelatase ATPase subunit I [Tolypothrix sp. PCC 7601]
Length=361

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  174  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNPPGFLEK  233

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y++EQE LQ +I  A+N L  VT D+D RVKI ++C+EL+VDGLRGDIVTNRAA+AL +L
Sbjct  234  YQSEQEALQQKIVNAQNLLPQVTSDYDLRVKISEICSELDVDGLRGDIVTNRAAKALTAL  293

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  294  EGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVFG  339



>ref|WP_009784802.1| magnesium chelatase [Lyngbya sp. PCC 8106]
 gb|EAW36589.1| protoporphyrin IX magnesium chelatase chain [Lyngbya sp. PCC 
8106]
Length=367

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE R  FD  PKEF   
Sbjct  194  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPNLRVKIVEQRTAFDGAPKEFLAQ  253

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y ++QEKLQ  I  A+  L SV I +DFRV I +VC+EL+VDGLRGDIVTNRAA+AL SL
Sbjct  254  YLSDQEKLQQTIIEAQQRLSSVEISYDFRVNISQVCSELDVDGLRGDIVTNRAAKALTSL  313

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDI  VI  CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  314  EGRTEVTVEDIGRVITLCLRHRLRKDPLESIDSGYKVQKVFRQVFG  359



>ref|WP_016873528.1| magnesium chelatase [Chlorogloeopsis fritschii]
Length=373

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+   LRV+ VE RA FD+NP+EF E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKAPALRVQIVEQRAEFDQNPQEFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK++QE+LQ +I  A+  L SV ID+D RVKI +VC+EL+VDGLRGDIV+NRAA+AL + 
Sbjct  247  YKSQQEELQQRIIKAQELLPSVNIDYDLRVKISEVCSELDVDGLRGDIVSNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVFG  352



>ref|YP_009057860.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Nephroselmis astigmatica]
 gb|AID67666.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Nephroselmis astigmatica]
Length=353

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++ +LRVK VE RA FD  P EFR+ 
Sbjct  185  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPDLRVKIVEQRAAFDEAPNEFRQS  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q  L  Q+  AR  L SV ID+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  245  YLESQTNLTDQLTEARERLASVEIDYDLRVKISQVCSELDVDGLRGDIVTNRAAKALAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            + R +VT EDI  +I  CLR RLRKDPLESIDSG  V E F   F 
Sbjct  305  ENRTQVTPEDIFRIITLCLRHRLRKDPLESIDSGDKVQEVFSRAFG  350



>ref|YP_009106843.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Marvania geminata]
 gb|AIT95648.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Marvania geminata]
Length=355

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRV+ VE RA FD  P EFR+ 
Sbjct  187  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPNLRVQIVEQRADFDAAPVEFRKS  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q+ L  QI  AR  L  V ID+DFRVKI ++C+EL+VDGLRGD+VTNRA++ALA+ 
Sbjct  247  YQDSQDLLSTQIIAARKLLPEVQIDYDFRVKISQICSELDVDGLRGDLVTNRASKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +G   VT EDI  +IP CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGHTTVTPEDIYRIIPLCLRHRLRKDPLESIDSGDKVRDIFKRVFG  352



>emb|CDI27958.1| magnesium-chelatase subunit chlI (chloroplast) [Acetabularia 
acetabulum]
Length=368

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRVK VE RA FD  P EFR+ 
Sbjct  201  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPSLRVKIVEQRAIFDEKPLEFRKN  260

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q+KL   I  AR  L SV++D++ RVKI ++C++LNVDGLRGDIVTNRAA+ALA+ 
Sbjct  261  YEESQQKLAQTIIQARQLLKSVSMDYEHRVKISQICSQLNVDGLRGDIVTNRAAKALAAF  320

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R+ VT +DI  VIP CLR RLRKDPLESIDSG  V + F ++F
Sbjct  321  EQRSSVTPQDIFRVIPLCLRHRLRKDPLESIDSGEKVKDIFKKIF  365



>ref|YP_009106822.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Elliptochloris bilobata]
 gb|AIT95566.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Elliptochloris bilobata]
Length=362

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV+DA  RV  V+ RA FD++P EFRE 
Sbjct  189  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKDASSRVHIVQQRASFDQSPFEFRET  248

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q++L+ +I  AR+ L +V ID++ RVKI ++C+ELNVDGLRGDIVTNRA++A+A+ 
Sbjct  249  YADSQQELRGKILAARDCLPTVEIDYESRVKISQICSELNVDGLRGDIVTNRASQAIAAF  308

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            + R  VT  DI  VIP CLR RLRKDPLE IDSG  V E F  VFN
Sbjct  309  ENRTRVTPHDIFRVIPLCLRHRLRKDPLEGIDSGEKVRETFQRVFN  354



>ref|WP_041032790.1| magnesium chelatase [Tolypothrix campylonemoides]
 gb|KIJ78619.1| magnesium chelatase [Tolypothrix campylonemoides VB511288]
Length=373

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R++FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSQFDQNPPAFLEN  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQ+ LQ +I  A+  L SVTID+D RVKI +VC+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  247  YKQEQKALQQKIVNAQKLLPSVTIDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTLDDIRRVITLCLRHRLRKDPLESIDSGYKVEKVFSRVFG  352



>ref|WP_015141479.1| magnesium chelatase ATPase subunit I [Nostoc sp. PCC 7524]
 gb|AFY51078.1| magnesium chelatase ATPase subunit I [Nostoc sp. PCC 7524]
Length=374

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNPPSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQE LQ +I  A+N L  V +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  247  YKTEQEGLQQKIVNAQNLLPEVKLDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVFG  352



>ref|WP_017314355.1| magnesium chelatase [Mastigocladopsis repens]
Length=373

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R  FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPGLRVQIVEQRGEFDQNPPRFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQE+LQ  I  A+  L SVTID+D RVKI +VC+EL+VDGLRGDIV+NRAA+ALA+ 
Sbjct  247  YKQEQEELQQNIVNAQKLLPSVTIDYDLRVKISEVCSELDVDGLRGDIVSNRAAKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  V+  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDIRRVMTLCLRHRLRKDPLESIDSGYKVEKVFSRVFG  352



>ref|WP_002791921.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCI21115.1| Magnesium-chelatase 38 kDa subunit (Mg-protoporphyrin IX chelatase) 
[Microcystis aeruginosa PCC 9808]
Length=357

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYELRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_017745273.1| magnesium chelatase [Scytonema hofmanni]
Length=371

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE RA FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRAEFDQNPPAFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK++QE+LQ +I  A+  L +VTID+D RVKI +VC+EL+VDGLRGDIVTNRAA+A+ + 
Sbjct  247  YKSQQEELQQKIVNAQQLLPTVTIDYDLRVKISEVCSELDVDGLRGDIVTNRAAKAITAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            + RNEVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  ERRNEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFGRVFG  352



>ref|WP_002738384.1| magnesium chelatase ATPase subunit I [Microcystis aeruginosa]
 gb|ELP52559.1| magnesium chelatase ATPase subunit I [Microcystis aeruginosa 
TAIHU98]
Length=357

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYELRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_002770087.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCI03809.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9443]
 emb|CCI18757.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9807]
Length=357

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYELRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|YP_009104833.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dictyochloropsis reticulata]
 gb|AIT93313.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dictyochloropsis reticulata]
Length=449

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTVR+A+LRVK VE RA FD++P EF + 
Sbjct  280  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVREAKLRVKIVEERASFDQSPVEFLKI  339

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +  EQ++L  QI  AR+ L +V ID+D RVKI +VC +LNVDGLRGDIVTNRA++ALA+ 
Sbjct  340  HAEEQKQLADQIVSARHLLGAVKIDYDLRVKISQVCGQLNVDGLRGDIVTNRASQALAAF  399

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R  VT EDI  VIP  LR RLRKDPLE IDSG  V E F +VF
Sbjct  400  EARTSVTPEDIFRVIPLSLRHRLRKDPLEPIDSGDKVRETFKQVF  444



>ref|WP_015226200.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
 gb|AFZ44325.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
Length=364

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGM+ +V TVRD ELRVK VE R+ FD+NP+EF + 
Sbjct  191  PARFVLVGSGNPEEGELRPQLLDRFGMNVEVRTVRDPELRVKIVEQRSEFDQNPQEFTQH  250

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ +Q  LQ +I  A+  L  V +++D RVK+ +VC EL+VDGLRGDIVTNRAA+AL +L
Sbjct  251  YQEQQTDLQQKIVQAQELLPQVQMEYDLRVKVSQVCGELDVDGLRGDIVTNRAAKALTAL  310

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDI  V+P CLR RLRKDPLESIDSG  V +   +VF 
Sbjct  311  EGRTEVTVEDIRRVMPFCLRHRLRKDPLESIDSGYKVEKAIAQVFG  356



>ref|WP_016516601.1| magnesium chelatase [Microcystis aeruginosa]
 gb|EPF19477.1| Magnesium-chelatase 38 kDa subunit [Microcystis aeruginosa SPC777]
Length=357

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPISFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYELRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_002780926.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCI14883.1| Magnesium-chelatase 38 kDa subunit (Mg-protoporphyrin IX chelatase) 
[Microcystis aeruginosa PCC 9806]
Length=357

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYELRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>gb|AID67829.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinophyceae sp. MBIC10622]
Length=350

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQ+GTVR+ +LRVK VE R +FD++P  FR  
Sbjct  183  PARFILIGSGNPEEGELRPQLLDRFGMHAQIGTVREPDLRVKVVEQRVQFDKDPNSFRSE  242

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q++L+ +I  AR+ L  V I  + RV+I +VC+ELNVDGLRGDIVTNRAA+ALA+ 
Sbjct  243  YEGAQQELRQKIESARDLLSKVEISEENRVRISQVCSELNVDGLRGDIVTNRAAKALAAF  302

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +G  EVT + IA VI  CLR RLRKDPLESIDSG  V E F  VFN
Sbjct  303  EGSTEVTIKHIAGVIVFCLRHRLRKDPLESIDSGSRVKEVFNTVFN  348



>ref|WP_002747283.1| magnesium chelatase ATPase subunit I [Microcystis aeruginosa]
 emb|CAO88902.1| chlI [Microcystis aeruginosa PCC 7806]
 gb|ELS45966.1| magnesium chelatase ATPase subunit I [Microcystis aeruginosa 
DIANCHI905]
Length=357

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPISFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYELRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_002754885.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCH93228.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9432]
Length=357

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE RA FD NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNPLSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  EQE+LQ ++  A+N L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  247  YNLEQEELQRKLVEAQNLLPSVELDYELRVKISEVCSELDVDGLRGDIVTNRAAKALAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT +DI  VI  CLR RLRKDPLESIDSG  V++ F  VF
Sbjct  307  EGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVF  351



>ref|WP_039729931.1| MULTISPECIES: magnesium chelatase [Oscillatoriophycideae]
 gb|KIF16848.1| magnesium chelatase [Aphanocapsa montana BDHKU210001]
 gb|KIF40090.1| magnesium chelatase [Lyngbya confervoides BDU141951]
Length=365

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+F+L+GSGNPEEGELRPQLLDRFGMHA++ TVRD ELRV+ VE R+ FD++P+ + E 
Sbjct  181  PAQFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVRDPELRVQIVEQRSDFDQDPQSYLEK  240

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +   Q  LQ +I  A+  L  VTI+HDFR+KI +VC+EL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  241  FAEPQTALQKRITDAQARLAEVTIEHDFRIKISQVCSELDVDGLRGDIVTNRAAKALAAY  300

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI TVI  CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  301  EGRTEVTLDDIRTVIVMCLRHRLRKDPLESIDSGYKVEKVFSQVFG  346



>gb|AID67423.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinococcus sp. CCMP1194]
Length=359

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHA++GTV++ ELRVK VE RA FD +P+ F+E 
Sbjct  192  PARFILVGSGNPEEGELRPQLLDRFGMHAKIGTVKEPELRVKIVEQRAEFDSDPQAFKEM  251

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +K  Q+ L  ++   R +L +V+ID+D ++KI ++C+EL+VDGLRGDIVTNRAA AL + 
Sbjct  252  FKDVQQSLTDKLDYGRTNLKNVSIDNDLKIKISQICSELDVDGLRGDIVTNRAALALTAF  311

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
              R+EVT +DI TVI  CLR RLRKDPLESIDSG  V E F +VF
Sbjct  312  DKRDEVTPKDIYTVISLCLRHRLRKDPLESIDSGYKVQETFRQVF  356



>ref|WP_007353825.1| MULTISPECIES: magnesium chelatase [Kamptonema]
 emb|CBN54600.1| protoporphyrin IX magnesium-chelatase [ [[Oscillatoria] sp. PCC 
6506]
Length=380

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NPKEF E 
Sbjct  209  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPTLRVQIVEQRSDFDQNPKEFLEK  268

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q +LQ Q+  A+  L SV +D+D RVKI +VCAEL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  269  YEPGQNELQKQLVDAQERLKSVQLDYDLRVKISQVCAELDVDGLRGDIVTNRAAKALAAC  328

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  V+  CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  329  EGRTEVTVDDIRRVVTLCLRHRLRKDPLESIDSGYKVQKVFGQVFG  374



>ref|WP_041780332.1| magnesium chelatase [Microcoleus sp. PCC 7113]
Length=364

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE RA FD NP+ F E 
Sbjct  182  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPALRVEIVEQRAAFDLNPQAFMEQ  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            ++ EQE +Q ++  A+  L  V +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  242  HQPEQEAMQQKLVAAQQLLPQVELDYDLRVKISQVCSELDVDGLRGDIVTNRAAKALAAL  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GRNEVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  302  EGRNEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFSRVFG  347



>gb|AFZ16214.1| protoporphyrin IX magnesium-chelatase [Microcoleus sp. PCC 7113]
Length=381

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE RA FD NP+ F E 
Sbjct  199  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPALRVEIVEQRAAFDLNPQAFMEQ  258

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            ++ EQE +Q ++  A+  L  V +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+L
Sbjct  259  HQPEQEAMQQKLVAAQQLLPQVELDYDLRVKISQVCSELDVDGLRGDIVTNRAAKALAAL  318

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GRNEVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF
Sbjct  319  EGRNEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFSRVF  363



>ref|WP_008274324.1| magnesium chelatase [Cyanothece sp. CCY0110]
 gb|EAZ92406.1| Mg chelatase subunit; ChlI [Cyanothece sp. CCY0110]
Length=357

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FDR+P++F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPNLRVQIVEQRSEFDRDPQKFCET  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+++QE+LQ  +  A+N L SV ID+D RVKI +VC+EL+VDGLRGDIVTNRA++ALA+ 
Sbjct  247  YQSQQEELQNSLVKAQNLLSSVNIDYDLRVKISEVCSELDVDGLRGDIVTNRASKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI   +  CLR RLRKDPLE+IDSG  V + F  VF
Sbjct  307  EGRTEVTVDDIRRTMVLCLRHRLRKDPLETIDSGYKVEKAFNRVF  351



>ref|WP_023065952.1| magnesium chelatase ATPase subunit I [Lyngbya aestuarii]
 gb|ERT07796.1| magnesium chelatase ATPase subunit I [Lyngbya aestuarii BL J]
Length=367

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R  FD  P EF   
Sbjct  194  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPNLRVQIVEQRTAFDGAPNEFLAQ  253

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y ++QEKLQ  I  A+  L SV I HDFRV I +VCAEL+VDGLRGDIVTNRAA+A+A+ 
Sbjct  254  YVSDQEKLQQTIIEAQQRLSSVEISHDFRVNISQVCAELDVDGLRGDIVTNRAAKAIAAF  313

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT EDI  VI  CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  314  EGRTEVTVEDIGRVITLCLRHRLRKDPLESIDSGYKVQKVFRQVFG  359



>ref|WP_035156108.1| magnesium chelatase [Calothrix sp. 336/3]
 gb|KFB85147.1| magnesium chelatase [Calothrix sp. 336/3]
Length=372

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  186  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVQIVEQRSEFDQNPHAFLEQ  245

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+++QE+LQ  I  A+  L SVT+D+D RVKI +VC+E++VDGLRGDIVTNRAA+A+A+ 
Sbjct  246  YQSKQEELQQTIINAQQLLPSVTLDYDLRVKISEVCSEMDVDGLRGDIVTNRAAKAIAAF  305

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  306  EGRTEVTIDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVFG  351



>ref|WP_009546697.1| MULTISPECIES: magnesium chelatase [Cyanothece]
 gb|ACB49550.1| magnesium chelatase, ATPase subunit I [Cyanothece sp. ATCC 51142]
Length=358

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FDR+P++F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPNLRVQIVEQRSEFDRDPQKFCET  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+++QE+LQ  +  A+N L SV ID+D RVKI +VC+EL+VDGLRGDIVTNRA++ALA+ 
Sbjct  247  YQSQQEELQNSLVKAQNLLPSVNIDYDLRVKISEVCSELDVDGLRGDIVTNRASKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI   +  CLR RLRKDPLE+IDSG  V + F  VF
Sbjct  307  EGRTEVTVDDIRRTMVLCLRHRLRKDPLETIDSGYKVEKAFNRVF  351



>ref|YP_007516996.1| chlorophyll biosynthesis (chloroplast) [Euglena viridis]
 gb|AEY70769.1| chlorophyll biosynthesis (chloroplast) [Euglena viridis]
Length=349

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+FIL+GSGNPEEGELRPQLLDRFGMHAQ+ TV++  LRVK V+ R  F+RNPKEF + 
Sbjct  182  PAKFILVGSGNPEEGELRPQLLDRFGMHAQIKTVKEPNLRVKIVQQRELFERNPKEFNQK  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ KL+ +I  AR  L  +TI ++   KI ++C+ELNVDGLRGD+VT+RAA+AL + 
Sbjct  242  YQDEQNKLKEKIVNARKKLKDITIQYELLEKISQICSELNVDGLRGDMVTSRAAKALVAF  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            + RNEVT +DI T+I  CLR RLRKDPLESIDSG  V E F ++FN
Sbjct  302  ENRNEVTPKDIYTIITLCLRHRLRKDPLESIDSGFKVQETFKKIFN  347



>gb|AHJ27963.1| Protoporphyrin IX Mg-chelatase subunit I [Nodularia spumigena 
CCY9414]
Length=348

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE RA FD+NP EF E 
Sbjct  161  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRAEFDQNPPEFLEK  220

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
             + EQE LQ +I  A+N L  VT+D+D RVKI ++C+EL+VDGLRGDIV+NRAA+AL + 
Sbjct  221  CQGEQEALQQKIVNAQNLLPKVTLDYDQRVKISEICSELDVDGLRGDIVSNRAAKALTAF  280

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR+EVT +DI  VI  CLR RLRKDPLESID+G  V + F  VF 
Sbjct  281  EGRSEVTVDDIKRVITLCLRHRLRKDPLESIDTGYKVQKAFARVFG  326



>ref|YP_009033617.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Klebsormidium flaccidum]
 gb|AHZ10999.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Klebsormidium flaccidum]
Length=355

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTV++ ELRV+ VE RA F+  P+ F++ 
Sbjct  185  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKEPELRVQIVEQRASFEEAPETFQQA  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            ++A QE ++ ++  AR  L SV I +D ++KI +VC+EL+VDGLRGDIVT RAA+ALA+L
Sbjct  245  WEASQESMRQKVIQARERLKSVEISYDHKIKISQVCSELDVDGLRGDIVTYRAAKALAAL  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
             GRNEVTA+DI TVIP CLR RLRKDPLE IDSG+LV EKF +VF
Sbjct  305  GGRNEVTAQDILTVIPLCLRHRLRKDPLEPIDSGLLVKEKFAKVF  349



>ref|YP_002600945.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pyramimonas parkeae]
 gb|ACJ71075.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pyramimonas parkeae]
Length=338

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 2/167 (1%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTVR+ +LRVK VE R RFD  P+ FR+ 
Sbjct  170  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVREPDLRVKIVEQRTRFDEYPQTFRDE  229

Query  547  YKAEQEKLQXQIALARNSLF--SVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALA  374
            Y+  Q  L  +I  AR  L    V++ +DF+VKI ++C+ELNVDGLRGDIVTNRAA+ALA
Sbjct  230  YQESQNALTDKITKARALLNKDGVSLSYDFQVKISQICSELNVDGLRGDIVTNRAAKALA  289

Query  373  SLKGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +   R EVTA+DI  ++  CLR RLRKDPLESIDSG  V E F  VF
Sbjct  290  AFDNREEVTAQDIFKIVTLCLRHRLRKDPLESIDSGTKVQEVFSTVF  336



>ref|YP_003058322.1| Mg-protoporyphyrin IX chelatase [Parachlorella kessleri]
 gb|ACQ90917.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Parachlorella kessleri]
Length=356

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRV+ VE RA FD  P EFR+ 
Sbjct  187  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPNLRVQIVEQRANFDAAPLEFRKN  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y   Q +L  QI  AR  L  V I +D RVKI ++C+ELNVDGLRGDIVTNRA++ALA+ 
Sbjct  247  YNDSQNELANQIIQARQLLPQVQISYDHRVKISQICSELNVDGLRGDIVTNRASKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +G   VT EDI  VIP CLR RLRKDPLESIDSG  V + F  VF
Sbjct  307  EGHTTVTVEDIFRVIPLCLRHRLRKDPLESIDSGDKVRDVFKRVF  351



>ref|NP_038377.1| Mg-protoporyphyrin IX chelatase [Mesostigma viride]
 sp|Q9MUT3.1|CHLI_MESVI RecName: Full=Magnesium-chelatase subunit ChlI; Short=Mg-chelatase 
subunit I-1; AltName: Full=Mg-protoporphyrin IX chelatase 
subunit ChlI (chloroplast) [Mesostigma viride]
 gb|AAF43818.1|AF166114_30 magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Mesostigma viride]
Length=360

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+FIL+GSGNPEEGELRPQLLDRFGMHA++ TV+D +LRVK VE R+ FD NP+ FR+ 
Sbjct  190  PAKFILVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPDLRVKIVEERSSFDENPQVFRKA  249

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  QE ++ QI  AR +L +V +D + R+K+ ++C+EL+VDGLRGD+V NRAA+ALA+ 
Sbjct  250  YEQSQEDVKSQIIQARKNLANVQMDRELRIKVSQICSELDVDGLRGDLVINRAAKALAAF  309

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR++V  +DI  +I  CLR RLRKDPLESIDSG  V  KFYEVF
Sbjct  310  EGRDKVLPKDILKIITLCLRHRLRKDPLESIDSGSKVESKFYEVF  354



>ref|WP_015162113.1| magnesium chelatase ATPase subunit I [Chamaesiphon minutus]
 gb|AFY96027.1| magnesium chelatase ATPase subunit I [Chamaesiphon minutus PCC 
6605]
Length=359

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++ ELRV+ VE R+ FD NP +F   
Sbjct  188  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPELRVQIVEQRSDFDLNPHKFTTE  247

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ  LQ +I  A+  L SVT+D+D RVKI +VC+E +VDGLRGDIVTNRAA+ALA+ 
Sbjct  248  YQAEQVLLQQRIVDAQTRLASVTLDYDLRVKISQVCSECDVDGLRGDIVTNRAAKALAAF  307

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  ++  CLR RLRKDPLESIDSG  V + F EVF 
Sbjct  308  EGRTEVTLDDIRRIVALCLRHRLRKDPLESIDSGYKVNKVFAEVFG  353



>gb|KHG08167.1| Magnesium-chelatase subunit chlI, chloroplastic [Gossypium arboreum]
Length=277

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -3

Query  637  VGTVRDAELRVKXVEXRARFDRNPKEFREFYKAEQEKLQXQIALARNSLFSVTIDHDFRV  458
            VGTVRDAELRVK VE RARFD+NPKEFR+ YKAEQEKLQ QIA AR+SL SV ID D +V
Sbjct  142  VGTVRDAELRVKIVEERARFDKNPKEFRDSYKAEQEKLQQQIASARSSLSSVQIDQDLKV  201

Query  457  KIFKVCAELNVDGLRGDIVTNRAARALASLKGRNEVTAEDIATVIPNCLRXRLRKDPLES  278
            KI KVCAELNVDGLRGDIVTNRAA+ALA+LKGR++V AEDIATVIPNCLR RLRKDPLES
Sbjct  202  KISKVCAELNVDGLRGDIVTNRAAKALAALKGRDKVIAEDIATVIPNCLRHRLRKDPLES  261

Query  277  IDSGVLVIEKFYEVFN  230
            IDSG+LVIEKFYEVF 
Sbjct  262  IDSGLLVIEKFYEVFG  277



>ref|WP_006197284.1| magnesium chelatase [Nodularia spumigena]
 gb|EAW44576.1| Magnesium chelatase ATPase subunit I [Nodularia spumigena CCY9414]
Length=374

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE RA FD+NP EF E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRAEFDQNPPEFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
             + EQE LQ +I  A+N L  VT+D+D RVKI ++C+EL+VDGLRGDIV+NRAA+AL + 
Sbjct  247  CQGEQEALQQKIVNAQNLLPKVTLDYDQRVKISEICSELDVDGLRGDIVSNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR+EVT +DI  VI  CLR RLRKDPLESID+G  V + F  VF 
Sbjct  307  EGRSEVTVDDIKRVITLCLRHRLRKDPLESIDTGYKVQKAFARVFG  352



>ref|YP_636198.1| Mg-protoporyphyrin IX chelatase [Pseudendoclonium akinetum]
 gb|AAV80622.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Pseudendoclonium akinetum]
Length=349

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHA++GTVR+ +LRV+ VE RA FD  P EFR  
Sbjct  184  PARFILVGSGNPEEGELRPQLLDRFGMHAEIGTVREPDLRVQIVEQRAAFDEAPLEFRTN  243

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+  Q+ L  ++  AR  L    +D+D RVKI ++C+ELNVDGLRGDIVTNRAA+ALA  
Sbjct  244  YENSQKALSQKLVEARELLKKAELDYDLRVKISQICSELNVDGLRGDIVTNRAAKALAVF  303

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR  VT+ DI  VIP CLR RLRKDPLE+IDSG  V E F +VF
Sbjct  304  EGRTSVTSNDIFRVIPLCLRHRLRKDPLETIDSGNKVREIFQKVF  348



>ref|WP_023074898.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
 gb|ESA34270.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
Length=359

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+F+LIGSGNPEEGELRPQLLDRFGMHA++ TV+D   RV+ VE R+ FD++P  F   
Sbjct  177  PAQFVLIGSGNPEEGELRPQLLDRFGMHAEIRTVKDPAQRVQIVEQRSEFDQDPDAFLVK  236

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+AEQ  LQ +I  A+  L  VTIDH++RV+I +VC+EL+VDGLRGDIV+NRAA+ALA+ 
Sbjct  237  YQAEQTALQEKIVSAQQRLKEVTIDHEYRVQISQVCSELDVDGLRGDIVSNRAAKALAAY  296

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI TVI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  297  EGRTEVTIDDIQTVIALCLRHRLRKDPLESIDSGYKVEKTFGNVFG  342



>ref|WP_015203363.1| protoporphyrin IX magnesium-chelatase [Crinalium epipsammum]
 gb|AFZ13249.1| protoporphyrin IX magnesium-chelatase [Crinalium epipsammum PCC 
9333]
Length=374

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TVR+  LRV+ VE RA FD+NP  F E 
Sbjct  188  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPALRVQIVEQRAEFDQNPPAFVEK  247

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ + Q QI  A+  L SV +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+AL +L
Sbjct  248  YQPEQIEAQKQIVDAQQLLSSVKMDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAL  307

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  308  EGRQEVTVDDIRRVIALCLRHRLRKDPLESIDSGYKVEKVFSRVFG  353



>ref|WP_027843787.1| magnesium chelatase [Mastigocoleus testarum]
Length=373

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNPPSFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y +EQE+LQ +I  A+ +L SV +D++ RVKI +VC+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  247  YHSEQEELQKRIVTAQENLSSVNLDYELRVKISEVCSELDVDGLRGDIVTNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            + R EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF
Sbjct  307  EARKEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVF  351



>ref|WP_041236613.1| magnesium chelatase [Cyanothece sp. PCC 7425]
Length=355

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+D   RV  VE R++FD+NP+EF   
Sbjct  185  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPVQRVDIVEQRSQFDQNPQEFLSQ  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +++EQ+ LQ +I  A+  L  VTID + RV+I +VCAELNVDGLRGDIVTNRAA+ALA+ 
Sbjct  245  HQSEQQALQQKIIQAQQLLPQVTIDRELRVQISQVCAELNVDGLRGDIVTNRAAKALAAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EV   DI  VI  CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  305  EGRTEVLVSDIERVITLCLRHRLRKDPLESIDSGYKVAKVFSQVFG  350



>ref|YP_009019349.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Auxenochlorella 
protothecoides]
 gb|AGL10882.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Auxenochlorella 
protothecoides]
Length=247

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGE RPQLLDRFGMHAQ+GTV++  LRV+ VE RA FD +P +FR  
Sbjct  80   PARFILVGSGNPEEGECRPQLLDRFGMHAQIGTVKEPHLRVQIVEQRADFDASPLKFRNI  139

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK  QE+L  QI  AR  L  V ID+DFR+KI ++C EL+VDGLRGD+VTNRA++ALA+ 
Sbjct  140  YKQSQEQLANQIIKARELLPEVQIDYDFRIKISQICGELDVDGLRGDLVTNRASKALAAF  199

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
             G   V  +DI  VIP  LR RLRKDPLESIDSG  V E F  VF
Sbjct  200  YGHTNVNEKDIFKVIPLSLRHRLRKDPLESIDSGDKVREAFKRVF  244



>gb|KIJ82690.1| magnesium chelatase [Scytonema tolypothrichoides VB-61278]
Length=373

 Score =   215 bits (547),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F + 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPALRVQIVEQRSEFDQNPPGFLDQ  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +K++Q++LQ +I  A+N L SV ID+D RVKI +VC+EL+VDGLRGDIVTNRAA+A+A+ 
Sbjct  247  HKSQQQELQQKIISAQNLLPSVAIDYDLRVKISEVCSELDVDGLRGDIVTNRAAKAIAAY  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  V+  CLR RLRKDPLESIDSG  V + F  +F 
Sbjct  307  EGRTEVTVDDIRRVMTLCLRHRLRKDPLESIDSGYKVEKTFSRIFG  352



>ref|WP_017713506.1| magnesium chelatase [Prochlorothrix hollandica]
Length=356

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGM  +V TVRD + RV+ VE R+ FD  P +F + 
Sbjct  182  PARFVLVGSGNPEEGELRPQLLDRFGMSVEVRTVRDPKQRVQVVEERSAFDNKPLDFLDK  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ+ LQ ++  A+  L SVT+D+D RV+I +VC+ L++DGLRGDIVTNRAA AL +L
Sbjct  242  YQVEQDGLQQKLVDAQTRLESVTLDYDLRVQISQVCSSLDIDGLRGDIVTNRAASALTAL  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GRNEVT EDI  V+P CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  302  EGRNEVTVEDIQRVLPLCLRHRLRKDPLESIDSGYKVTKTFCQVFG  347



>ref|YP_009106670.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pseudochloris wilhelmii]
 gb|AIT95482.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pseudochloris wilhelmii]
Length=362

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTV++  LRV+ VE RA FD  P EFR+ 
Sbjct  194  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKEPYLRVQIVEQRASFDAAPLEFRQT  253

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            ++A Q KL   I  AR  L  V +++D+RVKI ++C+EL+VDGLRGD+VTNRA++A+A+ 
Sbjct  254  HQAAQMKLAENIIDARQLLAQVELEYDYRVKISQICSELDVDGLRGDLVTNRASKAIAAF  313

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
             GR  VT EDI  VIP CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  314  DGRTRVTPEDIYRVIPLCLRHRLRKDPLESIDSGNKVQDVFKRVFG  359



>ref|WP_008233259.1| Protoporphyrin IX Mg-chelatase subunit I [Richelia intracellularis]
 emb|CCH67102.1| Protoporphyrin IX Mg-chelatase subunit I [Richelia intracellularis 
HH01]
Length=363

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 129/170 (76%), Gaps = 0/170 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMH+++ TVR+  LRV+ VE R+ FD+NP EF   
Sbjct  184  PARFVLVGSGNPEEGELRPQLLDRFGMHSEIRTVREPALRVQIVEQRSEFDKNPSEFLAR  243

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQE+LQ +I  A+  L  + ID++ RV I +VC+ELNVDGLRGDIVTN AA+AL + 
Sbjct  244  YKIEQEELQQRIVNAQKLLTQLNIDYNLRVNISEVCSELNVDGLRGDIVTNHAAKALTAF  303

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN*GTT  218
            +GR EVT EDI  VI  CLR RLRKDPLE+IDSG  V + F  VF   T+
Sbjct  304  EGRTEVTVEDIQRVITLCLRHRLRKDPLEAIDSGYKVEKAFSRVFGVATS  353



>ref|WP_015172950.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
 gb|AFY67386.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
Length=375

 Score =   215 bits (547),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD++P  F E 
Sbjct  190  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPNLRVQIVEQRSEFDQDPPSFLEK  249

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+A+Q+++Q ++  AR+ L SVTI H+ +V+I +VCAEL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  250  YQAQQDEIQQKLVSARDRLPSVTIAHNMKVQISQVCAELDVDGLRGDIVTNRAAKALAAF  309

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT  DI  +I  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  310  EGRTEVTVNDIQRIIALCLRHRLRKDPLESIDSGYKVEKIFCRVFG  355



>gb|ACL43356.1| magnesium chelatase ATPase subunit I [Cyanothece sp. PCC 7425]
Length=369

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+D   RV  VE R++FD+NP+EF   
Sbjct  199  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPVQRVDIVEQRSQFDQNPQEFLSQ  258

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +++EQ+ LQ +I  A+  L  VTID + RV+I +VCAELNVDGLRGDIVTNRAA+ALA+ 
Sbjct  259  HQSEQQALQQKIIQAQQLLPQVTIDRELRVQISQVCAELNVDGLRGDIVTNRAAKALAAF  318

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EV   DI  VI  CLR RLRKDPLESIDSG  V + F +VF 
Sbjct  319  EGRTEVLVSDIERVITLCLRHRLRKDPLESIDSGYKVAKVFSQVFG  364



>ref|WP_019498563.1| magnesium chelatase [Pseudanabaena sp. PCC 6802]
Length=357

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+  ELRV+ VE R  FDRNP++F   
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKTPELRVQIVEQRTDFDRNPQQFLSH  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y  +Q ++Q QI  A+  L SVTI  D R+ I +VCA+L+VDGLRGDIVTNRA++A+A+L
Sbjct  247  YSDKQIEIQEQIVRAQELLNSVTIPTDLRLNISQVCADLDVDGLRGDIVTNRASKAIAAL  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F EVF 
Sbjct  307  EGRTEVTVDDIKRVITLCLRHRLRKDPLESIDSGYKVQKVFREVFG  352



>ref|YP_007317165.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Monomorphina aenigmatica]
 gb|AFZ88767.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Monomorphina aenigmatica]
Length=349

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+ TV+D   RVK V+ R  F+RNPK+F++ 
Sbjct  182  PARFILVGSGNPEEGELRPQLLDRFGMHAQIKTVKDPSSRVKIVQQRELFERNPKDFKQK  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQ+KL  +I  AR +L ++TI ++   KI ++C++LNVDGLRGD+VT+RAA+AL + 
Sbjct  242  YQDEQDKLMEKIKNARKNLKNITIKYELLEKISQICSDLNVDGLRGDMVTSRAAKALVAF  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            + RNEVT++DI T+I  CLR RLRKDPLE IDSG  V E F  VFN
Sbjct  302  ENRNEVTSKDIFTIITLCLRHRLRKDPLEQIDSGFKVQESFKRVFN  347



>ref|WP_017652974.1| magnesium chelatase [Microchaete sp. PCC 7126]
Length=374

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TVR+  LRV+ VE RA FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVREPALRVQIVEQRAEFDQNPLAFVEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK EQE LQ +I  A+N L +V  D+D RVKI ++C+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  247  YKPEQEALQEKIVKAQNLLSAVKSDYDTRVKISEICSELDVDGLRGDIVTNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            + R EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EERTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKAFARVFG  352



>ref|WP_008317866.1| magnesium chelatase ATPase subunit I [Leptolyngbya sp. PCC 6406]
Length=366

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PA+F+L+GSGNPEEGELRPQLLDRFGMHA++ TV+D ELRV+ VE R+ FD++P+ +   
Sbjct  182  PAQFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPELRVQIVEQRSDFDQDPQTYLAN  241

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            ++ EQ+ LQ ++  A+  L SVT+DHD+RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  242  HQTEQDALQQRLVEAQMRLPSVTLDHDYRVKISQVCSELDVDGLRGDIVTNRAAKALAAY  301

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EV  +DI  VI  CLR RLRKDPLESID+G  V + F +VF 
Sbjct  302  EGRTEVVLDDIRRVIALCLRHRLRKDPLESIDTGYKVEKVFSQVFG  347



>gb|KIY99379.1| magnesium chelatase subunit I [Monoraphidium neglectum]
Length=330

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARFIL+GSGNPEEGELRPQLLDRFGMHAQ+GTVR+ ELRV+ V  R+ FD +P  FR  
Sbjct  163  PARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVREPELRVQIVAERSTFDEDPATFRGK  222

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ +Q  L  +I  AR  L SV I +DFRVKI ++C+ELNVDG+RGDIVTNRA++A+A+ 
Sbjct  223  YEDKQNALTNKIVDARKRLKSVDIAYDFRVKISQICSELNVDGIRGDIVTNRASKAIAAF  282

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR+EV  EDI  VIP CLR RLRKDPL  IDSG  V E F  VF 
Sbjct  283  EGRSEVALEDIYRVIPLCLRHRLRKDPLADIDSGDKVREVFKAVFG  328



>ref|WP_015111597.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
 gb|AFY41357.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
Length=374

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNPPVFLEQ  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +K EQE LQ ++  A+  L  V ID+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  247  HKTEQESLQQKVVNAQTLLPEVKIDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALAAY  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTLDDIRRVITLCLRHRLRKDPLESIDSGYKVEKVFARVFG  352



>ref|WP_012593827.1| MULTISPECIES: magnesium chelatase [Cyanothece]
 gb|ACK64550.1| magnesium chelatase ATPase subunit I [Cyanothece sp. PCC 8801]
 gb|ACU99423.1| magnesium chelatase ATPase subunit I [Cyanothece sp. PCC 8802]
Length=358

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FDR+P++F + 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDRDPQKFCDN  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ EQE LQ ++  A+  L   T+D+D RVKI +VC+EL+VDGLRGDIVTNRAA+ALA+ 
Sbjct  247  YQPEQEALQNKLVQAQEILKKATVDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALAAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI   I  CLR RLRKDPLE+IDSG  V + F  VF
Sbjct  307  EGRTEVTVDDIRRTIVLCLRHRLRKDPLETIDSGYKVTKAFNRVF  351



>ref|WP_009456321.1| MULTISPECIES: magnesium chelatase [Fischerella]
 gb|EHC14814.1| magnesium chelatase ATPase subunit I [Fischerella sp. JSC-11]
Length=369

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  183  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPVLRVQIVEQRSEFDQNPLAFVEK  242

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK++Q+ LQ +I  A+  L SV ID+D RVKI +VC+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  243  YKSQQQDLQQRIIKAQELLPSVNIDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAF  302

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR +VT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  303  EGRTDVTVDDIHRVIVLCLRHRLRKDPLESIDSGYKVDKAFARVFG  348



>ref|WP_036002315.1| magnesium chelatase [Leptolyngbya sp. JSC-1]
Length=365

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFG+HA++ TV+D  LRV+ VE R+ FD+ P+ F E 
Sbjct  189  PARFVLVGSGNPEEGELRPQLLDRFGLHAEIRTVKDPALRVQIVEQRSEFDQEPEAFLEK  248

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ +QE LQ ++  A+  L SVTIDHD +VKI +VCAEL+VDGLRGDIVTNR A+ALA+ 
Sbjct  249  YQPQQEALQQKLIRAQELLKSVTIDHDLKVKISQVCAELDVDGLRGDIVTNRTAKALAAY  308

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  V+   LR RLRKDPLESIDSG  V + F +VF 
Sbjct  309  EGRTEVTVDDIRRVVVMALRHRLRKDPLESIDSGYKVEKVFNQVFG  354



>ref|WP_013191980.1| magnesium chelatase [Trichormus azollae]
 gb|ADI64965.1| magnesium chelatase ATPase subunit I ['Nostoc azollae' 0708]
Length=373

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV  VE R+ FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVHIVEKRSEFDQNPPFFLEN  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK+EQE LQ +I  A+  L  V +D+D RVKI +VC+EL+VDGLRGDIVTNRAA+AL + 
Sbjct  247  YKSEQEGLQEKIVKAQELLPQVNLDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR +VT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTQVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVQKAFARVFG  352



>ref|WP_012165153.1| magnesium chelatase [Acaryochloris marina]
 gb|ABW29878.1| magnesium protoporphyrin IX chelatase, subunit I [Acaryochloris 
marina MBIC11017]
Length=337

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV+D  LRV+ VE R++FD+ P  + + 
Sbjct  161  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKDPTLRVQIVEERSQFDQEPNAYLDN  220

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            +   Q+ LQ QI  A+N+L +V IDH+ RV I +VC+EL+VDGLRGDIV+NRAA+A+A+ 
Sbjct  221  HTDNQKALQDQIVNAQNNLANVNIDHELRVNISQVCSELDVDGLRGDIVSNRAAKAIAAF  280

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F +VF
Sbjct  281  EGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVSKVFRQVF  325



>ref|WP_015148601.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata]
 gb|AFY81959.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata 
PCC 6304]
Length=363

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRVK VE R+ FD+NP+ + E 
Sbjct  191  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPALRVKIVEERSGFDQNPQTYLEQ  250

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            ++ EQ+ LQ ++  A+N L SV +D++ RV+I +VC+EL+VDGLRGDIVTNRAA+A+A+L
Sbjct  251  HETEQQALQQKLIDAQNLLPSVNLDYEMRVQISQVCSELDVDGLRGDIVTNRAAKAIAAL  310

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  311  EGRTEVTLDDIRRVITLCLRHRLRKDPLESIDSGYKVQKVFSSVFG  356



>ref|WP_011243252.1| MULTISPECIES: magnesium chelatase [Synechococcus]
 dbj|BAD79130.1| magnesium-chelatase subunit ChlI [Synechococcus elongatus PCC 
6301]
 gb|ABB56615.1| protoporphyrin IX magnesium-chelatase [Synechococcus elongatus 
PCC 7942]
 gb|AJD56346.1| magnesium chelatase [Synechococcus sp. UTEX 2973]
Length=364

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGM  +V TV+D ELRV+ VE R+ FD+NP+ F + 
Sbjct  185  PARFVLVGSGNPEEGELRPQLLDRFGMSVEVRTVKDPELRVQVVEQRSTFDQNPQTFLDR  244

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y +EQ+ LQ +I  A+  L SV +D+D RVKI +VC+EL++DGLRGDIVTNRAA+AL + 
Sbjct  245  YASEQDSLQARIVAAQTLLPSVELDYDLRVKISEVCSELDIDGLRGDIVTNRAAKALTAF  304

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR+EVT EDI  ++  CLR RLRKDPLES+DSG  V + F  VF 
Sbjct  305  EGRSEVTLEDIQRIVAPCLRHRLRKDPLESVDSGGKVAKVFCRVFG  350



>ref|WP_012412525.1| magnesium chelatase [Nostoc punctiforme]
 gb|ACC84586.1| magnesium chelatase ATPase subunit I [Nostoc punctiforme PCC 
73102]
Length=374

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE RA FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRADFDQNPLVFLEN  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            YK +QE LQ QI  A+  L  V +D++ RVKI +VC+EL+VDGLRGDIV+NRAA+AL + 
Sbjct  247  YKPQQEALQEQIVNAQQLLPEVKLDYELRVKISEVCSELDVDGLRGDIVSNRAAKALTAY  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVFN  230
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  VF 
Sbjct  307  EGRTEVTVDDICRVITLCLRHRLRKDPLESIDSGYKVAKVFSRVFG  352



>ref|WP_019494089.1| magnesium chelatase [Calothrix sp. PCC 7103]
Length=372

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -3

Query  727  PARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKXVEXRARFDRNPKEFREF  548
            PARF+L+GSGNPEEGELRPQLLDRFGMHA++ TV++  LRV+ VE R+ FD+NP  F E 
Sbjct  187  PARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPALRVQIVEQRSEFDQNPNPFLEK  246

Query  547  YKAEQEKLQXQIALARNSLFSVTIDHDFRVKIFKVCAELNVDGLRGDIVTNRAARALASL  368
            Y+ +QE+LQ +I  A+N L SV +D+D RVKI +VCAEL+VDGLRGDIV+NRAA+A+ + 
Sbjct  247  YQPQQEELQQRIINAQNLLPSVNMDYDLRVKISEVCAELDVDGLRGDIVSNRAAKAITAF  306

Query  367  KGRNEVTAEDIATVIPNCLRXRLRKDPLESIDSGVLVIEKFYEVF  233
            +GR EVT +DI  VI  CLR RLRKDPLESIDSG  V + F  +F
Sbjct  307  EGRTEVTIDDIRRVITLCLRHRLRKDPLESIDSGYKVEKVFGRIF  351



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1344627596975