BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1365

Length=839
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621483.1|  PREDICTED: transcription initiation factor T...    229   7e-67   Nicotiana tomentosiformis
ref|XP_009621482.1|  PREDICTED: transcription initiation factor T...    228   2e-66   
ref|XP_009796566.1|  PREDICTED: transcription initiation factor T...    226   5e-66   Nicotiana sylvestris
ref|XP_004246524.1|  PREDICTED: transcription initiation factor T...    223   2e-64   Solanum lycopersicum
ref|XP_006341120.1|  PREDICTED: transcription initiation factor T...    221   5e-64   Solanum tuberosum [potatoes]
emb|CBI30264.3|  unnamed protein product                                215   2e-63   Vitis vinifera
ref|XP_010654342.1|  PREDICTED: transcription initiation factor T...    216   2e-62   Vitis vinifera
ref|XP_007203746.1|  hypothetical protein PRUPE_ppa017159mg             215   6e-62   
emb|CDP15396.1|  unnamed protein product                                216   7e-62   Coffea canephora [robusta coffee]
ref|XP_008241261.1|  PREDICTED: transcription initiation factor T...    216   9e-62   Prunus mume [ume]
ref|XP_002528715.1|  protein with unknown function                      211   7e-61   
ref|XP_012066476.1|  PREDICTED: transcription initiation factor T...    211   3e-60   Jatropha curcas
ref|XP_008355631.1|  PREDICTED: transcription initiation factor T...    201   1e-59   
gb|KCW48340.1|  hypothetical protein EUGRSUZ_K02056                     209   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010036709.1|  PREDICTED: transcription initiation factor T...    209   2e-59   Eucalyptus grandis [rose gum]
ref|XP_011094374.1|  PREDICTED: transcription initiation factor T...    207   4e-59   Sesamum indicum [beniseed]
ref|XP_004305348.1|  PREDICTED: transcription initiation factor T...    207   6e-59   Fragaria vesca subsp. vesca
ref|XP_011466777.1|  PREDICTED: transcription initiation factor T...    207   7e-59   Fragaria vesca subsp. vesca
ref|XP_009366650.1|  PREDICTED: transcription initiation factor T...    206   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_009366648.1|  PREDICTED: transcription initiation factor T...    206   3e-58   Pyrus x bretschneideri [bai li]
ref|XP_009374742.1|  PREDICTED: transcription initiation factor T...    204   4e-57   
ref|XP_010101595.1|  Transcription initiation factor TFIID subuni...    203   7e-57   
ref|XP_007027689.1|  Transcription initiation factor TFIID subuni...    202   1e-56   
ref|XP_008462670.1|  PREDICTED: transcription initiation factor T...    199   4e-56   Cucumis melo [Oriental melon]
gb|KHG00576.1|  Transcription initiation factor TFIID subunit 12        199   8e-56   Gossypium arboreum [tree cotton]
gb|KJB15070.1|  hypothetical protein B456_002G158700                    198   2e-55   Gossypium raimondii
ref|XP_011657696.1|  PREDICTED: transcription initiation factor T...    197   2e-55   Cucumis sativus [cucumbers]
ref|XP_011657695.1|  PREDICTED: transcription initiation factor T...    197   3e-55   Cucumis sativus [cucumbers]
ref|XP_007027691.1|  Transcription initiation factor TFIID subuni...    197   5e-55   
ref|XP_006481807.1|  PREDICTED: transcription initiation factor T...    196   1e-54   Citrus sinensis [apfelsine]
ref|XP_008467013.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    190   2e-54   
gb|KDO61101.1|  hypothetical protein CISIN_1g009336mg                   195   3e-54   Citrus sinensis [apfelsine]
ref|XP_006430244.1|  hypothetical protein CICLE_v10011440mg             194   7e-54   Citrus clementina [clementine]
ref|XP_010543485.1|  PREDICTED: transcription initiation factor T...    191   8e-53   Tarenaya hassleriana [spider flower]
ref|XP_010486588.1|  PREDICTED: transcription initiation factor T...    188   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007145316.1|  hypothetical protein PHAVU_007G228800g             187   1e-51   Phaseolus vulgaris [French bean]
ref|XP_010480364.1|  PREDICTED: transcription initiation factor T...    187   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_003542594.1|  PREDICTED: transcription initiation factor T...    186   3e-51   Glycine max [soybeans]
ref|XP_011019889.1|  PREDICTED: transcription initiation factor T...    186   6e-51   Populus euphratica
ref|XP_006407609.1|  hypothetical protein EUTSA_v10020482mg             185   1e-50   Eutrema salsugineum [saltwater cress]
ref|XP_002308150.1|  transcription initiation factor IID subunit ...    184   2e-50   
ref|XP_006297380.1|  hypothetical protein CARUB_v10013405mg             184   5e-50   Capsella rubella
ref|XP_010464667.1|  PREDICTED: transcription initiation factor T...    184   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002884775.1|  tata-associated factor II 58                       183   8e-50   
ref|NP_566367.1|  TBP-associated factor 12                              183   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010695518.1|  PREDICTED: transcription initiation factor T...    178   1e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH42051.1|  transcription initiation factor TFIID subunit 12        182   2e-49   Medicago truncatula
ref|XP_004516193.1|  PREDICTED: transcription initiation factor T...    180   1e-48   Cicer arietinum [garbanzo]
ref|XP_007027692.1|  Transcription initiation factor TFIID subuni...    181   1e-48   
gb|KFK38391.1|  hypothetical protein AALP_AA3G107300                    179   3e-48   Arabis alpina [alpine rockcress]
ref|XP_009146875.1|  PREDICTED: transcription initiation factor T...    179   3e-48   Brassica rapa
emb|CDY60164.1|  BnaAnng16580D                                          179   3e-48   Brassica napus [oilseed rape]
ref|XP_010695517.1|  PREDICTED: transcription initiation factor T...    179   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695516.1|  PREDICTED: transcription initiation factor T...    179   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006645050.1|  PREDICTED: transcription initiation factor T...    172   9e-48   Oryza brachyantha
emb|CDY00904.1|  BnaC05g42960D                                          177   1e-47   
ref|XP_003537062.1|  PREDICTED: transcription initiation factor T...    176   2e-47   Glycine max [soybeans]
ref|XP_010271709.1|  PREDICTED: transcription initiation factor T...    176   3e-47   Nelumbo nucifera [Indian lotus]
ref|NP_001044860.1|  Os01g0858500                                       170   6e-47   
dbj|BAD82054.1|  transcription initiation factor IID (TFIID) subu...    170   7e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KDO61104.1|  hypothetical protein CISIN_1g009336mg                   174   2e-46   Citrus sinensis [apfelsine]
ref|XP_010910328.1|  PREDICTED: transcription initiation factor T...    172   5e-46   Elaeis guineensis
gb|EEC71841.1|  hypothetical protein OsI_04504                          172   5e-46   Oryza sativa Indica Group [Indian rice]
gb|EMS49133.1|  Transcription initiation factor TFIID subunit 12        170   6e-46   Triticum urartu
ref|XP_010910326.1|  PREDICTED: transcription initiation factor T...    172   7e-46   Elaeis guineensis
ref|XP_002975297.1|  hypothetical protein SELMODRAFT_6783               161   9e-46   
tpg|DAA56738.1|  TPA: hypothetical protein ZEAMMB73_736720              170   1e-45   
ref|XP_008674801.1|  PREDICTED: transcription initiation factor T...    171   1e-45   Zea mays [maize]
ref|XP_003564657.2|  PREDICTED: transcription initiation factor T...    170   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_010543486.1|  PREDICTED: transcription initiation factor T...    171   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_010232585.1|  PREDICTED: transcription initiation factor T...    171   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_010232584.1|  PREDICTED: transcription initiation factor T...    170   3e-45   Brachypodium distachyon [annual false brome]
ref|XP_010238690.1|  PREDICTED: transcription initiation factor T...    170   5e-45   
ref|XP_002458799.1|  hypothetical protein SORBIDRAFT_03g040460          169   6e-45   Sorghum bicolor [broomcorn]
gb|EMT22443.1|  Transcription initiation factor TFIID subunit 12        169   6e-45   
ref|XP_004970647.1|  PREDICTED: transcription initiation factor T...    168   1e-44   Setaria italica
ref|XP_008808549.1|  PREDICTED: transcription initiation factor T...    169   2e-44   Phoenix dactylifera
ref|XP_009420517.1|  PREDICTED: transcription initiation factor T...    167   8e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008674800.1|  PREDICTED: transcription initiation factor T...    165   2e-43   Zea mays [maize]
ref|XP_008674802.1|  PREDICTED: transcription initiation factor T...    164   3e-43   Zea mays [maize]
ref|XP_006851500.2|  PREDICTED: transcription initiation factor T...    159   5e-42   
gb|EPS61934.1|  hypothetical protein M569_12859                         154   6e-42   Genlisea aurea
gb|ERN13081.1|  hypothetical protein AMTR_s00040p00151890               159   8e-42   Amborella trichopoda
ref|XP_008363808.1|  PREDICTED: transcription initiation factor T...    147   2e-40   
gb|KDO61105.1|  hypothetical protein CISIN_1g009336mg                   156   4e-40   Citrus sinensis [apfelsine]
gb|ERN08040.1|  hypothetical protein AMTR_s00012p00261940               150   1e-38   Amborella trichopoda
ref|XP_010271712.1|  PREDICTED: transcription initiation factor T...    149   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_001781440.1|  predicted protein                                  142   2e-38   
ref|XP_010910327.1|  PREDICTED: transcription initiation factor T...    148   3e-37   Elaeis guineensis
ref|XP_006846365.2|  PREDICTED: transcription initiation factor T...    147   6e-37   
ref|XP_012068891.1|  PREDICTED: transcription initiation factor T...    145   4e-36   Jatropha curcas
ref|XP_012068890.1|  PREDICTED: transcription initiation factor T...    145   5e-36   Jatropha curcas
emb|CEG73313.1|  Putative Genomic scaffold, msy_sf_3                    142   1e-35   Rhizopus microsporus
gb|KJB68260.1|  hypothetical protein B456_010G235100                    144   1e-35   Gossypium raimondii
gb|KJB68264.1|  hypothetical protein B456_010G235100                    144   1e-35   Gossypium raimondii
gb|KJB68265.1|  hypothetical protein B456_010G235100                    144   1e-35   Gossypium raimondii
gb|EIE76230.1|  hypothetical protein RO3G_00934                         141   2e-35   Rhizopus delemar RA 99-880
gb|EPB84926.1|  hypothetical protein HMPREF1544_08285                   141   4e-35   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_011467427.1|  PREDICTED: transcription initiation factor T...    142   4e-35   Fragaria vesca subsp. vesca
ref|XP_007216979.1|  hypothetical protein PRUPE_ppa002765mg             142   5e-35   Prunus persica
ref|XP_007024607.1|  Transcription initiation factor TFIID subuni...    143   5e-35   
ref|XP_002264851.2|  PREDICTED: transcription initiation factor T...    142   6e-35   Vitis vinifera
ref|XP_007024609.1|  Transcription initiation factor TFIID subuni...    142   7e-35   
ref|XP_008228206.1|  PREDICTED: transcription initiation factor T...    142   1e-34   Prunus mume [ume]
ref|XP_011035712.1|  PREDICTED: transcription initiation factor T...    141   1e-34   Populus euphratica
ref|XP_011035709.1|  PREDICTED: transcription initiation factor T...    141   1e-34   Populus euphratica
gb|KJB68261.1|  hypothetical protein B456_010G235100                    141   1e-34   Gossypium raimondii
gb|KJB68263.1|  hypothetical protein B456_010G235100                    141   2e-34   Gossypium raimondii
ref|XP_011036418.1|  PREDICTED: transcription initiation factor T...    140   3e-34   Populus euphratica
ref|XP_002521336.1|  protein with unknown function                      140   3e-34   Ricinus communis
emb|CEP13702.1|  hypothetical protein                                   139   3e-34   Parasitella parasitica
ref|XP_002304140.1|  transcription initiation factor IID subunit ...    140   3e-34   
dbj|GAN08512.1|  transcription initiation factor TFIID subunit 12...    139   4e-34   Mucor ambiguus
ref|XP_004235568.1|  PREDICTED: transcription initiation factor T...    140   4e-34   Solanum lycopersicum
gb|KJB70117.1|  hypothetical protein B456_011G058700                    140   5e-34   Gossypium raimondii
gb|KCW69820.1|  hypothetical protein EUGRSUZ_F03174                     138   7e-34   Eucalyptus grandis [rose gum]
ref|XP_003627263.1|  Transcription initiation factor TFIID subunit      139   8e-34   
ref|XP_008391383.1|  PREDICTED: transcription initiation factor T...    139   9e-34   Malus domestica [apple tree]
gb|ADL36631.1|  C2H2L domain class transcription factor                 139   1e-33   Malus domestica [apple tree]
ref|NP_001275310.1|  transcription initiation factor TFIID subuni...    139   1e-33   Solanum tuberosum [potatoes]
ref|XP_008785532.1|  PREDICTED: transcription initiation factor T...    138   1e-33   Phoenix dactylifera
ref|XP_008785531.1|  PREDICTED: transcription initiation factor T...    138   1e-33   Phoenix dactylifera
ref|XP_009339800.1|  PREDICTED: transcription initiation factor T...    139   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_010062697.1|  PREDICTED: transcription initiation factor T...    138   2e-33   Eucalyptus grandis [rose gum]
gb|KDO65043.1|  hypothetical protein CISIN_1g007852mg                   138   2e-33   Citrus sinensis [apfelsine]
ref|XP_006426645.1|  hypothetical protein CICLE_v10025234mg             137   2e-33   Citrus clementina [clementine]
ref|XP_009372343.1|  PREDICTED: transcription initiation factor T...    138   2e-33   
ref|XP_006465927.1|  PREDICTED: transcription initiation factor T...    137   2e-33   Citrus sinensis [apfelsine]
ref|XP_009409036.1|  PREDICTED: transcription initiation factor T...    138   2e-33   
ref|XP_007024610.1|  Transcription initiation factor TFIID subuni...    138   3e-33   
ref|XP_011659626.1|  PREDICTED: transcription initiation factor T...    137   5e-33   Cucumis sativus [cucumbers]
gb|KCW69819.1|  hypothetical protein EUGRSUZ_F03174                     137   5e-33   Eucalyptus grandis [rose gum]
ref|XP_010256794.1|  PREDICTED: transcription initiation factor T...    137   5e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010256795.1|  PREDICTED: transcription initiation factor T...    137   6e-33   Nelumbo nucifera [Indian lotus]
gb|KGN45493.1|  hypothetical protein Csa_7G450520                       137   6e-33   Cucumis sativus [cucumbers]
ref|XP_009800090.1|  PREDICTED: transcription initiation factor T...    136   9e-33   Nicotiana sylvestris
ref|XP_008462314.1|  PREDICTED: transcription initiation factor T...    137   9e-33   Cucumis melo [Oriental melon]
ref|XP_007135452.1|  hypothetical protein PHAVU_010G130700g             134   3e-32   Phaseolus vulgaris [French bean]
ref|XP_003528481.1|  PREDICTED: transcription initiation factor T...    134   3e-32   Glycine max [soybeans]
ref|XP_010923230.1|  PREDICTED: transcription initiation factor T...    134   6e-32   Elaeis guineensis
ref|XP_010923229.1|  PREDICTED: transcription initiation factor T...    134   6e-32   Elaeis guineensis
gb|AAC50601.1|  TAF15                                                   125   7e-32   Homo sapiens [man]
ref|XP_010674214.1|  PREDICTED: transcription initiation factor T...    135   7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674213.1|  PREDICTED: transcription initiation factor T...    134   7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_938182.1|  transcription initiation factor TFIID subunit 12      126   8e-32   Danio rerio [leopard danio]
emb|CDP11601.1|  unnamed protein product                                132   8e-32   Coffea canephora [robusta coffee]
ref|XP_010105507.1|  Transcription initiation factor TFIID subuni...    134   9e-32   Morus notabilis
ref|XP_011072579.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    133   1e-31   Sesamum indicum [beniseed]
ref|XP_003229639.1|  PREDICTED: transcription initiation factor T...    126   1e-31   Anolis carolinensis [Carolina anole]
ref|XP_007892954.1|  PREDICTED: transcription initiation factor T...    125   1e-31   Callorhinchus milii [Australian ghost shark]
gb|KFU83685.1|  Transcription initiation factor TFIID subunit 12        125   1e-31   Chaetura pelagica
ref|XP_006631324.1|  PREDICTED: transcription initiation factor T...    126   1e-31   Lepisosteus oculatus
gb|EYU21330.1|  hypothetical protein MIMGU_mgv1a008631mg                130   2e-31   Erythranthe guttata [common monkey flower]
ref|NP_079855.2|  transcription initiation factor TFIID subunit 12      125   2e-31   Mus musculus [mouse]
ref|XP_004425897.1|  PREDICTED: transcription initiation factor T...    125   2e-31   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_011810901.1|  PREDICTED: transcription initiation factor T...    125   2e-31   Colobus angolensis palliatus
gb|ADO28126.1|  transcription initiation factor tfIId subunit 12        125   2e-31   Ictalurus furcatus
ref|NP_001108508.1|  transcription initiation factor TFIID subuni...    125   2e-31   Rattus norvegicus [brown rat]
ref|XP_008052974.1|  PREDICTED: transcription initiation factor T...    125   2e-31   
ref|NP_005635.1|  transcription initiation factor TFIID subunit 12      125   2e-31   Homo sapiens [man]
ref|XP_003471311.1|  PREDICTED: transcription initiation factor T...    125   2e-31   Cavia porcellus [guinea pig]
gb|KHN01400.1|  Transcription initiation factor TFIID subunit 12        132   2e-31   Glycine soja [wild soybean]
ref|NP_001029926.1|  transcription initiation factor TFIID subuni...    125   2e-31   Bos taurus [bovine]
ref|XP_004705110.1|  PREDICTED: transcription initiation factor T...    125   2e-31   Echinops telfairi [lesser hedgehog tenrec]
gb|AAP36430.1|  Homo sapiens TAF12 RNA polymerase II, TATA box bi...    125   2e-31   synthetic construct
ref|XP_004592230.1|  PREDICTED: transcription initiation factor T...    125   2e-31   Ochotona princeps [southern American pika]
ref|NP_001273972.1|  transcription initiation factor TFIID subuni...    125   2e-31   Canis lupus familiaris [dogs]
ref|NP_001187960.1|  transcription initiation factor TFIID subuni...    125   2e-31   Ictalurus punctatus
ref|XP_006739953.1|  PREDICTED: transcription initiation factor T...    125   2e-31   Leptonychotes weddellii
ref|XP_004878186.1|  PREDICTED: transcription initiation factor T...    125   2e-31   
gb|KFH73728.1|  transcription initiation factor TFIID subunit D10       124   3e-31   Mortierella verticillata NRRL 6337
ref|XP_007249707.1|  PREDICTED: transcription initiation factor T...    125   3e-31   Astyanax mexicanus [blind cave fish]
ref|XP_007442021.1|  PREDICTED: transcription initiation factor T...    125   3e-31   Python bivittatus
ref|XP_004078314.1|  PREDICTED: transcription initiation factor T...    124   3e-31   Oryzias latipes [Japanese rice fish]
dbj|BAB25276.1|  unnamed protein product                                125   3e-31   Mus musculus [mouse]
gb|KFP43820.1|  Transcription initiation factor TFIID subunit 12        124   4e-31   Chlamydotis macqueenii
gb|KFO93706.1|  Transcription initiation factor TFIID subunit 12        124   4e-31   Buceros rhinoceros silvestris
gb|ACO09956.1|  Transcription initiation factor TFIID subunit 12        124   4e-31   Osmerus mordax
ref|XP_002189028.1|  PREDICTED: transcription initiation factor T...    124   4e-31   Taeniopygia guttata
ref|XP_005993185.1|  PREDICTED: transcription initiation factor T...    124   4e-31   Latimeria chalumnae
ref|XP_005509739.1|  PREDICTED: transcription initiation factor T...    124   4e-31   
ref|XP_005529902.1|  PREDICTED: transcription initiation factor T...    124   4e-31   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_007170600.1|  PREDICTED: transcription initiation factor T...    125   4e-31   Balaenoptera acutorostrata scammoni
ref|XP_005286224.1|  PREDICTED: transcription initiation factor T...    124   4e-31   Chrysemys picta bellii
ref|XP_005058471.1|  PREDICTED: transcription initiation factor T...    124   4e-31   Ficedula albicollis
gb|KFQ24471.1|  Transcription initiation factor TFIID subunit 12        124   5e-31   Merops nubicus
gb|KFO79426.1|  Transcription initiation factor TFIID subunit 12        124   5e-31   Cuculus canorus
ref|XP_005494213.1|  PREDICTED: transcription initiation factor T...    124   5e-31   Zonotrichia albicollis
ref|NP_001026065.1|  transcription initiation factor TFIID subuni...    124   5e-31   Gallus gallus [bantam]
ref|XP_007625003.1|  PREDICTED: transcription initiation factor T...    125   5e-31   Cricetulus griseus [Chinese hamsters]
gb|KFV70710.1|  Transcription initiation factor TFIID subunit 12        124   5e-31   Picoides pubescens
gb|KFR17297.1|  Transcription initiation factor TFIID subunit 12        124   5e-31   Opisthocomus hoazin [hoatzin]
ref|XP_004678750.1|  PREDICTED: transcription initiation factor T...    124   5e-31   Condylura cristata
ref|XP_010796175.1|  PREDICTED: transcription initiation factor T...    123   5e-31   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008496666.1|  PREDICTED: transcription initiation factor T...    124   5e-31   Calypte anna
gb|KFZ62102.1|  Transcription initiation factor TFIID subunit 12        124   5e-31   Podiceps cristatus
ref|XP_005142495.1|  PREDICTED: transcription initiation factor T...    124   5e-31   Melopsittacus undulatus
gb|EAX07681.1|  TAF12 RNA polymerase II, TATA box binding protein...    125   5e-31   Homo sapiens [man]
ref|XP_007892953.1|  PREDICTED: transcription initiation factor T...    126   5e-31   Callorhinchus milii [Australian ghost shark]
ref|XP_010199699.1|  PREDICTED: transcription initiation factor T...    124   5e-31   Colius striatus
ref|XP_006883493.1|  PREDICTED: transcription initiation factor T...    124   5e-31   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008121977.1|  PREDICTED: transcription initiation factor T...    125   5e-31   Anolis carolinensis [Carolina anole]
ref|XP_001520104.2|  PREDICTED: transcription initiation factor T...    124   6e-31   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_011810900.1|  PREDICTED: transcription initiation factor T...    125   6e-31   Colobus angolensis palliatus
ref|XP_010531871.1|  PREDICTED: transcription initiation factor T...    132   6e-31   Tarenaya hassleriana [spider flower]
ref|XP_010006473.1|  PREDICTED: transcription initiation factor T...    125   6e-31   Chaetura pelagica
ref|XP_003341073.1|  PREDICTED: transcription initiation factor T...    124   6e-31   Monodelphis domestica
ref|XP_004398021.1|  PREDICTED: transcription initiation factor T...    125   6e-31   
ref|XP_002811215.3|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    122   7e-31   
ref|XP_006239129.1|  PREDICTED: transcription initiation factor T...    125   7e-31   Rattus norvegicus [brown rat]
ref|XP_008777545.1|  PREDICTED: transcription initiation factor T...    131   7e-31   Phoenix dactylifera
ref|XP_006934549.1|  PREDICTED: transcription initiation factor T...    125   7e-31   Felis catus [cat]
dbj|BAB28669.1|  unnamed protein product                                124   7e-31   Mus musculus [mouse]
ref|XP_003976007.1|  PREDICTED: transcription initiation factor T...    123   7e-31   Takifugu rubripes [tiger puffer]
gb|KFO37660.1|  Transcription initiation factor TFIID subunit 12        125   8e-31   Fukomys damarensis [Damara mole rat]
ref|XP_005353188.1|  PREDICTED: transcription initiation factor T...    125   8e-31   Microtus ochrogaster [prairie voles]
ref|XP_011810899.1|  PREDICTED: transcription initiation factor T...    125   8e-31   Colobus angolensis palliatus
ref|XP_010979962.1|  PREDICTED: transcription initiation factor T...    125   8e-31   Camelus dromedarius [camel]
ref|XP_006975644.1|  PREDICTED: transcription initiation factor T...    125   8e-31   Peromyscus maniculatus bairdii
ref|XP_004005111.1|  PREDICTED: transcription initiation factor T...    125   8e-31   
ref|XP_002750565.1|  PREDICTED: transcription initiation factor T...    125   8e-31   Callithrix jacchus [common marmoset]
ref|XP_006924396.1|  PREDICTED: transcription initiation factor T...    125   8e-31   
ref|XP_005246035.1|  PREDICTED: transcription initiation factor T...    125   8e-31   
ref|XP_010946253.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    125   9e-31   Camelus bactrianus [camel]
ref|XP_004425896.1|  PREDICTED: transcription initiation factor T...    125   9e-31   
ref|XP_006164631.1|  PREDICTED: transcription initiation factor T...    124   9e-31   Tupaia chinensis
ref|XP_010540091.1|  PREDICTED: transcription initiation factor T...    131   1e-30   Tarenaya hassleriana [spider flower]
gb|EXX73443.1|  Taf12p                                                  129   1e-30   Rhizophagus irregularis DAOM 197198w
ref|XP_010866711.1|  PREDICTED: transcription initiation factor T...    123   1e-30   Esox lucius
ref|XP_010729903.1|  PREDICTED: transcription initiation factor T...    122   1e-30   
ref|XP_008566899.1|  PREDICTED: transcription initiation factor T...    125   1e-30   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008322428.1|  PREDICTED: transcription initiation factor T...    122   1e-30   Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_001135281.1|  transcription initiation factor TFIID subuni...    123   1e-30   Salmo salar
emb|CDQ72656.1|  unnamed protein product                                123   1e-30   Oncorhynchus mykiss
gb|ACM08607.1|  Transcription initiation factor TFIID subunit 12        123   1e-30   Salmo salar
ref|XP_010931213.1|  PREDICTED: transcription initiation factor T...    130   1e-30   Elaeis guineensis
gb|ETE65469.1|  Transcription initiation factor TFIID subunit 12        124   1e-30   Ophiophagus hannah
ref|XP_010322827.1|  PREDICTED: transcription initiation factor T...    127   1e-30   Solanum lycopersicum
ref|XP_008275627.1|  PREDICTED: transcription initiation factor T...    122   1e-30   Stegastes partitus
ref|XP_005795997.1|  PREDICTED: transcription initiation factor T...    122   1e-30   Xiphophorus maculatus
ref|XP_007442020.1|  PREDICTED: transcription initiation factor T...    124   1e-30   
ref|XP_003450546.1|  PREDICTED: transcription initiation factor T...    122   2e-30   Oreochromis niloticus
ref|XP_006112036.1|  PREDICTED: transcription initiation factor T...    124   2e-30   
ref|XP_009903229.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Picoides pubescens
ref|NP_001081155.1|  transcription initiation factor TFIID subuni...    123   2e-30   Xenopus laevis [clawed frog]
emb|CDQ80222.1|  unnamed protein product                                123   2e-30   Oncorhynchus mykiss
ref|XP_008948260.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Merops nubicus
emb|CAF94342.1|  unnamed protein product                                122   2e-30   Tetraodon nigroviridis
ref|XP_005028592.1|  PREDICTED: transcription initiation factor T...    124   2e-30   
ref|XP_010122593.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Chlamydotis macqueenii
ref|XP_009871063.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Apaloderma vittatum
ref|XP_005509737.1|  PREDICTED: transcription initiation factor T...    124   2e-30   
gb|EMS64504.1|  Transcription initiation factor TFIID subunit 12        126   2e-30   Triticum urartu
ref|XP_009563585.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Cuculus canorus
ref|XP_005993184.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Latimeria chalumnae
ref|XP_009509343.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Phalacrocorax carbo [common cormorant]
ref|XP_008920557.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Manacus vitellinus
ref|XP_008566900.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Galeopterus variegatus [Malayan flying lemur]
ref|XP_007064899.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Chelonia mydas [green seaturtle]
ref|XP_009941266.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Opisthocomus hoazin [hoatzin]
ref|XP_006112033.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010140800.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Buceros rhinoceros silvestris
ref|XP_009076113.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Acanthisitta chloris
ref|XP_003212558.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Meleagris gallopavo [common turkey]
ref|XP_010192964.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Mesitornis unicolor
ref|XP_009274456.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Aptenodytes forsteri
ref|XP_009984085.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Tauraco erythrolophus
ref|XP_009486053.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Pelecanus crispus
ref|XP_006267188.1|  PREDICTED: transcription initiation factor T...    124   2e-30   
ref|XP_005286223.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Chrysemys picta bellii
ref|XP_006021946.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Alligator sinensis
ref|XP_005238347.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Falco peregrinus [peregrine]
ref|XP_006880357.1|  PREDICTED: transcription initiation factor T...    122   2e-30   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006899088.1|  PREDICTED: transcription initiation factor T...    122   2e-30   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010299626.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Balearica regulorum gibbericeps
ref|XP_008636293.1|  PREDICTED: transcription initiation factor T...    124   2e-30   Corvus brachyrhynchos
ref|XP_004175841.1|  PREDICTED: transcription initiation factor T...    124   2e-30   
ref|XP_006112034.1|  PREDICTED: transcription initiation factor T...    124   3e-30   
ref|XP_008836859.1|  PREDICTED: transcription initiation factor T...    122   3e-30   
ref|XP_006164629.1|  PREDICTED: transcription initiation factor T...    123   3e-30   
ref|XP_006164630.1|  PREDICTED: transcription initiation factor T...    123   3e-30   
ref|XP_007491538.1|  PREDICTED: transcription initiation factor T...    124   3e-30   
ref|XP_010010156.1|  PREDICTED: transcription initiation factor T...    124   3e-30   
ref|XP_006112035.1|  PREDICTED: transcription initiation factor T...    123   3e-30   
ref|XP_010077538.1|  PREDICTED: transcription initiation factor T...    124   3e-30   
ref|XP_005426959.1|  PREDICTED: transcription initiation factor T...    124   4e-30   
ref|XP_009666080.1|  PREDICTED: transcription initiation factor T...    123   4e-30   
ref|XP_006164628.1|  PREDICTED: transcription initiation factor T...    123   4e-30   
ref|NP_001016168.1|  TAF12 RNA polymerase II, TATA box binding pr...    121   6e-30   
ref|XP_009644115.1|  PREDICTED: transcription initiation factor T...    123   6e-30   
gb|KCW69821.1|  hypothetical protein EUGRSUZ_F03174                     127   7e-30   
ref|XP_005870064.1|  PREDICTED: transcription initiation factor T...    120   1e-29   
gb|EPQ13226.1|  Transcription initiation factor TFIID subunit 12        124   1e-29   
ref|XP_009911859.1|  PREDICTED: transcription initiation factor T...    123   1e-29   
ref|XP_006899213.1|  PREDICTED: transcription initiation factor T...    120   1e-29   
ref|XP_009804793.1|  PREDICTED: transcription initiation factor T...    122   1e-29   
ref|NP_001154103.1|  transcription initiation factor TFIID subuni...    120   2e-29   
ref|XP_006087724.1|  PREDICTED: transcription initiation factor T...    119   3e-29   
emb|CCJ28334.1|  unnamed protein product                                124   5e-29   
gb|EPS69927.1|  hypothetical protein M569_04832                         124   5e-29   
ref|XP_001622758.1|  predicted protein                                  117   5e-29   
dbj|BAJ99471.1|  predicted protein                                      124   6e-29   
gb|EKC37361.1|  Transcription initiation factor TFIID subunit 12        119   6e-29   
gb|EMT25142.1|  Transcription initiation factor TFIID subunit 12        124   6e-29   
ref|XP_007413481.1|  hypothetical protein MELLADRAFT_38078              117   6e-29   
ref|XP_011414310.1|  PREDICTED: transcription initiation factor T...    118   7e-29   
gb|KFV77686.1|  Transcription initiation factor TFIID subunit 12        118   1e-28   
ref|XP_006645003.1|  PREDICTED: transcription initiation factor T...    123   1e-28   
gb|ELR52715.1|  Transcription initiation factor TFIID subunit 12        117   1e-28   
ref|XP_002130711.1|  PREDICTED: transcription initiation factor T...    120   1e-28   
gb|ELR59072.1|  hypothetical protein M91_11796                          117   1e-28   
ref|XP_009149193.1|  PREDICTED: transcription initiation factor T...    125   1e-28   
ref|XP_788876.3|  PREDICTED: transcription initiation factor TFII...    120   1e-28   
emb|CDY26245.1|  BnaA06g11720D                                          125   1e-28   
ref|XP_004362266.1|  hypothetical protein DFA_06565                     122   2e-28   
ref|XP_007875314.1|  hypothetical protein PNEG_03247                    122   2e-28   
ref|XP_003564602.1|  PREDICTED: transcription initiation factor T...    123   2e-28   
ref|XP_010232557.1|  PREDICTED: transcription initiation factor T...    123   2e-28   
ref|XP_005985575.1|  PREDICTED: transcription initiation factor T...    117   2e-28   
ref|XP_010232558.1|  PREDICTED: transcription initiation factor T...    122   3e-28   
gb|EFB27223.1|  hypothetical protein PANDA_001204                       117   3e-28   
ref|XP_011837126.1|  PREDICTED: transcription initiation factor T...    117   3e-28   
ref|NP_564023.1|  transcription initiation factor TFIID subunit 12B     124   3e-28   
sp|B2C6R6.1|TAFCL_ARATH  RecName: Full=Transcription initiation f...    124   3e-28   
ref|XP_002892951.1|  hypothetical protein ARALYDRAFT_471949             124   4e-28   
gb|EOA95034.1|  Transcription initiation factor TFIID subunit 12        115   6e-28   
ref|XP_005627713.1|  PREDICTED: transcription initiation factor T...    116   6e-28   
ref|XP_010459334.1|  PREDICTED: transcription initiation factor T...    123   7e-28   
ref|XP_010459332.1|  PREDICTED: transcription initiation factor T...    123   8e-28   
ref|XP_006306911.1|  hypothetical protein CARUB_v10008470mg             123   9e-28   
ref|XP_011352343.1|  PREDICTED: transcription initiation factor T...    116   9e-28   
ref|XP_006887109.1|  PREDICTED: transcription initiation factor T...    115   1e-27   
ref|XP_010498093.1|  PREDICTED: transcription initiation factor T...    122   1e-27   
gb|EAY76482.1|  hypothetical protein OsI_04423                          121   1e-27   
gb|EAZ14140.1|  hypothetical protein OsJ_04067                          121   1e-27   
ref|NP_001044793.1|  Os01g0846900                                       121   1e-27   
ref|XP_010498091.1|  PREDICTED: transcription initiation factor T...    122   1e-27   
ref|XP_010476894.1|  PREDICTED: transcription initiation factor T...    122   1e-27   
ref|XP_010476893.1|  PREDICTED: transcription initiation factor T...    122   2e-27   
ref|NP_001169752.1|  transcription associated factor1 isoform 1         120   2e-27   
ref|XP_008673220.1|  PREDICTED: transcription associated factor1 ...    120   2e-27   
ref|XP_002458756.1|  hypothetical protein SORBIDRAFT_03g039720          120   2e-27   
dbj|BAE24124.1|  unnamed protein product                                115   2e-27   
ref|XP_006108477.1|  PREDICTED: transcription initiation factor T...    114   2e-27   
ref|XP_006108476.1|  PREDICTED: transcription initiation factor T...    114   2e-27   
gb|ELV12557.1|  Transcription initiation factor TFIID subunit 12        115   2e-27   
ref|XP_009971653.1|  PREDICTED: transcription initiation factor T...    115   3e-27   
ref|XP_009064287.1|  hypothetical protein LOTGIDRAFT_58640              113   3e-27   
ref|XP_006107464.1|  PREDICTED: transcription initiation factor T...    114   4e-27   
ref|XP_004328406.1|  PREDICTED: transcription initiation factor T...    114   4e-27   
ref|XP_005058469.1|  PREDICTED: transcription initiation factor T...    115   4e-27   
ref|XP_006107245.1|  PREDICTED: transcription initiation factor T...    114   4e-27   
gb|KHN39636.1|  Transcription initiation factor TFIID subunit 12        117   5e-27   
ref|XP_011616212.1|  PREDICTED: transcription initiation factor T...    114   6e-27   
gb|EHB02222.1|  Transcription initiation factor TFIID subunit 12        113   7e-27   
ref|XP_006108434.1|  PREDICTED: transcription initiation factor T...    112   8e-27   
gb|ELT91102.1|  hypothetical protein CAPTEDRAFT_162600                  114   9e-27   
ref|XP_011308510.1|  PREDICTED: transcription initiation factor T...    113   9e-27   
ref|XP_008777554.1|  PREDICTED: transcription initiation factor T...    119   9e-27   
gb|ACN34223.1|  unknown                                                 118   1e-26   
gb|AFW84606.1|  hypothetical protein ZEAMMB73_782872                    118   1e-26   
ref|XP_011308509.1|  PREDICTED: transcription initiation factor T...    113   1e-26   
ref|XP_011352340.1|  PREDICTED: transcription initiation factor T...    114   1e-26   
ref|XP_005395018.1|  PREDICTED: transcription initiation factor T...    113   2e-26   
ref|XP_004970563.1|  PREDICTED: histone-lysine N-methyltransferas...    118   2e-26   
ref|XP_003307308.1|  hypothetical protein PGTG_00258                    119   2e-26   
gb|EHJ76209.1|  transcription initiation factor TFIID subunit 12        112   2e-26   
gb|EPY87942.1|  hypothetical protein CB1_000207004                      116   3e-26   
ref|XP_011262024.1|  PREDICTED: transcription initiation factor T...    112   4e-26   
ref|XP_005101363.1|  PREDICTED: transcription initiation factor T...    112   4e-26   
ref|XP_011642148.1|  PREDICTED: transcription initiation factor T...    112   5e-26   
gb|KHG30829.1|  Taf12                                                   115   5e-26   
ref|XP_393786.2|  PREDICTED: transcription initiation factor TFII...    110   7e-26   
ref|XP_003702466.1|  PREDICTED: transcription initiation factor T...    111   7e-26   
ref|XP_011167526.1|  PREDICTED: transcription initiation factor T...    111   7e-26   
gb|KDR22629.1|  Transcription initiation factor TFIID subunit 12        113   8e-26   
ref|XP_002299594.1|  transcription initiation factor IID subunit ...    117   8e-26   
ref|XP_011695764.1|  PREDICTED: transcription initiation factor T...    111   9e-26   
gb|KHG30830.1|  Taf12                                                   115   9e-26   
ref|XP_011496429.1|  PREDICTED: transcription initiation factor T...    110   1e-25   
ref|XP_011560050.1|  PREDICTED: transcription initiation factor T...    110   1e-25   
ref|XP_001605166.2|  PREDICTED: transcription initiation factor T...    110   2e-25   
ref|XP_003571319.1|  PREDICTED: transcription initiation factor T...    114   2e-25   
ref|XP_003289125.1|  hypothetical protein DICPUDRAFT_11975              107   2e-25   
ref|NP_001040422.1|  transcription initiation factor TFIID subuni...    110   2e-25   
ref|XP_011862583.1|  PREDICTED: transcription initiation factor T...    110   2e-25   
ref|XP_011064144.1|  PREDICTED: transcription initiation factor T...    109   3e-25   
ref|XP_501393.1|  YALI0C03333p                                          115   3e-25   
dbj|GAA95086.1|  hypothetical protein E5Q_01741                         114   3e-25   
ref|XP_008674803.1|  PREDICTED: transcription initiation factor T...    113   4e-25   
ref|XP_003698472.1|  PREDICTED: transcription initiation factor T...    108   4e-25   
ref|XP_006416703.1|  hypothetical protein EUTSA_v10006997mg             115   4e-25   
ref|XP_003398968.1|  PREDICTED: transcription initiation factor T...    109   5e-25   
ref|XP_003485527.1|  PREDICTED: transcription initiation factor T...    109   5e-25   
ref|XP_008518343.1|  PREDICTED: transcription initiation factor T...    109   5e-25   
ref|XP_012054563.1|  PREDICTED: transcription initiation factor T...    108   6e-25   
ref|XP_011142742.1|  PREDICTED: transcription initiation factor T...    109   7e-25   
ref|XP_002173661.2|  transcription factor TFIID complex subunit A...    112   7e-25   
ref|XP_002117109.1|  hypothetical protein TRIADDRAFT_31979              105   2e-24   
emb|CDY48302.1|  BnaC05g13560D                                          112   2e-24   
gb|KEI38104.1|  hypothetical protein L969DRAFT_51607                    112   2e-24   
emb|CCU98041.1|  unnamed protein product                                112   3e-24   
gb|AAF79486.1|AC022492_30  F1L3.13                                      112   4e-24   
emb|CDS12919.1|  hypothetical protein LRAMOSA05103                      108   5e-24   
gb|AAF97312.1|AC007843_15  Unknown protein                              112   5e-24   
emb|CDH55731.1|  transcription initiation factor tfiid subunit12        108   7e-24   
gb|KFM83097.1|  Transcription initiation factor TFIID subunit 12        105   1e-23   
ref|XP_005004312.1|  PREDICTED: transcription initiation factor T...    103   1e-23   
ref|XP_011291397.1|  PREDICTED: transcription initiation factor T...    104   2e-23   
ref|XP_001646091.1|  hypothetical protein Kpol_543p63                   110   2e-23   
ref|XP_008034494.1|  hypothetical protein TRAVEDRAFT_142011             106   2e-23   
ref|XP_009117660.1|  PREDICTED: transcription initiation factor T...    109   2e-23   
ref|XP_008808551.1|  PREDICTED: transcription initiation factor T...    108   2e-23   
ref|XP_010411021.1|  PREDICTED: transcription initiation factor T...    103   2e-23   
ref|XP_005529903.1|  PREDICTED: transcription initiation factor T...    103   3e-23   
ref|XP_005180880.1|  PREDICTED: transcription initiation factor T...    103   3e-23   
ref|XP_001731859.1|  hypothetical protein MGL_1127                      109   3e-23   
ref|XP_008808550.1|  PREDICTED: transcription initiation factor T...    108   3e-23   
ref|XP_009267138.1|  Transcription initiation factor TFIID subuni...    107   4e-23   
emb|CDY21749.1|  BnaA09g45000D                                          108   5e-23   
emb|CDX81826.1|  BnaC08g37750D                                          108   6e-23   
gb|AJU62847.1|  Taf12p                                                  107   6e-23   
gb|AJU88641.1|  Taf12p                                                  107   6e-23   
gb|AHY75134.1|  Taf12p                                                  107   6e-23   
gb|AJU87938.1|  Taf12p                                                  107   6e-23   
gb|AJU73412.1|  Taf12p                                                  107   7e-23   
gb|AJU61437.1|  Taf12p                                                  107   7e-23   
gb|AJU60087.1|  Taf12p                                                  107   7e-23   
gb|AJU59372.1|  Taf12p                                                  107   7e-23   
gb|EDV08164.1|  transcription initiation factor TFIID subunit 12        107   7e-23   
gb|EHN08123.1|  Taf12p                                                  107   7e-23   
gb|AJU99945.1|  Taf12p                                                  107   7e-23   
gb|AJP37863.1|  Taf12p                                                  107   7e-23   
ref|NP_010429.1|  Taf12p                                                107   7e-23   
gb|AJU67061.1|  Taf12p                                                  107   7e-23   
emb|CAY78650.1|  Taf12p                                                 107   7e-23   
gb|AJU57984.1|  Taf12p                                                  107   7e-23   
gb|AJU97837.1|  Taf12p                                                  107   7e-23   
gb|AJU66383.1|  Taf12p                                                  107   7e-23   
gb|AJU62150.1|  Taf12p                                                  107   7e-23   
dbj|GAA22377.1|  K7_Taf12p                                              107   7e-23   
gb|AJU81110.1|  Taf12p                                                  107   7e-23   
gb|AJV02789.1|  Taf12p                                                  107   7e-23   
gb|AJU70590.1|  Taf12p                                                  107   7e-23   
gb|AJV13178.1|  Taf12p                                                  107   7e-23   
gb|AJU90044.1|  Taf12p                                                  107   7e-23   
gb|AJU89332.1|  Taf12p                                                  107   7e-23   
gb|AJV04876.1|  Taf12p                                                  107   7e-23   
gb|EIW11351.1|  Taf12p                                                  107   7e-23   
gb|AJU58679.1|  Taf12p                                                  107   7e-23   
gb|AJU67776.1|  Taf12p                                                  107   7e-23   
gb|AJU83793.1|  Taf12p                                                  107   7e-23   
gb|AJV03458.1|  Taf12p                                                  107   7e-23   
gb|AJU90762.1|  Taf12p                                                  107   7e-23   
gb|AJV15265.1|  Taf12p                                                  107   7e-23   
gb|AJV04164.1|  Taf12p                                                  107   7e-23   
gb|AJV01370.1|  Taf12p                                                  107   7e-23   
gb|AJV07002.1|  Taf12p                                                  107   7e-23   
gb|AJV13888.1|  Taf12p                                                  107   7e-23   
gb|AJV11841.1|  Taf12p                                                  108   7e-23   
gb|AJU65664.1|  Taf12p                                                  107   7e-23   
gb|EWG87188.1|  Taf12p                                                  107   7e-23   
gb|ACO12075.1|  Transcription initiation factor TFIID subunit 12        103   8e-23   
gb|AJU69881.1|  Taf12p                                                  107   8e-23   
gb|AJU95729.1|  Taf12p                                                  107   8e-23   
gb|EEU09318.1|  Taf12p                                                  107   8e-23   
gb|EDN60485.1|  TFIID subunit                                           107   8e-23   
gb|AJU64237.1|  Taf12p                                                  107   8e-23   
emb|CEG73314.1|  Putative Genomic scaffold, msy_sf_3                    105   9e-23   
ref|XP_011185570.1|  PREDICTED: transcription initiation factor T...    102   9e-23   
ref|XP_644047.2|  transcription initiation factor TFIID subunit         108   9e-23   
emb|CEI88957.1|  Putative Genomic scaffold, msy_sf_3                    105   9e-23   
ref|XP_003356301.2|  PREDICTED: transcription initiation factor T...    103   9e-23   
ref|XP_007864125.1|  hypothetical protein GLOTRDRAFT_73406              105   9e-23   
ref|XP_011211192.1|  PREDICTED: transcription initiation factor T...    102   1e-22   
gb|ERE85929.1|  transcription initiation factor TFIID subunit 12-...    102   1e-22   
gb|EGA87546.1|  Taf12p                                                  107   1e-22   
emb|CDR38473.1|  CYFA0S02e02058g1_1                                     108   1e-22   
ref|XP_011273759.1|  Transcription initiation factor TFIID subuni...    108   1e-22   
gb|EWG97107.1|  Taf12p                                                  107   1e-22   
ref|XP_007307971.1|  hypothetical protein STEHIDRAFT_149170             105   1e-22   
ref|XP_004536981.1|  PREDICTED: transcription initiation factor T...    102   1e-22   
ref|XP_003800830.1|  PREDICTED: transcription initiation factor T...    100   2e-22   
emb|CDO77103.1|  hypothetical protein BN946_scf184501.g8                104   2e-22   
ref|XP_008836932.1|  PREDICTED: transcription initiation factor T...    100   2e-22   
ref|XP_002430999.1|  transcription initiation factor TFIID subuni...    103   2e-22   
gb|KII92417.1|  hypothetical protein PLICRDRAFT_89019                   104   2e-22   
ref|XP_011185567.1|  PREDICTED: transcription initiation factor T...    102   2e-22   
ref|XP_009547393.1|  hypothetical protein HETIRDRAFT_320855             104   2e-22   
ref|XP_011211191.1|  PREDICTED: transcription initiation factor T...    102   2e-22   
gb|KDN47324.1|  hypothetical protein K437DRAFT_267867                   107   2e-22   
ref|XP_004536979.1|  PREDICTED: transcription initiation factor T...    102   2e-22   
ref|XP_003956003.1|  hypothetical protein KAFR_0B05720                  105   3e-22   
ref|XP_003683673.1|  hypothetical protein TPHA_0A01560                  106   3e-22   
gb|EGA59396.1|  Taf12p                                                  106   3e-22   
gb|KIJ39473.1|  hypothetical protein M422DRAFT_32720                    104   3e-22   
gb|ESW97494.1|  Transcription initiation factor TFIID subunit 12        105   4e-22   
ref|XP_007362102.1|  hypothetical protein DICSQDRAFT_50676              103   4e-22   
gb|EFA85008.1|  hypothetical protein PPL_02002                          105   4e-22   
gb|EMD33607.1|  hypothetical protein CERSUDRAFT_117708                  103   4e-22   



>ref|XP_009621483.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Nicotiana tomentosiformis]
Length=540

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +  ETEEPC RILSKRSIQE++ QIDP  KLDAEVED+LVDIA+EFVES+TTFGCSL
Sbjct  387  SKVTTLETEEPCTRILSKRSIQEILAQIDPSEKLDAEVEDVLVDIAEEFVESITTFGCSL  446

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER+WN+TLP FSGDEIRTYKKP TSDIH+ER+AAIK+S +  
Sbjct  447  AKHRKSNTLEAKDILLHLERNWNMTLPGFSGDEIRTYKKPFTSDIHKERIAAIKKSGLVA  506

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAKT  373
            + TN K +   GG  K   L KG  NIL SPNAKT
Sbjct  507  EMTNAKGSAQAGGGMKGH-LAKGAANILGSPNAKT  540



>ref|XP_009621482.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Nicotiana tomentosiformis]
Length=573

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +  ETEEPC RILSKRSIQE++ QIDP  KLDAEVED+LVDIA+EFVES+TTFGCSL
Sbjct  420  SKVTTLETEEPCTRILSKRSIQEILAQIDPSEKLDAEVEDVLVDIAEEFVESITTFGCSL  479

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER+WN+TLP FSGDEIRTYKKP TSDIH+ER+AAIK+S +  
Sbjct  480  AKHRKSNTLEAKDILLHLERNWNMTLPGFSGDEIRTYKKPFTSDIHKERIAAIKKSGLVA  539

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAKT  373
            + TN K +   GG  K   L KG  NIL SPNAKT
Sbjct  540  EMTNAKGSAQAGGGMKGH-LAKGAANILGSPNAKT  573



>ref|XP_009796566.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Nicotiana 
sylvestris]
Length=547

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +  E EEPC RILSKRSIQE++TQIDP  KLDAEVED+LVDIA+EFVES+TTFGCSL
Sbjct  394  SKATTLEMEEPCTRILSKRSIQEILTQIDPSEKLDAEVEDVLVDIAEEFVESITTFGCSL  453

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER+WN+TLP FSGDEIRTYKKP  SDIH+ER+AAIK+S++A 
Sbjct  454  AKHRKSNTLEAKDILLHLERNWNMTLPGFSGDEIRTYKKPFISDIHKERIAAIKKSALAA  513

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAKT  373
            + TN K +   GG  K   L KG  NIL SP+AKT
Sbjct  514  EMTNAKGSAQAGGGMKGH-LAKGAANILGSPDAKT  547



>ref|XP_004246524.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Solanum 
lycopersicum]
Length=566

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -3

Query  819  ETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKS  640
            E  +PC RILSKRSIQE+VTQIDP  KLDAEVEDILVDIA+EFVES+TTFGCSLAKHRKS
Sbjct  419  EMGDPCTRILSKRSIQEIVTQIDPSEKLDAEVEDILVDIAEEFVESITTFGCSLAKHRKS  478

Query  639  STLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTK  460
            +TLEAKDILLH ER+WN+TLP F GDEIR YKKPLTSDIH+ER+AAIK+S++  + TN K
Sbjct  479  NTLEAKDILLHLERNWNMTLPGFGGDEIRAYKKPLTSDIHKERIAAIKKSTLVAEMTNAK  538

Query  459  SAVGQGGNSKTTPLGKGPINILTSPNAKT  373
                 GGN K+  L K   NI+ SPNAKT
Sbjct  539  GPTQTGGNMKSH-LAKNAANIMGSPNAKT  566



>ref|XP_006341120.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Solanum tuberosum]
Length=561

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = -3

Query  819  ETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKS  640
            E  +PC RILSKRSIQE+VTQIDP  KLDAEVEDILVDIA+EFVES+TTFGCSLAKHRKS
Sbjct  414  EMGDPCTRILSKRSIQEIVTQIDPSEKLDAEVEDILVDIAEEFVESITTFGCSLAKHRKS  473

Query  639  STLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTK  460
            +TLEAKDILLH ER+WN+TLP F GDEIR YKKPLTSDIH+ER+A IK+S++  + TN K
Sbjct  474  NTLEAKDILLHLERNWNMTLPGFGGDEIRAYKKPLTSDIHKERIAVIKKSTLVAEMTNAK  533

Query  459  SAVGQGGNSKTTPLGKGPINILTSPNAKT  373
                 GGN K+  L K   NIL SPNAKT
Sbjct  534  GPTQTGGNMKSH-LAKSAANILGSPNAKT  561



>emb|CBI30264.3| unnamed protein product [Vitis vinifera]
Length=372

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            ++T++AE  E  NRILSKRSI ELV QIDP  KLD EVEDILVDIA++FVES+TTFGCSL
Sbjct  214  SRTASAEASESGNRILSKRSIHELVNQIDPSEKLDPEVEDILVDIAEDFVESITTFGCSL  273

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH ER+WN+TLP F GDEI+T+KKP  SDIH+ERLAAIK+S+V  
Sbjct  274  AKHRKSPTLEAKDILLHLERNWNMTLPGFGGDEIKTFKKPFVSDIHKERLAAIKKSAVGT  333

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPINILTSPNAK  376
            ++ NTKS+ GQG GN+K  P  K   N+L+SPN K
Sbjct  334  ESANTKSSSGQGAGNTKGHP-AKTSANVLSSPNLK  367



>ref|XP_010654342.1| PREDICTED: transcription initiation factor TFIID subunit 12, 
partial [Vitis vinifera]
Length=495

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            ++T++AE  E  NRILSKRSI ELV QIDP  KLD EVEDILVDIA++FVES+TTFGCSL
Sbjct  337  SRTASAEASESGNRILSKRSIHELVNQIDPSEKLDPEVEDILVDIAEDFVESITTFGCSL  396

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH ER+WN+TLP F GDEI+T+KKP  SDIH+ERLAAIK+S+V  
Sbjct  397  AKHRKSPTLEAKDILLHLERNWNMTLPGFGGDEIKTFKKPFVSDIHKERLAAIKKSAVGT  456

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPINILTSPNAK  376
            ++ NTKS+ GQG GN+K  P  K   N+L+SPN K
Sbjct  457  ESANTKSSSGQGAGNTKGHP-AKTSANVLSSPNLK  490



>ref|XP_007203746.1| hypothetical protein PRUPE_ppa017159mg [Prunus persica]
 gb|EMJ04945.1| hypothetical protein PRUPE_ppa017159mg [Prunus persica]
Length=509

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NK+++AET+E CNRILSKRSI ELV QIDP  KLD EVEDIL+DIADEFVES+TTF CSL
Sbjct  347  NKSASAETDESCNRILSKRSIHELVNQIDPSEKLDPEVEDILMDIADEFVESITTFSCSL  406

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH E++WNITLP F GDEI+ ++KPLT+DIH+ERL+ IK+S VA 
Sbjct  407  AKHRKSTTLEAKDILLHIEKNWNITLPGFGGDEIKGFRKPLTNDIHKERLSVIKKSIVAT  466

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPINILTSPNAK  376
            +T N +S+ GQ  GN+K + L K P N+++S N K
Sbjct  467  ETANARSSTGQATGNAKGS-LVKAPANVISSQNTK  500



>emb|CDP15396.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   216 bits (549),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N+  +AE EE CNRILSKRSIQELV+ +D   KLD EVEDILVDIA++FV+S+TTFGCSL
Sbjct  405  NRAPSAEPEESCNRILSKRSIQELVSHVDASEKLDPEVEDILVDIAEDFVDSITTFGCSL  464

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER+WN TLP FSGDEI+TYKKP TSDIHRERLA IK+S +A 
Sbjct  465  AKHRKSATLEAKDILLHLERNWNTTLPGFSGDEIKTYKKPFTSDIHRERLAVIKKSVLAG  524

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            +T N++S+ GQ G      L KGP +I+ SP  K
Sbjct  525  ETLNSRSSAGQAGGHPKGHLAKGPTSIVGSPPDK  558



>ref|XP_008241261.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Prunus 
mume]
 ref|XP_008241262.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Prunus 
mume]
Length=578

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NKT++AET+E CNRILSKRSI ELV QIDP  KLD EVEDIL+DIADEFVES+TTF CSL
Sbjct  420  NKTASAETDESCNRILSKRSIHELVNQIDPSEKLDPEVEDILMDIADEFVESITTFSCSL  479

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH E++WNITLP F GDEI+ ++KPL++DIH+ERL+ IK+S VA 
Sbjct  480  AKHRKSTTLEAKDILLHIEKNWNITLPGFGGDEIKGFRKPLSNDIHKERLSVIKKSIVAT  539

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPINILTSPNAK  376
            +T N +S+ GQ  GN+K + L K P N+++S N K
Sbjct  540  ETANARSSTGQATGNAKGS-LVKAPANVISSQNTK  573



>ref|XP_002528715.1| protein with unknown function [Ricinus communis]
 gb|EEF33627.1| protein with unknown function [Ricinus communis]
Length=451

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N+T+  E++E  NRILSKR+I ELVTQIDP  KLD EVEDIL DIADEFVES+TTFGCSL
Sbjct  297  NRTAIPESDESGNRILSKRNIHELVTQIDPSEKLDPEVEDILADIADEFVESITTFGCSL  356

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH ER+WN+TL  FSGDEI+TY+KPLTSDIH+ERLA IK+S +A 
Sbjct  357  AKHRKSDTLEAKDILLHLERNWNMTLTGFSGDEIKTYRKPLTSDIHKERLAVIKKSILAS  416

Query  477  KTTNTKSAVGQ-GGNSKTTPLGKGPINILTSPNAK  376
               + KS+VGQ  GN+K+  L + P N + SPN K
Sbjct  417  DMASAKSSVGQAAGNAKSN-LTRTPANAMISPNLK  450



>ref|XP_012066476.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Jatropha 
curcas]
 gb|KDP42726.1| hypothetical protein JCGZ_23666 [Jatropha curcas]
Length=535

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            +T+  E+EE  NRILSKRSI ELV+QIDP  KLD EVEDIL DIADEFVES+TTFGCSLA
Sbjct  378  RTTNMESEESGNRILSKRSIHELVSQIDPSEKLDPEVEDILADIADEFVESITTFGCSLA  437

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNITLP FSGDEI+TY+KPLTSDIH+ERL  IK+S +A +
Sbjct  438  KHRKSDTLEAKDILLHLERNWNITLPGFSGDEIKTYRKPLTSDIHKERLGVIKKSILASE  497

Query  474  TTNTKSAVGQ-GGNSKTTPLGKGPINILTSPNAKT  373
              N K++ GQ  GN+K+  L K P N + +PN KT
Sbjct  498  IGNVKNSGGQTTGNAKSN-LTKTPANAVPTPNLKT  531



>ref|XP_008355631.1| PREDICTED: transcription initiation factor TFIID subunit 12-like, 
partial [Malus domestica]
Length=238

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NKT + E +E CNRIL KRSI+ELV QIDP   LD EVE+IL+DIADEFV+S+TTF CSL
Sbjct  80   NKTLSPEXDESCNRILGKRSIRELVNQIDPSEXLDPEVEEILMDIADEFVDSITTFSCSL  139

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+ LEAKDILLH E++WNITLP F GDEI+ ++KPLT+DIH+ERLA IK+S VA 
Sbjct  140  AKHRKSTQLEAKDILLHIEKNWNITLPGFGGDEIKGFRKPLTNDIHKERLAVIKKSIVAT  199

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            +T N ++  GQ   +    L K P NI++S N+K
Sbjct  200  ETANARNPTGQAAGNAKGSLVKTPANIISSLNSK  233



>gb|KCW48340.1| hypothetical protein EUGRSUZ_K02056 [Eucalyptus grandis]
Length=533

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            K + + ++E CNRILSKRSI ELV QIDP  KLD EVEDILVDIA+EFVES+T FGCSLA
Sbjct  380  KIAGSGSDESCNRILSKRSIHELVNQIDPSEKLDPEVEDILVDIAEEFVESITAFGCSLA  439

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS++LEAKDILLH ER+WNI LP FS DE+++Y+KP+T+DIH+ERLA IKRS+V  +
Sbjct  440  KHRKSTSLEAKDILLHLERNWNIALPGFSADEVKSYRKPVTNDIHKERLAVIKRSAVVSE  499

Query  474  TTNTKSAVGQGGNSKTTPLGKGPINILTSPNAKT  373
              N ++A GQ  +S    LGK   N+L SPN K+
Sbjct  500  VVNARNAPGQVASSAKGTLGKAAANVLGSPNLKS  533



>ref|XP_010036709.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Eucalyptus 
grandis]
 gb|KCW48339.1| hypothetical protein EUGRSUZ_K02056 [Eucalyptus grandis]
Length=549

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            K + + ++E CNRILSKRSI ELV QIDP  KLD EVEDILVDIA+EFVES+T FGCSLA
Sbjct  396  KIAGSGSDESCNRILSKRSIHELVNQIDPSEKLDPEVEDILVDIAEEFVESITAFGCSLA  455

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS++LEAKDILLH ER+WNI LP FS DE+++Y+KP+T+DIH+ERLA IKRS+V  +
Sbjct  456  KHRKSTSLEAKDILLHLERNWNIALPGFSADEVKSYRKPVTNDIHKERLAVIKRSAVVSE  515

Query  474  TTNTKSAVGQGGNSKTTPLGKGPINILTSPNAKT  373
              N ++A GQ  +S    LGK   N+L SPN K+
Sbjct  516  VVNARNAPGQVASSAKGTLGKAAANVLGSPNLKS  549



>ref|XP_011094374.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Sesamum 
indicum]
Length=494

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +KT+  +TEE  NRI+SKRSIQELV QIDP  KLD EVEDILV+IA++FVES+TTFGCSL
Sbjct  336  SKTAITDTEESSNRIVSKRSIQELVNQIDPSEKLDPEVEDILVEIAEDFVESITTFGCSL  395

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER+WN+TLP F GDEI+TYKKP+ SDIHRERLAAIK+S VA 
Sbjct  396  AKHRKSTTLEAKDILLHLERNWNMTLPGFGGDEIKTYKKPIVSDIHRERLAAIKKSIVAT  455

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSP  385
                       GGN+K   L KGP +I+ SP
Sbjct  456  DMVTKNPGGPSGGNAKGH-LAKGPASIIGSP  485



>ref|XP_004305348.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=538

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N+ ++AETEEP NRILSKR+I ELV QIDP  +LD +VEDIL+DIADEFVES+TTF CSL
Sbjct  381  NRITSAETEEPGNRILSKRTIHELVNQIDPSERLDPDVEDILMDIADEFVESITTFSCSL  440

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH E++WNITLP F GDEI+ Y+KP+T+DIH+ RLAAIK+S VA 
Sbjct  441  AKHRKSTTLEAKDILLHLEKNWNITLPGFGGDEIKGYRKPITNDIHKGRLAAIKKSMVAT  500

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPINI  397
            +T NT+++ GQ  GN+K   L K P+NI
Sbjct  501  ETANTRNSAGQATGNAKGG-LVKVPVNI  527



>ref|XP_011466777.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=541

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N+ ++AETEEP NRILSKR+I ELV QIDP  +LD +VEDIL+DIADEFVES+TTF CSL
Sbjct  384  NRITSAETEEPGNRILSKRTIHELVNQIDPSERLDPDVEDILMDIADEFVESITTFSCSL  443

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH E++WNITLP F GDEI+ Y+KP+T+DIH+ RLAAIK+S VA 
Sbjct  444  AKHRKSTTLEAKDILLHLEKNWNITLPGFGGDEIKGYRKPITNDIHKGRLAAIKKSMVAT  503

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPINI  397
            +T NT+++ GQ  GN+K   L K P+NI
Sbjct  504  ETANTRNSAGQATGNAKGG-LVKVPVNI  530



>ref|XP_009366650.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pyrus x bretschneideri]
Length=512

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NKT + ET+E CNRIL KRSI+ELV QIDP  KLD EVE+IL+DIADEFV+S+TTF CSL
Sbjct  354  NKTLSPETDESCNRILGKRSIRELVNQIDPSEKLDPEVEEILMDIADEFVDSITTFSCSL  413

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+ LEAKDILLH E++WNITLP F GDEI+ +KKPLT+DIH+ERLA IK+S VA 
Sbjct  414  AKHRKSTQLEAKDILLHIEKNWNITLPGFGGDEIKGFKKPLTNDIHKERLAVIKKSIVAT  473

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            +T N ++  GQ   +    L K P NI++S N+K
Sbjct  474  ETANARNPTGQAAGNAKGGLIKTPANIISSQNSK  507



>ref|XP_009366648.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009366649.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pyrus x bretschneideri]
Length=567

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NKT + ET+E CNRIL KRSI+ELV QIDP  KLD EVE+IL+DIADEFV+S+TTF CSL
Sbjct  409  NKTLSPETDESCNRILGKRSIRELVNQIDPSEKLDPEVEEILMDIADEFVDSITTFSCSL  468

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+ LEAKDILLH E++WNITLP F GDEI+ +KKPLT+DIH+ERLA IK+S VA 
Sbjct  469  AKHRKSTQLEAKDILLHIEKNWNITLPGFGGDEIKGFKKPLTNDIHKERLAVIKKSIVAT  528

Query  477  KTTNTKSAVGQ-GGNSKTTPLGKGPINILTSPNAK  376
            +T N ++  GQ  GN+K   L K P NI++S N+K
Sbjct  529  ETANARNPTGQAAGNAKGG-LIKTPANIISSQNSK  562



>ref|XP_009374742.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Pyrus x bretschneideri]
Length=592

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 124/155 (80%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NKT + ET+E CNRIL KRSI+ELV QIDP  KLD EVE+IL+D+ADEFV+S+TTF CSL
Sbjct  434  NKTPSPETDESCNRILGKRSIRELVNQIDPSEKLDPEVEEILMDVADEFVDSITTFSCSL  493

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+ LEAKDILLH E++WNITLP F GDEI+ ++KPLT+D+H+ERLA IK+S VA 
Sbjct  494  AKHRKSTQLEAKDILLHIEKNWNITLPGFGGDEIKGFRKPLTNDMHKERLAVIKKSIVAT  553

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPINILTSPNAK  376
            +T N ++  GQ  GN+K   L K P NI+ S N+K
Sbjct  554  ETANARNPTGQATGNAKGG-LVKTPANIILSQNSK  587



>ref|XP_010101595.1| Transcription initiation factor TFIID subunit 12 [Morus notabilis]
 gb|EXB88734.1| Transcription initiation factor TFIID subunit 12 [Morus notabilis]
Length=603

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N+ S AET+E CNRILSKRSI ELV+Q+DP  KLD EVEDIL+DIAD+FVES+TTFGCSL
Sbjct  419  NRISTAETDESCNRILSKRSIHELVSQVDPSEKLDPEVEDILMDIADDFVESITTFGCSL  478

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER+WNITLP F GDEI++++KP+ +DIH ERL AIK+S +  
Sbjct  479  AKHRKSTTLEAKDILLHLERNWNITLPGFGGDEIKSFRKPVVNDIHMERLVAIKKSMLTT  538

Query  477  KTTNTKSAVGQ-GGNSK  430
            +T NT++  GQ  GN+K
Sbjct  539  ETANTRNPSGQAAGNAK  555



>ref|XP_007027689.1| Transcription initiation factor TFIID subunit 12, putative isoform 
1 [Theobroma cacao]
 ref|XP_007027690.1| Transcription initiation factor TFIID subunit 12, putative isoform 
1 [Theobroma cacao]
 gb|EOY08191.1| Transcription initiation factor TFIID subunit 12, putative isoform 
1 [Theobroma cacao]
 gb|EOY08192.1| Transcription initiation factor TFIID subunit 12, putative isoform 
1 [Theobroma cacao]
Length=560

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NK +  E++E   RILSKRS+ +LV QIDP  KLD EVEDILVDIA++FV+S+TTFGCSL
Sbjct  402  NKAAITESDESGGRILSKRSVHDLVNQIDPSEKLDPEVEDILVDIAEDFVDSITTFGCSL  461

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH ER+W++TLP F GDEI+TY+KPLT++IH+ERLAAIK+S +  
Sbjct  462  AKHRKSDTLEAKDILLHLERNWHMTLPGFCGDEIKTYRKPLTNEIHKERLAAIKKSILVT  521

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            + TNTK   GQ   +    LGK   NIL SPN K
Sbjct  522  EATNTKHFGGQAAVNAKGNLGKAAANILGSPNVK  555



>ref|XP_008462670.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Cucumis 
melo]
Length=486

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            AE EEPC+RILSKRSI +LV QIDP  +LD EVEDILVD+A+EFVES+TTFGCSLAKHRK
Sbjct  346  AEMEEPCSRILSKRSIGKLVNQIDPSERLDPEVEDILVDLAEEFVESITTFGCSLAKHRK  405

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S+TLEAKDILLH E++WN+TLP F  DEI+ ++KPLT+D HRERLAA+K+S VA +  +T
Sbjct  406  STTLEAKDILLHLEKNWNLTLPGFGSDEIKIFRKPLTNDTHRERLAAVKKSIVASEMAST  465

Query  462  KSAVGQ-GGNSKTT  424
            +S+ GQ  GN+K++
Sbjct  466  RSSAGQAAGNTKSS  479



>gb|KHG00576.1| Transcription initiation factor TFIID subunit 12 [Gossypium arboreum]
Length=518

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NK +  E+++   RILSKRSI ++V QIDP  KLD EVEDILVDIA++FV+S+TTFGCSL
Sbjct  360  NKAAITESDDSGGRILSKRSIHDIVNQIDPSEKLDPEVEDILVDIAEDFVDSITTFGCSL  419

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH ER+WN+TLP FSGDEI+TYKKPLT+++H+ERLA IK+S +A 
Sbjct  420  AKHRKSDTLEAKDILLHLERNWNMTLPGFSGDEIKTYKKPLTNEVHKERLAVIKKSILAS  479

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            +  N K  +GQ   +    +GK   NIL SPN K
Sbjct  480  EAANAKHIIGQTAVNTKGNVGKVAANILGSPNVK  513



>gb|KJB15070.1| hypothetical protein B456_002G158700 [Gossypium raimondii]
 gb|KJB15071.1| hypothetical protein B456_002G158700 [Gossypium raimondii]
Length=518

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NK +  E+++   RILSKRSI ++V QIDP  KLD EVEDILVDIA++FV+S+TTFGCSL
Sbjct  360  NKAAITESDDSGGRILSKRSIHDIVNQIDPSEKLDPEVEDILVDIAEDFVDSITTFGCSL  419

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH ER+WN+TLP FSGDEI+TYKKP+T+++H+ERLA IK+S +A 
Sbjct  420  AKHRKSDTLEAKDILLHLERNWNMTLPGFSGDEIKTYKKPITNEVHKERLAVIKKSILAR  479

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            +  N K  +GQ   +    +GK   NIL SPN K
Sbjct  480  EAANAKHIIGQTAVNTKGNVGKVAANILGSPNVK  513



>ref|XP_011657696.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Cucumis sativus]
Length=468

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            AE EEPC+RILSKRSI +LV QIDP  +LD EVEDILVD+A+EFVES+TTFGCSLAKHRK
Sbjct  328  AEMEEPCSRILSKRSIGKLVNQIDPSERLDPEVEDILVDLAEEFVESITTFGCSLAKHRK  387

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S+TLEAKDILLH E++WN+TLP F  DEI+ ++KPLT+D HRER+AA+K+S VA +  +T
Sbjct  388  STTLEAKDILLHLEKNWNLTLPGFGSDEIKIFRKPLTNDTHRERVAAVKKSIVASEMAST  447

Query  462  KSAVGQ-GGNSKTT  424
            +S+ GQ  GN+K++
Sbjct  448  RSSAGQAAGNTKSS  461



>ref|XP_011657695.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Cucumis sativus]
 gb|KGN48255.1| hypothetical protein Csa_6G452070 [Cucumis sativus]
Length=511

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            AE EEPC+RILSKRSI +LV QIDP  +LD EVEDILVD+A+EFVES+TTFGCSLAKHRK
Sbjct  371  AEMEEPCSRILSKRSIGKLVNQIDPSERLDPEVEDILVDLAEEFVESITTFGCSLAKHRK  430

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S+TLEAKDILLH E++WN+TLP F  DEI+ ++KPLT+D HRER+AA+K+S VA +  +T
Sbjct  431  STTLEAKDILLHLEKNWNLTLPGFGSDEIKIFRKPLTNDTHRERVAAVKKSIVASEMAST  490

Query  462  KSAVGQ-GGNSKTT  424
            +S+ GQ  GN+K++
Sbjct  491  RSSAGQAAGNTKSS  504



>ref|XP_007027691.1| Transcription initiation factor TFIID subunit 12, putative isoform 
3 [Theobroma cacao]
 gb|EOY08193.1| Transcription initiation factor TFIID subunit 12, putative isoform 
3 [Theobroma cacao]
Length=561

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQ-IDPPGKLDAEVEDILVDIADEFVESLTTFGCS  661
            NK +  E++E   RILSKRS+ +LV Q IDP  KLD EVEDILVDIA++FV+S+TTFGCS
Sbjct  402  NKAAITESDESGGRILSKRSVHDLVNQQIDPSEKLDPEVEDILVDIAEDFVDSITTFGCS  461

Query  660  LAKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVA  481
            LAKHRKS TLEAKDILLH ER+W++TLP F GDEI+TY+KPLT++IH+ERLAAIK+S + 
Sbjct  462  LAKHRKSDTLEAKDILLHLERNWHMTLPGFCGDEIKTYRKPLTNEIHKERLAAIKKSILV  521

Query  480  VKTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
             + TNTK   GQ   +    LGK   NIL SPN K
Sbjct  522  TEATNTKHFGGQAAVNAKGNLGKAAANILGSPNVK  556



>ref|XP_006481807.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Citrus sinensis]
Length=538

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +A E++E  NRIL+KRSIQELV QI P  +LD +VEDILVDIA++FVES+TTFGCSL
Sbjct  388  SKIAATESDEFGNRILTKRSIQELVNQIGPSERLDPDVEDILVDIAEDFVESITTFGCSL  447

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDIL+H ER+WN+TLP FSGDEI+T++KPL  DIH+ERLAAIK+S +A 
Sbjct  448  AKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPLVCDIHKERLAAIKKSVMAT  507

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTS  388
            +  + ++  GQ   S    LGK P NI+ S
Sbjct  508  EVASARTTGGQAAASAKGNLGKMPANIIGS  537



>ref|XP_008467013.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 12-like, partial [Cucumis melo]
Length=321

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = -3

Query  819  ETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKS  640
            E EEPC+RILSKRSI +LV QI+P  +LD EVEDILVD+A+EFVES+TTFGCSLAKHRKS
Sbjct  182  EMEEPCSRILSKRSIGKLVNQINPSERLDPEVEDILVDLAEEFVESITTFGCSLAKHRKS  241

Query  639  STLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTK  460
            +TLEAKDILLH E++WN+TLP F  DEI+ ++KPL +D HRERLAA K+S VA +  +T+
Sbjct  242  TTLEAKDILLHLEKNWNLTLPGFGSDEIKIFRKPLINDTHRERLAAXKKSIVASEMASTR  301

Query  459  SAVGQ-GGNSKTTPLGKGP  406
            S+ GQ  GN+K++ L K P
Sbjct  302  SSAGQAAGNTKSS-LTKTP  319



>gb|KDO61101.1| hypothetical protein CISIN_1g009336mg [Citrus sinensis]
 gb|KDO61102.1| hypothetical protein CISIN_1g009336mg [Citrus sinensis]
 gb|KDO61103.1| hypothetical protein CISIN_1g009336mg [Citrus sinensis]
Length=537

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +  E++E  NRIL+KRSIQELV QIDP  +LD +VEDILVDIA++FVES+T FGCSL
Sbjct  387  SKIAGTESDEFGNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSL  446

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDIL+H ER+WN+TLP FSGDEI+T++KPL  DIH+ERLAAIK+S +A 
Sbjct  447  AKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPLVCDIHKERLAAIKKSVMAT  506

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTS  388
            +  + ++  GQ   S    LGK P NI+ S
Sbjct  507  EVASARTTGGQAAASAKGNLGKMPANIIGS  536



>ref|XP_006430244.1| hypothetical protein CICLE_v10011440mg [Citrus clementina]
 gb|ESR43484.1| hypothetical protein CICLE_v10011440mg [Citrus clementina]
Length=537

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +  E++E  NRIL+KRSIQELV QIDP  +LD +VEDILVDIA++FVES+T FGCSL
Sbjct  387  SKIAGTESDEFGNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSL  446

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDIL+H ER+WN+TLP FSGDEI+T++KPL  DIH+ERLAAIK+S +A 
Sbjct  447  AKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPLVCDIHKERLAAIKKSVMAT  506

Query  477  KTTNTKSAVGQGGNSKTTPLGKGPINILTS  388
            +  + ++  GQ   S    LGK P NI+ S
Sbjct  507  EVASARTTGGQTAASAKGNLGKMPANIIGS  536



>ref|XP_010543485.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Tarenaya hassleriana]
Length=536

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            AE EE  +RIL KRSI+EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLAKHRK
Sbjct  386  AENEESGDRILGKRSIRELIQQIDPSEKLDPEVEDILADIAEDFVESITTFGCSLAKHRK  445

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S TLEAKDILLH ER+WNI  P F GDEI+T++KPLT+DIH+ERLAA+K+S +A +  N 
Sbjct  446  SDTLEAKDILLHVERNWNIRPPGFCGDEIKTFRKPLTTDIHKERLAAVKKSMIATEVANA  505

Query  462  KSA-VGQGGNSKTTPLGKGPINILTSP  385
            ++  +GQG  +      K P N L SP
Sbjct  506  RNPIIGQGAVNAKGGQAKAPANPLASP  532



>ref|XP_010486588.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Camelina 
sativa]
Length=535

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 112/149 (75%), Gaps = 6/149 (4%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            K  +AE E   +RIL KRSI EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLA
Sbjct  389  KIVSAENEASDDRILGKRSIHELLQQIDPSEKLDPEVEDILADIAEDFVESITTFGCSLA  448

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DE +T++KPLT+DIH+ERLAAIK+S +A +
Sbjct  449  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTADIHKERLAAIKKSVIATE  508

Query  474  TTNTKSAVGQGGNSKTTPLGKGPINILTS  388
              N + + G+GG +KT      P N L S
Sbjct  509  AANARISYGRGGQAKT------PANPLAS  531



>ref|XP_007145316.1| hypothetical protein PHAVU_007G228800g [Phaseolus vulgaris]
 gb|ESW17310.1| hypothetical protein PHAVU_007G228800g [Phaseolus vulgaris]
Length=506

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -3

Query  819  ETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKS  640
            +TEE CN ILSKRSI ELV Q+DP  KLD EV DILVDIA+ F+ES+   GCSLAKHRKS
Sbjct  357  DTEESCNSILSKRSIHELVNQVDPLEKLDPEVADILVDIAENFLESIIRSGCSLAKHRKS  416

Query  639  STLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTK  460
            +TLEAKDILLH E++WN+TLP F GDEI++Y++ +TSDIH+ERL+AIK+S  A +  + K
Sbjct  417  TTLEAKDILLHLEKNWNMTLPGFGGDEIKSYRRQITSDIHKERLSAIKKSMTATELAHAK  476

Query  459  SAVGQGGNSKTTPLGKGPINILTSPNAK  376
             + GQ   S      K P+NI+ SPN K
Sbjct  477  GSAGQASGSAKGNQAKTPMNIIGSPNLK  504



>ref|XP_010480364.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Camelina 
sativa]
Length=536

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 6/146 (4%)
 Frame = -3

Query  825  AAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHR  646
            +AE E   +RIL KRSI EL+ QIDP  KLD EVEDIL DIA++FVES+TTF CSLAKHR
Sbjct  393  SAENEASDDRILGKRSIHELLQQIDPSEKLDPEVEDILADIAEDFVESITTFSCSLAKHR  452

Query  645  KSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTN  466
            KS TLEAKDILLH ER+WNI  P FS DE +T++KPLT+DIH+ERLAAIK+S  A +  N
Sbjct  453  KSDTLEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTTDIHKERLAAIKKSVTATEAAN  512

Query  465  TKSAVGQGGNSKTTPLGKGPINILTS  388
             ++A G+GG +KT      P N L S
Sbjct  513  ARNAFGRGGQAKT------PANPLAS  532



>ref|XP_003542594.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Glycine max]
Length=507

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            ++T+E  N ILSKRSI ELV Q+DP  KL+ EV DILVDIA+ F+ES+T  GCSLAKHRK
Sbjct  357  SDTDESSNSILSKRSIHELVNQVDPLEKLEPEVADILVDIAENFLESITRSGCSLAKHRK  416

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S+TLE+KDILLH E++WN+TLP F GDEI++Y++P+TSDIH+ERLA IK+S  + +  + 
Sbjct  417  STTLESKDILLHLEKNWNMTLPGFGGDEIKSYRRPITSDIHKERLAVIKKSMASTEAAHG  476

Query  462  KSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            K + GQ   S     GK P+NI+ SPN K
Sbjct  477  KGSAGQASGSAKGNQGKTPLNIIGSPNLK  505



>ref|XP_011019889.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Populus 
euphratica]
 ref|XP_011019890.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Populus 
euphratica]
Length=502

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N  + AE++E  NRILSKRSI ELV+QIDP  K + EV +IL DIADEF+ S+TTFGCSL
Sbjct  347  NSIANAESDESGNRILSKRSIHELVSQIDPSEKFNPEVVEILADIADEFLVSVTTFGCSL  406

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH +R+WN+TLP F GDEI++Y+K +T+DIH+ERLAAIK+S +A 
Sbjct  407  AKHRKSDTLEAKDILLHLDRNWNMTLPGFCGDEIKSYRKQITNDIHKERLAAIKKSILAS  466

Query  477  KTTNTKSAVGQ-GGNSKTTPLGKGPINILTSPNAK  376
            +  N K+ VGQ  GN+K++   K   N + SPN K
Sbjct  467  EMANAKNTVGQAAGNAKSS-TTKTLSNPIVSPNLK  500



>ref|XP_006407609.1| hypothetical protein EUTSA_v10020482mg [Eutrema salsugineum]
 gb|ESQ49062.1| hypothetical protein EUTSA_v10020482mg [Eutrema salsugineum]
Length=535

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            KT +AE EE  +RIL KRSI EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLA
Sbjct  384  KTVSAENEESDDRILGKRSIHELLQQIDPSEKLDPEVEDILADIAEDFVESITTFGCSLA  443

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DEI+T++KPLT+DIH+ERLAAIK+S  A +
Sbjct  444  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEIKTFRKPLTTDIHKERLAAIKKSVTATE  503

Query  474  TTNTKSAVG  448
              N ++  G
Sbjct  504  AANARNPFG  512



>ref|XP_002308150.1| transcription initiation factor IID subunit A family protein 
[Populus trichocarpa]
 gb|EEE91673.1| transcription initiation factor IID subunit A family protein 
[Populus trichocarpa]
Length=497

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N  + AE++E  NRILSKRSI ELV+QIDP  K + EV +IL DIADEF+ S+TTFGCSL
Sbjct  342  NSIANAESDESGNRILSKRSIHELVSQIDPSEKFNPEVVEILADIADEFLVSVTTFGCSL  401

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS TLEAKDILLH +R+WN+TLP F GDEI++Y+K +T+DIH+ERLAAIK+S +  
Sbjct  402  AKHRKSDTLEAKDILLHLDRNWNMTLPGFCGDEIKSYRKQVTNDIHKERLAAIKKSILTS  461

Query  477  KTTNTKSAVGQ-GGNSKTTPLGKGPINILTSPNAK  376
            +  N K++VGQ  GN+K++   K   N + SPN K
Sbjct  462  EMANAKNSVGQAAGNAKSS-TTKTLSNPIVSPNLK  495



>ref|XP_006297380.1| hypothetical protein CARUB_v10013405mg [Capsella rubella]
 gb|EOA30278.1| hypothetical protein CARUB_v10013405mg [Capsella rubella]
Length=539

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            KT +AE E   +RIL KRSI EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLA
Sbjct  387  KTVSAEIEASDDRILGKRSIHELLQQIDPSEKLDPEVEDILADIAEDFVESITTFGCSLA  446

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DE +T++KPLT+DIH+ERLA IK+S +A +
Sbjct  447  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTTDIHKERLATIKKSVMATE  506

Query  474  TTNTKSAVGQGGNSKTTPLGKGPINILTS  388
              N +++ G G  +      K P N L S
Sbjct  507  AANARNSFGHGTANARGGQAKTPANPLAS  535



>ref|XP_010464667.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Camelina sativa]
Length=541

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            K  +AE E   +RIL KRSI EL+ QIDP  KLD EVEDIL DIA++F+ES+TTF CSLA
Sbjct  395  KIVSAEIEASDDRILGKRSIHELLQQIDPSEKLDPEVEDILADIAEDFLESITTFSCSLA  454

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DE +T++KPLT+DIH+ERLAAIK+S    +
Sbjct  455  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTTDIHKERLAAIKKSVTVTE  514

Query  474  TTNTKSAVGQGGNSKTTPLGKGPINILTS  388
              N ++A G+GG +KT      P N L S
Sbjct  515  AANARNAFGRGGQAKT------PANPLAS  537



>ref|XP_002884775.1| tata-associated factor II 58 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61034.1| tata-associated factor II 58 [Arabidopsis lyrata subsp. lyrata]
Length=541

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 111/148 (75%), Gaps = 8/148 (5%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            KT +AE E   +RIL KRSI EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLA
Sbjct  388  KTVSAENETSDDRILGKRSIHELLQQIDPSEKLDPEVEDILADIAEDFVESITTFGCSLA  447

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DE +T++KPLT+DIH+ERLAAIK+S  A +
Sbjct  448  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTTDIHKERLAAIKKSVTATE  507

Query  474  TTNTKSAVG------QGGNSKT--TPLG  415
              + ++  G      +GG SKT   PLG
Sbjct  508  AASARNQFGHGTANARGGQSKTPSNPLG  535



>ref|NP_566367.1| TBP-associated factor 12 [Arabidopsis thaliana]
 sp|Q9SR71.1|TAF12_ARATH RecName: Full=Transcription initiation factor TFIID subunit 12; 
AltName: Full=TBP-associated factor 12; Short=AtTAF12 [Arabidopsis 
thaliana]
 gb|AAF04417.1|AC010927_10 unknown protein [Arabidopsis thaliana]
 gb|AAK28289.1|AF344878_1 putative TBP-associated 58 kDa subunit protein [Arabidopsis thaliana]
 gb|AAR28015.1| TAF12 [Arabidopsis thaliana]
 dbj|BAD95394.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74856.1| TBP-associated factor 12 [Arabidopsis thaliana]
Length=539

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 8/148 (5%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            KT +AETE   +RIL KRSI EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLA
Sbjct  386  KTVSAETEPSDDRILGKRSIHELLQQIDPSEKLDPEVEDILSDIAEDFVESITTFGCSLA  445

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS  LEAKDILLH ER+WNI  P FS DE +T++KPLT+DIH+ERLAAIK+S  A +
Sbjct  446  KHRKSDILEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTTDIHKERLAAIKKSVTATE  505

Query  474  TTNTKSAVG------QGGNSKT--TPLG  415
              N ++  G      +GG +KT   P+G
Sbjct  506  AANARNQFGHGTANARGGQAKTPSNPMG  533



>ref|XP_010695518.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=345

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            + T+AAE  E C+ ILSKR+IQELV QIDP  +L+ EVED+LVDIA++F++S+TTFGCSL
Sbjct  198  DNTNAAEVSEHCSTILSKRNIQELVNQIDPSERLNPEVEDVLVDIAEDFIDSVTTFGCSL  257

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER WN+ LP FSGDEI+TYKKP+ +D+H+ERL+ IK+S    
Sbjct  258  AKHRKSNTLEAKDILLHLERTWNMALPGFSGDEIKTYKKPVVNDVHKERLSLIKKSLAGA  317

Query  477  KTTNTKSAVGQG-GNSK  430
               N  SA G   GN K
Sbjct  318  D--NKASAAGPATGNIK  332



>gb|KEH42051.1| transcription initiation factor TFIID subunit 12 [Medicago truncatula]
Length=515

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A+ EE    +LSKRSI ELV Q+DP  KLD EV DIL DIA+ F+ES+   GCSLAKHRK
Sbjct  365  ADIEESGKSVLSKRSIHELVHQVDPLEKLDPEVADILGDIAENFLESIIRSGCSLAKHRK  424

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S+TLEAKD+LLH E++WNITLP F GDEI+ Y+KPL++DIH+ERLAAIK+S +A +  + 
Sbjct  425  STTLEAKDVLLHLEKNWNITLPGFGGDEIKNYRKPLSTDIHKERLAAIKKSMIATEAAHP  484

Query  462  KSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            K + GQ   S      K P N+L SPN K
Sbjct  485  KGSAGQASGSAKGSQAKIPFNVLGSPNLK  513



>ref|XP_004516193.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X1 [Cicer arietinum]
 ref|XP_004516194.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X2 [Cicer arietinum]
Length=523

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A+TEE    +LSKRSI ELV Q+DP  KLD EV D+L DIA+ F++S+   GCSLAKHRK
Sbjct  373  ADTEESGKSVLSKRSIHELVNQVDPLEKLDPEVADVLGDIAENFLDSIIRSGCSLAKHRK  432

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S+TLEAKD+LLH E++WN+TLP F G+EI+ Y+KP+ SDIH+ERLAAIK+S VA +  ++
Sbjct  433  STTLEAKDVLLHLEKNWNMTLPGFGGEEIKNYRKPVPSDIHKERLAAIKKSMVATEVAHS  492

Query  462  KSAVGQGGNSKTTPLGKGPINILTSPNAKT  373
            K   GQ   S      K P N++ SPN K+
Sbjct  493  KGTAGQASGSAKGGQAKTPFNVIGSPNLKS  522



>ref|XP_007027692.1| Transcription initiation factor TFIID subunit 12, putative isoform 
4 [Theobroma cacao]
 gb|EOY08194.1| Transcription initiation factor TFIID subunit 12, putative isoform 
4 [Theobroma cacao]
Length=603

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 120/197 (61%), Gaps = 43/197 (22%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            NK +  E++E   RILSKRS+ +LV QIDP  KLD EVEDILVDIA++FV+S+TTFGCSL
Sbjct  402  NKAAITESDESGGRILSKRSVHDLVNQIDPSEKLDPEVEDILVDIAEDFVDSITTFGCSL  461

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKP--------------------  538
            AKHRKS TLEAKDILLH ER+W++TLP F GDEI+TY+KP                    
Sbjct  462  AKHRKSDTLEAKDILLHLERNWHMTLPGFCGDEIKTYRKPVKCSLLSIVHTGDVGCAVVC  521

Query  537  -----------------------LTSDIHRERLAAIKRSSVAVKTTNTKSAVGQGGNSKT  427
                                   LT++IH+ERLAAIK+S +  + TNTK   GQ   +  
Sbjct  522  KRNLTVVDLDLQLFLIVALLVMQLTNEIHKERLAAIKKSILVTEATNTKHFGGQAAVNAK  581

Query  426  TPLGKGPINILTSPNAK  376
              LGK   NIL SPN K
Sbjct  582  GNLGKAAANILGSPNVK  598



>gb|KFK38391.1| hypothetical protein AALP_AA3G107300 [Arabis alpina]
Length=531

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            K  + E EE   R+L KRSI EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLA
Sbjct  378  KPVSVENEESDGRVLGKRSIHELLQQIDPTEKLDPEVEDILADIAEDFVESITTFGCSLA  437

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DEI+T++KP+T++IH+ERLAAIK+S    +
Sbjct  438  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEIKTFRKPVTTEIHKERLAAIKKSVAVTE  497

Query  474  TTNTKSAVGQGGNSKTTPLGKGPINILTS  388
              N ++  G G  +      K P N L S
Sbjct  498  AANARNPYGHGMANARGGQAKTPANHLAS  526



>ref|XP_009146875.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Brassica 
rapa]
Length=527

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 8/151 (5%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            KT +AE EE  +RIL KRSI E++ QIDP  KLD EVE IL DIA++FVES+TTFGCSLA
Sbjct  378  KTVSAENEESDDRILGKRSIHEILQQIDPSEKLDPEVEGILADIAEDFVESITTFGCSLA  437

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DEI+T++KP+T+DIH++RLAA+K+S    +
Sbjct  438  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEIKTFRKPVTTDIHKDRLAAVKKSMTVTE  497

Query  474  TTNTK--SAVGQGGNSKTTPLGKGPINILTS  388
              N +  +A  +GG +KT      P N L S
Sbjct  498  AANARFGTANARGGQAKT------PANPLAS  522



>emb|CDY60164.1| BnaAnng16580D [Brassica napus]
Length=527

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 8/151 (5%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            KT +AE EE  +RIL KRSI E++ QIDP  KLD EVE IL DIA++FVES+TTFGCSLA
Sbjct  378  KTVSAENEESDDRILGKRSIHEILQQIDPSEKLDPEVEGILADIAEDFVESITTFGCSLA  437

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DEI+T++KP+T+DIH++RLAA+K+S    +
Sbjct  438  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEIKTFRKPVTTDIHKDRLAAVKKSMTVTE  497

Query  474  TTNTK--SAVGQGGNSKTTPLGKGPINILTS  388
              N +  +A  +GG +KT      P N L S
Sbjct  498  AANARFGTANARGGQAKT------PANPLAS  522



>ref|XP_010695517.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=536

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            + T+AAE  E C+ ILSKR+IQELV QIDP  +L+ EVED+LVDIA++F++S+TTFGCSL
Sbjct  389  DNTNAAEVSEHCSTILSKRNIQELVNQIDPSERLNPEVEDVLVDIAEDFIDSVTTFGCSL  448

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER WN+ LP FSGDEI+TYKKP+ +D+H+ERL+ IK+S    
Sbjct  449  AKHRKSNTLEAKDILLHLERTWNMALPGFSGDEIKTYKKPVVNDVHKERLSLIKKSLAGA  508

Query  477  KTTNTKSAVGQG-GNSK  430
               N  SA G   GN K
Sbjct  509  D--NKASAAGPATGNIK  523



>ref|XP_010695516.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=563

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            + T+AAE  E C+ ILSKR+IQELV QIDP  +L+ EVED+LVDIA++F++S+TTFGCSL
Sbjct  416  DNTNAAEVSEHCSTILSKRNIQELVNQIDPSERLNPEVEDVLVDIAEDFIDSVTTFGCSL  475

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDILLH ER WN+ LP FSGDEI+TYKKP+ +D+H+ERL+ IK+S    
Sbjct  476  AKHRKSNTLEAKDILLHLERTWNMALPGFSGDEIKTYKKPVVNDVHKERLSLIKKSLAGA  535

Query  477  KTTNTKSAVGQG-GNSK  430
               N  SA G   GN K
Sbjct  536  D--NKASAAGPATGNIK  550



>ref|XP_006645050.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Oryza brachyantha]
Length=308

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            NR+LSKRSI EL+ QIDP  KLD EVEDIL+DIA++FVES+ TF CSLAKHRKSSTLEAK
Sbjct  174  NRLLSKRSIHELLAQIDPSEKLDPEVEDILIDIAEDFVESVATFACSLAKHRKSSTLEAK  233

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            D+LLHAER WNITLP FSGDEI+ YKKP  +DIHRERL  IK+S
Sbjct  234  DVLLHAERSWNITLPGFSGDEIKLYKKPHVNDIHRERLTLIKKS  277



>emb|CDY00904.1| BnaC05g42960D [Brassica napus]
Length=527

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 10/153 (7%)
 Frame = -3

Query  834  KTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLA  655
            KT + E EE  +RIL KRSI EL+ QIDP  KLD EVE IL DIA++FVES+TTFGCSLA
Sbjct  376  KTVSTENEESDDRILGKRSIHELLQQIDPSEKLDPEVEGILADIAEDFVESITTFGCSLA  435

Query  654  KHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK  475
            KHRKS TLEAKDILLH ER+WNI  P FS DEI+T++KP+T+DIH++RLAA+K+S    +
Sbjct  436  KHRKSDTLEAKDILLHVERNWNIRPPGFSSDEIKTFRKPVTTDIHKDRLAAVKKSMTVTE  495

Query  474  TTNTK----SAVGQGGNSKTTPLGKGPINILTS  388
              N +    +A  +GG +KT      P N L S
Sbjct  496  AANARFGHGTANARGGQAKT------PANPLAS  522



>ref|XP_003537062.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Glycine max]
Length=507

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -3

Query  819  ETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKS  640
            +T+E  N ILSKRSI ELV Q+DP  KL+ EV DILVDIA+ F+ES+T  GCSLAKHRKS
Sbjct  358  DTDESSNSILSKRSIHELVNQVDPLEKLEPEVADILVDIAENFLESITRSGCSLAKHRKS  417

Query  639  STLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTK  460
            +TLEAKDILLH E++WN+TL  F GD+I++Y++P TSDIH+ERL  IK+S  A +  + K
Sbjct  418  TTLEAKDILLHLEKNWNMTLLGFGGDDIKSYRRPTTSDIHKERLTVIKKSMAATEAAHGK  477

Query  459  SAVGQGGNSKTTPLGKGPINILTSPNAK  376
             + GQ   S     GK P+NI+  PN K
Sbjct  478  GSAGQASGSAKGNQGKTPLNIIGLPNLK  505



>ref|XP_010271709.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010271711.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Nelumbo nucifera]
Length=558

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 107/137 (78%), Gaps = 1/137 (1%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            N TS A+  E C++ILSKR+I ELVTQIDP  +LD EVE+ILV+IAD+FV+++ T  CSL
Sbjct  404  NTTSNADAGEICSKILSKRTIHELVTQIDPSERLDPEVEEILVEIADDFVDTIATCACSL  463

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAV  478
            AKHRKS+TLEAKDI+LH E++WN+TLP F GDEI+ YKK  T+DIHRERLA IK+S V  
Sbjct  464  AKHRKSTTLEAKDIILHLEKNWNLTLPGFGGDEIKIYKKQYTNDIHRERLAVIKKSVVGS  523

Query  477  KTTNTKSAVGQ-GGNSK  430
            +  N K+  GQ  GN K
Sbjct  524  EVANMKTPAGQAAGNVK  540



>ref|NP_001044860.1| Os01g0858500 [Oryza sativa Japonica Group]
 dbj|BAF06774.1| Os01g0858500 [Oryza sativa Japonica Group]
 gb|EEE55703.1| hypothetical protein OsJ_04136 [Oryza sativa Japonica Group]
Length=301

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            NR+LSKRSI ELV QIDP  KLD EVED+L+DIA++FVES+ TF CSLAKHRKSS LEAK
Sbjct  167  NRLLSKRSIHELVAQIDPSEKLDPEVEDVLIDIAEDFVESVATFACSLAKHRKSSILEAK  226

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            D+LLHAER WNITLP FSGDEI+ YKKP  +DIHRERL  IK+S
Sbjct  227  DVLLHAERSWNITLPGFSGDEIKLYKKPHVNDIHRERLTLIKKS  270



>dbj|BAD82054.1| transcription initiation factor IID (TFIID) subunit A-like protein 
[Oryza sativa Japonica Group]
Length=295

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            NR+LSKRSI ELV QIDP  KLD EVED+L+DIA++FVES+ TF CSLAKHRKSS LEAK
Sbjct  161  NRLLSKRSIHELVAQIDPSEKLDPEVEDVLIDIAEDFVESVATFACSLAKHRKSSILEAK  220

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            D+LLHAER WNITLP FSGDEI+ YKKP  +DIHRERL  IK+S
Sbjct  221  DVLLHAERSWNITLPGFSGDEIKLYKKPHVNDIHRERLTLIKKS  264



>gb|KDO61104.1| hypothetical protein CISIN_1g009336mg [Citrus sinensis]
Length=529

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +  E++E  NRIL+KRSIQELV QIDP  +LD +VEDILVDIA++FVES+T FGCSL
Sbjct  387  SKIAGTESDEFGNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSL  446

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAI  499
            AKHRKS TLEAKDIL+H ER+WN+TLP FSGDEI+T++KPL  DIH+ERLAA+
Sbjct  447  AKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPLVCDIHKERLAAV  499



>ref|XP_010910328.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Elaeis guineensis]
Length=510

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 9/138 (7%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N+ILSKRS++ELV QIDP  KLD+EVED+LV++A++F+ES+TTF CSLAKHRKSSTL
Sbjct  366  ESGNQILSKRSLRELVAQIDPSEKLDSEVEDVLVEVAEDFIESVTTFACSLAKHRKSSTL  425

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTKSAV  451
            EAKDILLH ER+WN+TLP FSGDEI+ YKK  T+DIH+ERLA IK+S V           
Sbjct  426  EAKDILLHVERNWNMTLPGFSGDEIKCYKKQFTNDIHKERLAVIKKSMV---------GT  476

Query  450  GQGGNSKTTPLGKGPINI  397
               GN+K    G+   N+
Sbjct  477  SDAGNAKNPAAGQAASNL  494



>gb|EEC71841.1| hypothetical protein OsI_04504 [Oryza sativa Indica Group]
Length=494

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            NR+LSKRSI ELV QIDP  KLD EVED+L+DIA++FVES+ TF CSLAKHRKSS LEAK
Sbjct  360  NRLLSKRSIHELVAQIDPSEKLDPEVEDVLIDIAEDFVESVATFACSLAKHRKSSILEAK  419

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            D+LLHAER WNITLP FSGDEI+ YKKP  +DIHRERL  IK+S
Sbjct  420  DVLLHAERSWNITLPGFSGDEIKLYKKPHVNDIHRERLTLIKKS  463



>gb|EMS49133.1| Transcription initiation factor TFIID subunit 12 [Triticum urartu]
Length=397

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A + E  NR+LSKRSI +L+ QIDP  +LD +VED+L+DIA++F+ES+ TF CSLAKHRK
Sbjct  256  AASGESSNRLLSKRSIHDLLAQIDPSERLDPDVEDVLIDIAEDFIESVGTFACSLAKHRK  315

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVA---VKT  472
            S+TLEAKD+LLHAER WNITLP F+GDEI+ YKKP  +DIHRERL  IK+S  +   +KT
Sbjct  316  STTLEAKDVLLHAERSWNITLPGFTGDEIKLYKKPHVNDIHRERLTLIKKSMASEGNIKT  375

Query  471  TNTKSAVGQGGNSKTTPLGKGP  406
            +  +S   Q   +   P    P
Sbjct  376  SAAQSTANQKNQAPKPPATGSP  397



>ref|XP_010910326.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Elaeis guineensis]
Length=566

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 9/138 (7%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N+ILSKRS++ELV QIDP  KLD+EVED+LV++A++F+ES+TTF CSLAKHRKSSTL
Sbjct  422  ESGNQILSKRSLRELVAQIDPSEKLDSEVEDVLVEVAEDFIESVTTFACSLAKHRKSSTL  481

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTKSAV  451
            EAKDILLH ER+WN+TLP FSGDEI+ YKK  T+DIH+ERLA IK+S V           
Sbjct  482  EAKDILLHVERNWNMTLPGFSGDEIKCYKKQFTNDIHKERLAVIKKSMVGTS--------  533

Query  450  GQGGNSKTTPLGKGPINI  397
               GN+K    G+   N+
Sbjct  534  -DAGNAKNPAAGQAASNL  550



>ref|XP_002975297.1| hypothetical protein SELMODRAFT_6783, partial [Selaginella moellendorffii]
 ref|XP_002993081.1| hypothetical protein SELMODRAFT_6778, partial [Selaginella moellendorffii]
 gb|EFJ05829.1| hypothetical protein SELMODRAFT_6778, partial [Selaginella moellendorffii]
 gb|EFJ23498.1| hypothetical protein SELMODRAFT_6783, partial [Selaginella moellendorffii]
Length=118

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            EP NRIL KRSIQELVTQ+D   KL+ EVED L++IAD+F+E++TTF C+LAKHRKS+ L
Sbjct  12   EPTNRILGKRSIQELVTQVDAKEKLEPEVEDALLEIADDFIETVTTFACALAKHRKSTVL  71

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            EAKD+LLH ER+W ITLP F G+E RTYKKP+ SD+H++RLA IK+S
Sbjct  72   EAKDVLLHLERNWRITLPGFGGEEYRTYKKPVASDVHKQRLAVIKKS  118



>tpg|DAA56738.1| TPA: hypothetical protein ZEAMMB73_736720 [Zea mays]
Length=434

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E   R+L+KRSI ELV QIDP  KLD EVED+L+DIA++FVES+TTF CSLAKHRK
Sbjct  295  ANASETGTRLLTKRSIHELVAQIDPNEKLDPEVEDVLIDIAEDFVESVTTFACSLAKHRK  354

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            SSTLEAKD+LLHAER WNITLP FSGDEI+ YKK   +DIHRERLA IK+S
Sbjct  355  SSTLEAKDVLLHAERSWNITLPGFSGDEIKLYKKQHINDIHRERLALIKKS  405



>ref|XP_008674801.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Zea mays]
 tpg|DAA56737.1| TPA: hypothetical protein ZEAMMB73_736720 [Zea mays]
Length=487

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E   R+L+KRSI ELV QIDP  KLD EVED+L+DIA++FVES+TTF CSLAKHRK
Sbjct  348  ANASETGTRLLTKRSIHELVAQIDPNEKLDPEVEDVLIDIAEDFVESVTTFACSLAKHRK  407

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            SSTLEAKD+LLHAER WNITLP FSGDEI+ YKK   +DIHRERLA IK+S
Sbjct  408  SSTLEAKDVLLHAERSWNITLPGFSGDEIKLYKKQHINDIHRERLALIKKS  458



>ref|XP_003564657.2| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X3 [Brachypodium distachyon]
Length=446

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E  NR+LSKRSI EL+ QIDP  +LD EVED+L+DIA++F+E++ TF CSLAKHRK
Sbjct  305  AAAGESSNRLLSKRSIHELLAQIDPSERLDPEVEDVLIDIAEDFIENVGTFACSLAKHRK  364

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTT  469
            SSTLEAKD+LLHAER WNITLP F+GDEI+ YKKP  +DIHRERL  IK+S  +  TT
Sbjct  365  SSTLEAKDVLLHAERSWNITLPGFTGDEIKLYKKPHVNDIHRERLTLIKKSMASEGTT  422



>ref|XP_010543486.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Tarenaya hassleriana]
Length=532

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            AE EE  +RIL KRSI+EL+ QIDP  KLD EVEDIL DIA++FVES+TTFGCSLAKHRK
Sbjct  386  AENEESGDRILGKRSIRELIQQIDPSEKLDPEVEDILADIAEDFVESITTFGCSLAKHRK  445

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAA  502
            S TLEAKDILLH ER+WNI  P F GDEI+T++KPLT+DIH+ERLAA
Sbjct  446  SDTLEAKDILLHVERNWNIRPPGFCGDEIKTFRKPLTTDIHKERLAA  492



>ref|XP_010232585.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X2 [Brachypodium distachyon]
Length=500

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E  NR+LSKRSI EL+ QIDP  +LD EVED+L+DIA++F+E++ TF CSLAKHRK
Sbjct  359  AAAGESSNRLLSKRSIHELLAQIDPSERLDPEVEDVLIDIAEDFIENVGTFACSLAKHRK  418

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTT  469
            SSTLEAKD+LLHAER WNITLP F+GDEI+ YKKP  +DIHRERL  IK+S  +  TT
Sbjct  419  SSTLEAKDVLLHAERSWNITLPGFTGDEIKLYKKPHVNDIHRERLTLIKKSMASEGTT  476



>ref|XP_010232584.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X1 [Brachypodium distachyon]
Length=520

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E  NR+LSKRSI EL+ QIDP  +LD EVED+L+DIA++F+E++ TF CSLAKHRK
Sbjct  379  AAAGESSNRLLSKRSIHELLAQIDPSERLDPEVEDVLIDIAEDFIENVGTFACSLAKHRK  438

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTT  469
            SSTLEAKD+LLHAER WNITLP F+GDEI+ YKKP  +DIHRERL  IK+S  +  TT
Sbjct  439  SSTLEAKDVLLHAERSWNITLPGFTGDEIKLYKKPHVNDIHRERLTLIKKSMASEGTT  496



>ref|XP_010238690.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Brachypodium distachyon]
Length=508

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E  NR+LSKRSI+EL+ QIDP   LD EVED+L+DIA++F+ES+  F CSLAKHRK
Sbjct  353  AAAGESSNRLLSKRSIRELLAQIDPSESLDPEVEDVLIDIAEDFIESVGRFSCSLAKHRK  412

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            SSTLEAKD+LLHAER WNITLP F+GDEI+ YKKP  +DIHRERL  IK+S  +    NT
Sbjct  413  SSTLEAKDVLLHAERSWNITLPGFTGDEIKLYKKPHVNDIHRERLTLIKKSMAS--EGNT  470

Query  462  KSAVGQGGNSK  430
            +S+  Q  +++
Sbjct  471  RSSAAQAASNQ  481



>ref|XP_002458799.1| hypothetical protein SORBIDRAFT_03g040460 [Sorghum bicolor]
 gb|EES03919.1| hypothetical protein SORBIDRAFT_03g040460 [Sorghum bicolor]
Length=498

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = -3

Query  798  RILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKD  619
            R+++KRSI ELV QIDP  KLD EVED+L+DIA++FVES+TTF CSLAKHRKSSTLEAKD
Sbjct  367  RLITKRSIHELVAQIDPNEKLDPEVEDVLIDIAEDFVESVTTFACSLAKHRKSSTLEAKD  426

Query  618  ILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            +LLHAER WNITLP FSGDEI+ YKK   +DIHRERLA IK+S
Sbjct  427  VLLHAERSWNITLPGFSGDEIKLYKKQHINDIHRERLALIKKS  469



>gb|EMT22443.1| Transcription initiation factor TFIID subunit 12 [Aegilops tauschii]
Length=464

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A + E  NR+LSKRSI +L+ QIDP  +LD +VED+L+DIA++F+ES+ TF CSLAKHRK
Sbjct  323  AASGESSNRLLSKRSIHDLLAQIDPSERLDPDVEDVLIDIAEDFIESVGTFACSLAKHRK  382

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVA---VKT  472
            S+TLEAKD+LLHAER WNITLP F+GDEI+ YKKP  +DIHRERL  IK+S  +   ++T
Sbjct  383  STTLEAKDVLLHAERSWNITLPGFTGDEIKLYKKPHVNDIHRERLTLIKKSMASEGNIRT  442

Query  471  TNTKSAVGQGGNSKTTPLGKGP  406
            +  +S   Q   +   P    P
Sbjct  443  SAAQSTANQKNQAPKPPATGSP  464



>ref|XP_004970647.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Setaria italica]
Length=499

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A+  E   R+L+KRSI ELV QIDP  KLD EVED+L+DIA++FVES+ TF CSLAKHRK
Sbjct  360  ADGSETGTRLLNKRSIHELVAQIDPNEKLDPEVEDVLMDIAEDFVESVATFACSLAKHRK  419

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNT  463
            S+TLEAKD+LLHAER WNITLP FSGDEI+ YKK   +DIHRERLA IK+S      T+T
Sbjct  420  SNTLEAKDVLLHAERSWNITLPGFSGDEIKLYKKQHINDIHRERLALIKKSMA----TDT  475

Query  462  KSAVGQGGNSK  430
            K++  Q   ++
Sbjct  476  KNSAAQAATNQ  486



>ref|XP_008808549.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Phoenix dactylifera]
Length=569

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A+  E  N +LSKRS++ELV QIDP  KLD+EVED+LV++A++F+ES+TTF CSLAKHRK
Sbjct  421  ADDAESGNHVLSKRSLRELVAQIDPFEKLDSEVEDVLVEVAEDFIESVTTFACSLAKHRK  480

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVA  481
            S+TLEAKDILLH ER+WN+TLP F GDEI+ YKK  T+DIH+ER+A IK+S VA
Sbjct  481  STTLEAKDILLHVERNWNMTLPGFGGDEIKCYKKQFTNDIHKERIAVIKKSMVA  534



>ref|XP_009420517.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009420518.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 102/129 (79%), Gaps = 4/129 (3%)
 Frame = -3

Query  831  TSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAK  652
            T AAE+    + IL KRS++ELV+QIDP  KLD+EVED+LV+IA++FVES+ TF CSLAK
Sbjct  422  TDAAES---GDHILGKRSLRELVSQIDPSEKLDSEVEDVLVEIAEDFVESVATFACSLAK  478

Query  651  HRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK-  475
            HRKS+TLEAKDILLH ER+WN+ LP + GDEI+ YKK  T+DIH+ERLA IK+S  A   
Sbjct  479  HRKSTTLEAKDILLHVERNWNMMLPGYGGDEIKCYKKQFTNDIHKERLAVIKKSMAATGD  538

Query  474  TTNTKSAVG  448
            T N K+A G
Sbjct  539  TANPKNASG  547



>ref|XP_008674800.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Zea mays]
Length=492

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 5/116 (4%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E   R+L+KRSI ELV QIDP  KLD EVED+L+DIA++FVES+TTF CSLAKHRK
Sbjct  348  ANASETGTRLLTKRSIHELVAQIDPNEKLDPEVEDVLIDIAEDFVESVTTFACSLAKHRK  407

Query  642  SSTLEAKDILLHA-----ERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            SSTLEAKD+LLHA     ER WNITLP FSGDEI+ YKK   +DIHRERLA IK+S
Sbjct  408  SSTLEAKDVLLHAVLSITERSWNITLPGFSGDEIKLYKKQHINDIHRERLALIKKS  463



>ref|XP_008674802.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Zea mays]
Length=439

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 5/116 (4%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            A   E   R+L+KRSI ELV QIDP  KLD EVED+L+DIA++FVES+TTF CSLAKHRK
Sbjct  295  ANASETGTRLLTKRSIHELVAQIDPNEKLDPEVEDVLIDIAEDFVESVTTFACSLAKHRK  354

Query  642  SSTLEAKDILLHA-----ERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            SSTLEAKD+LLHA     ER WNITLP FSGDEI+ YKK   +DIHRERLA IK+S
Sbjct  355  SSTLEAKDVLLHAVLSITERSWNITLPGFSGDEIKLYKKQHINDIHRERLALIKKS  410



>ref|XP_006851500.2| PREDICTED: transcription initiation factor TFIID subunit 12 [Amborella 
trichopoda]
Length=399

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            +E  E  N ILSKRSIQELV QID   KLD E+EDILV+IA++F+ES  T  CSLAKHR 
Sbjct  248  SEVVETSNHILSKRSIQELVAQIDASEKLDPELEDILVEIAEDFLESTVTSACSLAKHRN  307

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK----  475
            S+ LEAKDI+LH ER+WN+TLP F  DEI++YKKP  +D HR+RLAA+K++ +  +    
Sbjct  308  STKLEAKDIILHLERNWNMTLPGFGIDEIKSYKKPPVNDQHRQRLAAVKKAMLTNQAGGD  367

Query  474  TTNTKSAVGQGGNS  433
              N KS+ GQGG S
Sbjct  368  ANNPKSSAGQGGGS  381



>gb|EPS61934.1| hypothetical protein M569_12859, partial [Genlisea aurea]
Length=203

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -3

Query  831  TSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAK  652
            TS+   EE  NRI++KRSIQ + +QIDP  +L++E+E ILVD+ +E++ES+ T GCSLAK
Sbjct  92   TSSDYAEEFSNRIINKRSIQNIASQIDPSERLESELESILVDVGEEYLESILTSGCSLAK  151

Query  651  HRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            HRKS++LE KDILLH E++WN+TLP F GDEI++YKKP TS+IH+ER+AA++
Sbjct  152  HRKSTSLEVKDILLHVEKNWNMTLPGFGGDEIKSYKKPSTSEIHKERVAAVR  203



>gb|ERN13081.1| hypothetical protein AMTR_s00040p00151890 [Amborella trichopoda]
Length=416

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = -3

Query  822  AETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRK  643
            +E  E  N ILSKRSIQELV QID   KLD E+EDILV+IA++F+ES  T  CSLAKHR 
Sbjct  265  SEVVETSNHILSKRSIQELVAQIDASEKLDPELEDILVEIAEDFLESTVTSACSLAKHRN  324

Query  642  SSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK----  475
            S+ LEAKDI+LH ER+WN+TLP F  DEI++YKKP  +D HR+RLAA+K++ +  +    
Sbjct  325  STKLEAKDIILHLERNWNMTLPGFGIDEIKSYKKPPVNDQHRQRLAAVKKAMLTNQAGGD  384

Query  474  TTNTKSAVGQGGNS  433
              N KS+ GQGG S
Sbjct  385  ANNPKSSAGQGGGS  398



>ref|XP_008363808.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Malus domestica]
Length=117

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  711  VDIADEFVESLTTFGCSLAKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLT  532
            +DIADEFV+S+TTF CSLAKHRKS+ LEAKDILLH E++WNITLP F GDEI+ ++KPLT
Sbjct  1    MDIADEFVDSITTFSCSLAKHRKSTQLEAKDILLHIEKNWNITLPGFGGDEIKGFRKPLT  60

Query  531  SDIHRERLAAIKRSSVAVKTTNTKSAVGQGGNSKTTPLGKGPINILTSPNAK  376
            +DIH+ERLA IK+S VA +T N ++  GQ   +    L K P NI++S N+K
Sbjct  61   NDIHKERLAVIKKSIVATETANARNPTGQAAGNAKGSLVKTPANIISSLNSK  112



>gb|KDO61105.1| hypothetical protein CISIN_1g009336mg [Citrus sinensis]
Length=496

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -3

Query  837  NKTSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSL  658
            +K +  E++E  NRIL+KRSIQELV QIDP  +LD +VEDILVDIA++FVES+T FGCSL
Sbjct  387  SKIAGTESDEFGNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSL  446

Query  657  AKHRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPL  535
            AKHRKS TLEAKDIL+H ER+WN+TLP FSGDEI+T++KP+
Sbjct  447  AKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPV  487



>gb|ERN08040.1| hypothetical protein AMTR_s00012p00261940 [Amborella trichopoda]
Length=371

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N++L KR IQ+LV+Q+DP GKLD EVEDIL++IAD+F++S+TT+ CSLAKHRKSSTL
Sbjct  209  EASNQVLGKRRIQDLVSQVDPQGKLDPEVEDILLEIADDFIDSVTTYACSLAKHRKSSTL  268

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTKSAV  451
            E+KD+LLH ER+W++ +P FS +E R ++KP+ +D HR+RL  I+     + + +  +AV
Sbjct  269  ESKDLLLHLERNWHLNIPGFSSEEQRNHRKPIANDAHRKRLEVIRN---LMDSQSPDTAV  325

Query  450  GQGGNSKTTPLGKGPINIL  394
            G+  +S    +G+  +N L
Sbjct  326  GKDRDS----MGQQAVNNL  340



>ref|XP_010271712.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Nelumbo nucifera]
Length=382

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -3

Query  768  LVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKDILLHAERHWN  589
            L +QIDP  +LD EVE+ILV+IAD+FV+++ T  CSLAKHRKS+TLEAKDI+LH E++WN
Sbjct  251  LASQIDPSERLDPEVEEILVEIADDFVDTIATCACSLAKHRKSTTLEAKDIILHLEKNWN  310

Query  588  ITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTKSAVGQ-GGNSK  430
            +TLP F GDEI+ YKK  T+DIHRERLA IK+S V  +  N K+  GQ  GN K
Sbjct  311  LTLPGFGGDEIKIYKKQYTNDIHRERLAVIKKSVVGSEVANMKTPAGQAAGNVK  364



>ref|XP_001781440.1| predicted protein [Physcomitrella patens]
 gb|EDQ53715.1| predicted protein, partial [Physcomitrella patens]
Length=102

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -3

Query  795  ILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKDI  616
            IL KRSIQ+LV QIDP  +LD +VED+L++IAD+F+ES+ +F C LAKHRKS+ LEAKD+
Sbjct  1    ILRKRSIQDLVAQIDPKERLDPDVEDVLLEIADDFIESVASFACKLAKHRKSAVLEAKDV  60

Query  615  LLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            LLH ++ WNIT+P F G+EIR+YK+P  S+ H++RLA +++S
Sbjct  61   LLHLDKQWNITVPGFGGEEIRSYKRPQISESHKQRLAVVRKS  102



>ref|XP_010910327.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Elaeis guineensis]
Length=527

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N+ILSKRS++ELV QIDP  KLD+EVED+LV++A++F+ES+TTF CSLAKHRKSSTLEAK
Sbjct  425  NQILSKRSLRELVAQIDPSEKLDSEVEDVLVEVAEDFIESVTTFACSLAKHRKSSTLEAK  484

Query  621  DILLHAERHWNITLPVFSGDEIRTYKK  541
            DILLH ER+WN+TLP FSGDEI+ YKK
Sbjct  485  DILLHVERNWNMTLPGFSGDEIKCYKK  511



>ref|XP_006846365.2| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Amborella trichopoda]
Length=573

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N++L KR IQ+LV+Q+DP GKLD EVEDIL++IAD+F++S+TT+ CSLAKHRKSSTL
Sbjct  411  EASNQVLGKRRIQDLVSQVDPQGKLDPEVEDILLEIADDFIDSVTTYACSLAKHRKSSTL  470

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            E+KD+LLH ER+W++ +P FS +E R ++KP+ +D HR+RL  I+
Sbjct  471  ESKDLLLHLERNWHLNIPGFSSEEQRNHRKPIANDAHRKRLEVIR  515



>ref|XP_012068891.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X2 [Jatropha curcas]
 gb|KDP40709.1| hypothetical protein JCGZ_24708 [Jatropha curcas]
Length=633

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 103/140 (74%), Gaps = 5/140 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  465  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLDPEVEDLLLEIADDFIDSVTTFACSLAKH  524

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL---AAIKRSS-VA  481
            RKSSTLE+KD+LLH E++W +T+P FS +E    +KPL+SD+H++RL    A++ SS + 
Sbjct  525  RKSSTLESKDLLLHLEKNWQLTIPGFSTEERNFQRKPLSSDLHKKRLDMICALRESSHME  584

Query  480  VKTTNTKSAVGQG-GNSKTT  424
                N K  + QG GN   T
Sbjct  585  TNNHNPKEMIRQGLGNPVVT  604



>ref|XP_012068890.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X1 [Jatropha curcas]
Length=636

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 103/140 (74%), Gaps = 5/140 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  468  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLDPEVEDLLLEIADDFIDSVTTFACSLAKH  527

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL---AAIKRSS-VA  481
            RKSSTLE+KD+LLH E++W +T+P FS +E    +KPL+SD+H++RL    A++ SS + 
Sbjct  528  RKSSTLESKDLLLHLEKNWQLTIPGFSTEERNFQRKPLSSDLHKKRLDMICALRESSHME  587

Query  480  VKTTNTKSAVGQG-GNSKTT  424
                N K  + QG GN   T
Sbjct  588  TNNHNPKEMIRQGLGNPVVT  607



>emb|CEG73313.1| Putative Genomic scaffold, msy_sf_3 [Rhizopus microsporus]
Length=389

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -3

Query  804  CNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEA  625
             NR+L+KR IQELVTQIDP  +L+ EVEDIL++IADEF+ES+TTF C LAKHRKS TLE 
Sbjct  274  VNRVLTKRKIQELVTQIDPSERLEPEVEDILLEIADEFIESVTTFACRLAKHRKSDTLEV  333

Query  624  KDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAI  499
            KD+ LH ER+WNI +P F+ D+IR  +KP  S  H+ ++ A+
Sbjct  334  KDVQLHLERNWNIRIPGFAADDIRPLRKPAISSAHQSKVQAV  375



>gb|KJB68260.1| hypothetical protein B456_010G235100 [Gossypium raimondii]
 gb|KJB68262.1| hypothetical protein B456_010G235100 [Gossypium raimondii]
Length=623

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  456  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  515

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KDILLH E++W +T+P FS +E R   +PL+SD+H++RL    A ++ S   
Sbjct  516  RKSSTLESKDILLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKKRLEMIRALMESSHPE  574

Query  480  VKTTNTKSAVGQG-GN  436
            +   N K  + QG GN
Sbjct  575  INANNPKEMIRQGLGN  590



>gb|KJB68264.1| hypothetical protein B456_010G235100 [Gossypium raimondii]
Length=613

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  446  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  505

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KDILLH E++W +T+P FS +E R   +PL+SD+H++RL    A ++ S   
Sbjct  506  RKSSTLESKDILLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKKRLEMIRALMESSHPE  564

Query  480  VKTTNTKSAVGQG-GN  436
            +   N K  + QG GN
Sbjct  565  INANNPKEMIRQGLGN  580



>gb|KJB68265.1| hypothetical protein B456_010G235100 [Gossypium raimondii]
Length=620

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  453  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  512

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KDILLH E++W +T+P FS +E R   +PL+SD+H++RL    A ++ S   
Sbjct  513  RKSSTLESKDILLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKKRLEMIRALMESSHPE  571

Query  480  VKTTNTKSAVGQG-GN  436
            +   N K  + QG GN
Sbjct  572  INANNPKEMIRQGLGN  587



>gb|EIE76230.1| hypothetical protein RO3G_00934 [Rhizopus delemar RA 99-880]
Length=392

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -3

Query  804  CNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEA  625
             NR+L+KR IQELV+QIDP  +L+ EVEDIL++IADEF+ES+TTF C LAKHRKS TLE 
Sbjct  276  VNRVLTKRKIQELVSQIDPAERLEPEVEDILLEIADEFIESVTTFACRLAKHRKSDTLEV  335

Query  624  KDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAI  499
            KD+ LH ER+WNI +P F+ D+IR  +KP  S  H+ ++ A+
Sbjct  336  KDVQLHLERNWNIRIPGFAADDIRPLRKPTVSSTHQSKIQAV  377



>gb|EPB84926.1| hypothetical protein HMPREF1544_08285 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=419

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = -3

Query  804  CNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEA  625
             NR+L+KR IQELV+QIDP  +L+ EVEDIL++IADEF+ES+TTF C LAKHRKS TLE 
Sbjct  299  VNRVLTKRKIQELVSQIDPSERLEPEVEDILLEIADEFIESVTTFACQLAKHRKSDTLEV  358

Query  624  KDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTK  460
            KD+ LH ER+WNI +P F+ D+IR  +KP     H+ ++ A+  +   + +T++K
Sbjct  359  KDVQLHLERNWNIRIPGFAADDIRPLRKPTIPSSHQSKVQAVNAAKSQMSSTSSK  413



>ref|XP_011467427.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Fragaria vesca subsp. vesca]
Length=624

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR +Q+LV+Q+D  G+LD+EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  457  SSSQGTEATNQLLGKRKMQDLVSQVDSQGRLDSEVEDLLLEIADDFIDSVTTFACSLAKH  516

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK----RSSVA  481
            RKSSTLE+KD+LLH E++W++T+P FS +E +   K L+SD+H++RL  I+     S   
Sbjct  517  RKSSTLESKDVLLHLEKNWHLTIPGFSSEERKYQNKSLSSDVHKKRLDMIRMLMESSQPE  576

Query  480  VKTTNTKSAVGQGGN  436
              T N K  +   GN
Sbjct  577  TNTNNPKEVIRGYGN  591



>ref|XP_007216979.1| hypothetical protein PRUPE_ppa002765mg [Prunus persica]
 gb|EMJ18178.1| hypothetical protein PRUPE_ppa002765mg [Prunus persica]
Length=635

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+QID  G+LD EVED+L++IAD+F++S+TT+ C+LAKH
Sbjct  469  SSSQGTEATNQLLGKRKIQDLVSQIDSQGRLDPEVEDLLLEIADDFIDSVTTYACNLAKH  528

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK----RSSVA  481
            RKSSTLE+KD+LLH E++WN+T+P FS +E +   K L+SD+H++RL  I+     S + 
Sbjct  529  RKSSTLESKDVLLHLEKNWNLTIPGFSSEERKYQNKSLSSDLHKKRLDMIRTLMESSHLE  588

Query  480  VKTTNTKSAVGQGGN  436
              T N K  +   GN
Sbjct  589  TNTNNPKEMMRGFGN  603



>ref|XP_007024607.1| Transcription initiation factor TFIID subunit A isoform 1 [Theobroma 
cacao]
 gb|EOY27229.1| Transcription initiation factor TFIID subunit A isoform 1 [Theobroma 
cacao]
Length=670

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 100/136 (74%), Gaps = 6/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  503  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  562

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KD+LLH E++W +T+P FS +E R   +PL+SD+H++RL    A ++ S   
Sbjct  563  RKSSTLESKDLLLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKQRLDMIRALMESSQPE  621

Query  480  VKTTNTKSAVGQG-GN  436
                N K  + QG GN
Sbjct  622  TTANNPKEMIRQGLGN  637



>ref|XP_002264851.2| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Vitis vinifera]
 emb|CBI35882.3| unnamed protein product [Vitis vinifera]
Length=587

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 106/146 (73%), Gaps = 7/146 (5%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  417  SSSQGTEASNQLLGKRKIQDLVSQVDSQGKLDPEVEDLLLEIADDFIDSVTTFACSLAKH  476

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRER---LAAIKRSSVAV  478
            RKSSTLE+KD+LLH E++W++ +P +S +E +   KP +S++H++R   + A+  SS + 
Sbjct  477  RKSSTLESKDLLLHLEKNWDLKIPGYSSEEQKNQTKPSSSELHKKRVDMVRALMESSHSE  536

Query  477  KTTNTKSAVGQG-GNSKTTPLGKGPI  403
               N K  + QG GN+   P+G  P+
Sbjct  537  TNANAKEMMRQGLGNN---PVGANPM  559



>ref|XP_007024609.1| Transcription initiation factor TFIID subunit A isoform 3 [Theobroma 
cacao]
 gb|EOY27231.1| Transcription initiation factor TFIID subunit A isoform 3 [Theobroma 
cacao]
Length=671

 Score =   142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 100/136 (74%), Gaps = 6/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  503  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  562

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KD+LLH E++W +T+P FS +E R   +PL+SD+H++RL    A ++ S   
Sbjct  563  RKSSTLESKDLLLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKQRLDMIRALMESSQPE  621

Query  480  VKTTNTKSAVGQG-GN  436
                N K  + QG GN
Sbjct  622  TTANNPKEMIRQGLGN  637



>ref|XP_008228206.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Prunus mume]
Length=634

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  G+LD EVED+L++IAD+F++S+TT+ C+LAKH
Sbjct  468  SSSQGTEATNQLLGKRKIQDLVSQVDSQGRLDPEVEDLLLEIADDFIDSVTTYACNLAKH  527

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK----RSSVA  481
            RKSSTLE+KD+LLH E++WN+T+P FS +E +   K L+SD+H++RL  I+     S + 
Sbjct  528  RKSSTLESKDVLLHLEKNWNLTIPGFSSEERKYQNKSLSSDLHKKRLDMIRTLMESSHLE  587

Query  480  VKTTNTKSAVGQGGN  436
              T N K  +   GN
Sbjct  588  TNTNNPKEMMRGFGN  602



>ref|XP_011035712.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
isoform X2 [Populus euphratica]
Length=584

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD +VE++ ++IAD+F++S+TTF CSLAKH
Sbjct  416  SSSQGTEATNQLLGKRKIQDLVSQVDSHGKLDPDVEELFLEIADDFIDSVTTFACSLAKH  475

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KDI+LH E++W++T+P FS +E +  K+PL SD+H++RL  I+
Sbjct  476  RKSSTLESKDIMLHLEKNWHLTIPGFSTEEQKHQKRPLPSDLHKKRLDMIR  526



>ref|XP_011035709.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
isoform X1 [Populus euphratica]
 ref|XP_011035710.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
isoform X1 [Populus euphratica]
 ref|XP_011035711.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
isoform X1 [Populus euphratica]
Length=597

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD +VE++ ++IAD+F++S+TTF CSLAKH
Sbjct  429  SSSQGTEATNQLLGKRKIQDLVSQVDSHGKLDPDVEELFLEIADDFIDSVTTFACSLAKH  488

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KDI+LH E++W++T+P FS +E +  K+PL SD+H++RL  I+
Sbjct  489  RKSSTLESKDIMLHLEKNWHLTIPGFSTEEQKHQKRPLPSDLHKKRLDMIR  539



>gb|KJB68261.1| hypothetical protein B456_010G235100 [Gossypium raimondii]
Length=572

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  456  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  515

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAI  499
            RKSSTLE+KDILLH E++W +T+P FS +E R   +PL+SD+H++RL  +
Sbjct  516  RKSSTLESKDILLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKKRLEMV  564



>gb|KJB68263.1| hypothetical protein B456_010G235100 [Gossypium raimondii]
Length=631

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 101/144 (70%), Gaps = 14/144 (10%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  456  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  515

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL------------A  505
            RKSSTLE+KDILLH E++W +T+P FS +E R   +PL+SD+H++RL            A
Sbjct  516  RKSSTLESKDILLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKKRLEMVTEIFSTKIRA  574

Query  504  AIKRSSVAVKTTNTKSAVGQG-GN  436
             ++ S   +   N K  + QG GN
Sbjct  575  LMESSHPEINANNPKEMIRQGLGN  598



>ref|XP_011036418.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Populus euphratica]
Length=611

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVE++ ++IAD+F++S+T F CSLAKH
Sbjct  443  SSSQGTEATNQLLGKRKIQDLVSQVDSHGKLDPEVEELFLEIADDFIDSVTAFACSLAKH  502

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KDILLH E++W +T+P FS +E +   KPL SD+H++RL  I+
Sbjct  503  RKSSTLESKDILLHLEKNWQLTIPGFSSEERKHQSKPLPSDLHKKRLDMIR  553



>ref|XP_002521336.1| protein with unknown function [Ricinus communis]
 gb|EEF41004.1| protein with unknown function [Ricinus communis]
Length=523

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GK+D EVE++L++IAD+F++++T F CSLAKH
Sbjct  356  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKVDPEVEELLLEIADDFIDNVTMFACSLAKH  415

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL---AAIKRSSVAV  478
            RKSSTLE+KD+LLH E++W++T+P FS +E    +KPL+SD+H++RL    A++  S + 
Sbjct  416  RKSSTLESKDLLLHLEKNWHLTIPGFSTEERNLQRKPLSSDLHKKRLDMIRALREPSHSE  475

Query  477  KTTNTKSAVGQG-GNSKTT  424
               N +  + QG GN   T
Sbjct  476  TNNNPREMIRQGLGNPVVT  494



>emb|CEP13702.1| hypothetical protein [Parasitella parasitica]
Length=400

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = -3

Query  804  CNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEA  625
             +R+L+KR IQELV+QIDP  +L+ EVEDIL++IADEF+ES+TTF C LAKHRKS TLE 
Sbjct  279  VHRVLTKRKIQELVSQIDPSERLEPEVEDILLEIADEFIESVTTFACQLAKHRKSDTLEV  338

Query  624  KDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTNTK  460
            KD+ LH ER+WNI +P F+ D+IR  +KP     H+ ++ A+  +   + +T++K
Sbjct  339  KDVQLHLERNWNIRIPGFAADDIRPLRKPTIPSSHQAKVQAVNAAKSQISSTSSK  393



>ref|XP_002304140.1| transcription initiation factor IID subunit A family protein 
[Populus trichocarpa]
 gb|EEE79119.1| transcription initiation factor IID subunit A family protein 
[Populus trichocarpa]
Length=655

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 99/140 (71%), Gaps = 5/140 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVE++ ++IAD+F++S+T F CSLAKH
Sbjct  457  SSSQGTEATNQLLGKRKIQDLVSQVDSHGKLDPEVEELFLEIADDFIDSVTAFACSLAKH  516

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KDILLH E++W++T+P FS +E +   KPL SD+H++RL    A ++ S   
Sbjct  517  RKSSTLESKDILLHLEKNWHLTIPGFSSEERKHQSKPLPSDLHKKRLDMIRALMESSQSE  576

Query  480  VKTTNTKSAVGQG-GNSKTT  424
                N K  + QG GN   T
Sbjct  577  ENNINPKEMIRQGHGNPAVT  596



>dbj|GAN08512.1| transcription initiation factor TFIID subunit 12 isoform X2 [Mucor 
ambiguus]
Length=420

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -3

Query  804  CNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEA  625
             NR+L+KR IQELV+QIDP  +L+ EVEDIL++IADEF+ES+TTF C LAKHRKS TLE 
Sbjct  300  VNRVLTKRKIQELVSQIDPSERLEPEVEDILLEIADEFIESVTTFACQLAKHRKSDTLEV  359

Query  624  KDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAI  499
            KD+ LH ER+WNI +P F+ D+IR  +KP     H+ ++ A+
Sbjct  360  KDVQLHLERNWNIRIPGFAADDIRPLRKPTIPSSHQSKVQAV  401



>ref|XP_004235568.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Solanum lycopersicum]
Length=642

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF C+LAKHRKSSTL
Sbjct  483  EASNQLLGKRKIQDLVSQVDAQGKLDPEVEDLLLEIADDFIDSVTTFACNLAKHRKSSTL  542

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            E+KD+LLH E++W++T+P FS +E + Y +  +SD+H++RL  I+
Sbjct  543  ESKDVLLHLEKNWHLTIPGFSSEERKQYPENSSSDLHKKRLDVIR  587



>gb|KJB70117.1| hypothetical protein B456_011G058700 [Gossypium raimondii]
 gb|KJB70118.1| hypothetical protein B456_011G058700 [Gossypium raimondii]
 gb|KJB70119.1| hypothetical protein B456_011G058700 [Gossypium raimondii]
Length=636

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 98/136 (72%), Gaps = 6/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKL+ EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  470  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAKH  529

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE++D+LLH ER+W + +P FS +E R    PL+SD+H++RL    A ++ S   
Sbjct  530  RKSSTLESRDLLLHLERNWKLPVPGFSSEE-RNQTSPLSSDLHKKRLDMVRALMESSQPE  588

Query  480  VKTTNTKSAVGQG-GN  436
                N K  + QG GN
Sbjct  589  TNANNPKEMIRQGLGN  604



>gb|KCW69820.1| hypothetical protein EUGRSUZ_F03174 [Eucalyptus grandis]
Length=476

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+DP G LD  VED+L++ AD+F++ +TTF CSLAKH
Sbjct  308  SSSQGTEATNQLLGKRKIQDLVSQVDPQGVLDPNVEDLLLEFADDFIDQVTTFACSLAKH  367

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W +T+P FS +  +  KKPL S+ H++RL  ++
Sbjct  368  RKSSTLESKDVLLHLEKNWGLTIPGFSSEGQKHLKKPLASEFHKKRLDMVR  418



>ref|XP_003627263.1| Transcription initiation factor TFIID subunit [Medicago truncatula]
 gb|AET01739.1| transcription initiation factor TFIID subunit A, putative [Medicago 
truncatula]
Length=571

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  831  TSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAK  652
            +S+  TE   N++L KR IQ+LV Q+DP GKLD EV D+L++ AD+F++S+TT GC LAK
Sbjct  402  SSSQGTEAATNQVLGKRKIQDLVAQVDPQGKLDPEVIDLLLEFADDFIDSVTTHGCILAK  461

Query  651  HRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            HRKSSTLE+KD+LLH E++W++T+P +S +E +   +PL++++H+ RL A++
Sbjct  462  HRKSSTLESKDLLLHLEKNWDLTIPGYSSEEKKYQSRPLSNELHKRRLDAVR  513



>ref|XP_008391383.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Malus domestica]
 ref|XP_008391384.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Malus domestica]
Length=629

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ++V+Q+D  G+LD EVED+L++IAD+F++S+TT+ C+LAKH
Sbjct  462  SSSQGTEATNQLLGKRKIQDVVSQVDSQGRLDPEVEDLLLEIADDFIDSVTTYACNLAKH  521

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W++T+P FS +E +   K L+SD+H++RL  I+
Sbjct  522  RKSSTLESKDVLLHLEKNWHLTIPGFSSEERKYQNKSLSSDLHKKRLDVIR  572



>gb|ADL36631.1| C2H2L domain class transcription factor [Malus domestica]
Length=630

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  G+LD EVED+L++IAD+F++S+TT+ C+LAKH
Sbjct  463  SSSQGTEATNQLLGKRKIQDLVSQVDSQGRLDPEVEDLLLEIADDFIDSVTTYACNLAKH  522

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W++T+P FS +E +   K L+SD+H++RL  I+
Sbjct  523  RKSSTLESKDVLLHLEKNWHLTIPGFSSEERKCQNKSLSSDLHKKRLDVIR  573



>ref|NP_001275310.1| transcription initiation factor TFIID subunit 12b-like [Solanum 
tuberosum]
 dbj|BAE46416.1| TATA binding protein associated factor [Solanum tuberosum]
Length=638

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF C+LAKHRKSSTL
Sbjct  479  EASNQLLGKRKIQDLVSQVDAQGKLDPEVEDLLLEIADDFIDSVTTFACNLAKHRKSSTL  538

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            E+KD+LLH E++W++T+P FS +E + Y +  +SD+H++RL  I+
Sbjct  539  ESKDVLLHLEKNWHLTIPGFSSEERKHYPENSSSDLHKKRLDVIR  583



>ref|XP_008785532.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X2 [Phoenix dactylifera]
Length=599

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+DP  KLD EVED+L+++AD+F+ S+TTF CSLAKH
Sbjct  432  SSSQGMEATNQLLGKRRIQDLVSQVDPQCKLDPEVEDLLLEMADDFINSVTTFACSLAKH  491

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLEAKD+LLH E++WN+T+P +S +E     K ++ D+H++RL  ++
Sbjct  492  RKSSTLEAKDVLLHLEKNWNLTIPGYSKEEQNQQGKSVSVDVHKKRLETVR  542



>ref|XP_008785531.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X1 [Phoenix dactylifera]
Length=601

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+DP  KLD EVED+L+++AD+F+ S+TTF CSLAKH
Sbjct  434  SSSQGMEATNQLLGKRRIQDLVSQVDPQCKLDPEVEDLLLEMADDFINSVTTFACSLAKH  493

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLEAKD+LLH E++WN+T+P +S +E     K ++ D+H++RL  ++
Sbjct  494  RKSSTLEAKDVLLHLEKNWNLTIPGYSKEEQNQQGKSVSVDVHKKRLETVR  544



>ref|XP_009339800.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Pyrus x bretschneideri]
Length=635

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  G+LD EVED+L++IAD+F++S+TT+ C+LAKH
Sbjct  468  SSSQGTEATNQLLGKRKIQDLVSQVDSQGRLDPEVEDLLLEIADDFIDSVTTYACNLAKH  527

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W++T+P FS +E +   K L+SD+H++RL  I+
Sbjct  528  RKSSTLESKDVLLHLEKNWHLTIPGFSSEERKCQNKSLSSDLHKKRLDVIR  578



>ref|XP_010062697.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Eucalyptus grandis]
Length=620

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+DP G LD  VED+L++ AD+F++ +TTF CSLAKH
Sbjct  452  SSSQGTEATNQLLGKRKIQDLVSQVDPQGVLDPNVEDLLLEFADDFIDQVTTFACSLAKH  511

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W +T+P FS +  +  KKPL S+ H++RL  ++
Sbjct  512  RKSSTLESKDVLLHLEKNWGLTIPGFSSEGQKHLKKPLASEFHKKRLDMVR  562



>gb|KDO65043.1| hypothetical protein CISIN_1g007852mg [Citrus sinensis]
Length=587

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GK+D EVED+L++IAD+F++S+T+F C+LAKH
Sbjct  420  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKVDPEVEDLLLEIADDFIDSVTSFACNLAKH  479

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KDILLH E++W++T+P FS +E    +K L+SD+H +RL  I+
Sbjct  480  RKSSTLESKDILLHLEKNWHLTVPGFSSEERNHQRKSLSSDVHSKRLEMIR  530



>ref|XP_006426645.1| hypothetical protein CICLE_v10025234mg [Citrus clementina]
 gb|ESR39885.1| hypothetical protein CICLE_v10025234mg [Citrus clementina]
Length=587

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GK+D EVED+L++IAD+F++S+T+F C+LAKH
Sbjct  420  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKVDPEVEDLLLEIADDFIDSVTSFACNLAKH  479

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KDILLH E++W++T+P FS +E    +K L+SD+H +RL  I+
Sbjct  480  RKSSTLESKDILLHLEKNWHLTVPGFSSEERNHQRKSLSSDVHSKRLEMIR  530



>ref|XP_009372343.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Pyrus x bretschneideri]
 ref|XP_009372344.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Pyrus x bretschneideri]
Length=634

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ++V+Q+D  G+LD EVED+L++IAD+F++S+TT+ C+LAKH
Sbjct  467  SSSQGTEATNQLLGKRKIQDVVSQVDSQGRLDPEVEDLLLEIADDFIDSVTTYACNLAKH  526

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W++T+P FS +E +   K L+SD+H++RL  I+
Sbjct  527  RKSSTLESKDVLLHLEKNWHLTIPGFSSEERKYQNKSLSSDLHKKRLDVIR  577



>ref|XP_006465927.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Citrus sinensis]
Length=593

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GK+D EVED+L++IAD+F++S+T+F C+LAKH
Sbjct  426  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKVDPEVEDLLLEIADDFIDSVTSFACNLAKH  485

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KDILLH E++W++T+P FS +E    +K L+SD+H +RL  I+
Sbjct  486  RKSSTLESKDILLHLEKNWHLTVPGFSSEERNHQRKSLSSDVHSKRLEMIR  536



>ref|XP_009409036.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Musa acuminata subsp. malaccensis]
Length=614

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR I +LV Q+DP GKLD EVED+L++IAD+F++S+T+F CSLAKH
Sbjct  447  SSSQGAEATNQLLGKRKIHDLVLQVDPMGKLDPEVEDLLLEIADDFIDSVTSFACSLAKH  506

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLEAKD+LLH E++WN+ +P ++ +E    K+ L  DIH++RL  I+
Sbjct  507  RKSSTLEAKDVLLHLEKNWNLAVPGYTREEKSYQKESLPLDIHKQRLEMIR  557



>ref|XP_007024610.1| Transcription initiation factor TFIID subunit A isoform 4 [Theobroma 
cacao]
 gb|EOY27232.1| Transcription initiation factor TFIID subunit A isoform 4 [Theobroma 
cacao]
Length=672

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQ-IDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAK  652
            S+++  E  N++L KR IQ+LV+Q +D  GKL+ EVED+L++IAD+F++S+TTF CSLAK
Sbjct  503  SSSQGTEATNQLLGKRKIQDLVSQQVDSQGKLEPEVEDLLLEIADDFIDSVTTFACSLAK  562

Query  651  HRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSV  484
            HRKSSTLE+KD+LLH E++W +T+P FS +E R   +PL+SD+H++RL    A ++ S  
Sbjct  563  HRKSSTLESKDLLLHLEKNWRLTIPGFSSEE-RNQTRPLSSDLHKQRLDMIRALMESSQP  621

Query  483  AVKTTNTKSAVGQG-GN  436
                 N K  + QG GN
Sbjct  622  ETTANNPKEMIRQGLGN  638



>ref|XP_011659626.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Cucumis sativus]
Length=668

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E   ++L KR IQ+LV+Q+DP GKL+ EVED+L++IAD+F++S+TTF C+LAKH
Sbjct  499  SSSQGTEAATQVLGKRKIQDLVSQVDPHGKLEPEVEDLLLEIADDFIDSVTTFSCNLAKH  558

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPL-TSDIHRERLAAIK----RSSV  484
            RKSSTLE+KD+LLH E++W + +P +S DE + + K L +SD+H++RL  I+     S V
Sbjct  559  RKSSTLESKDLLLHLEKNWQLNVPGYSSDEWKNHNKNLSSSDVHKKRLDMIRILKEASCV  618

Query  483  AVKTTNTKSAVGQGGNSKTTPLGKGPINILTSP  385
                 + K  V QG       +  GP N LT P
Sbjct  619  ETNVNSPKEMVRQG-----VGMSIGP-NTLTRP  645



>gb|KCW69819.1| hypothetical protein EUGRSUZ_F03174 [Eucalyptus grandis]
Length=631

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+DP G LD  VED+L++ AD+F++ +TTF CSLAKH
Sbjct  463  SSSQGTEATNQLLGKRKIQDLVSQVDPQGVLDPNVEDLLLEFADDFIDQVTTFACSLAKH  522

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W +T+P FS +  +  KKPL S+ H++RL  ++
Sbjct  523  RKSSTLESKDVLLHLEKNWGLTIPGFSSEGQKHLKKPLASEFHKKRLDMVR  573



>ref|XP_010256794.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X1 [Nelumbo nucifera]
Length=644

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  475  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLDPEVEDLLLEIADDFIDSVTTFACSLAKH  534

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W++ +P ++ +E +   K L+ D+H  RL  I+
Sbjct  535  RKSSTLESKDLLLHLEKNWHLKIPGYTSEEHKYQMKSLSGDLHNRRLGMIR  585



>ref|XP_010256795.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X2 [Nelumbo nucifera]
Length=641

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF CSLAKH
Sbjct  472  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLDPEVEDLLLEIADDFIDSVTTFACSLAKH  531

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W++ +P ++ +E +   K L+ D+H  RL  I+
Sbjct  532  RKSSTLESKDLLLHLEKNWHLKIPGYTSEEHKYQMKSLSGDLHNRRLGMIR  582



>gb|KGN45493.1| hypothetical protein Csa_7G450520 [Cucumis sativus]
Length=680

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E   ++L KR IQ+LV+Q+DP GKL+ EVED+L++IAD+F++S+TTF C+LAKH
Sbjct  511  SSSQGTEAATQVLGKRKIQDLVSQVDPHGKLEPEVEDLLLEIADDFIDSVTTFSCNLAKH  570

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPL-TSDIHRERLAAIK----RSSV  484
            RKSSTLE+KD+LLH E++W + +P +S DE + + K L +SD+H++RL  I+     S V
Sbjct  571  RKSSTLESKDLLLHLEKNWQLNVPGYSSDEWKNHNKNLSSSDVHKKRLDMIRILKEASCV  630

Query  483  AVKTTNTKSAVGQGGNSKTTPLGKGPINILTSP  385
                 + K  V QG       +  GP N LT P
Sbjct  631  ETNVNSPKEMVRQG-----VGMSIGP-NTLTRP  657



>ref|XP_009800090.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Nicotiana sylvestris]
Length=647

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF C+LAKHRKSSTL
Sbjct  488  EASNQLLGKRKIQDLVSQVDSHGKLDPEVEDLLLEIADDFIDSVTTFACNLAKHRKSSTL  547

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            E+KD+LLH E++W++T+P FS +E + Y +   SD+H++RL  I+
Sbjct  548  ESKDVLLHLEKNWHLTIPGFSSEERKHYPEHSPSDLHKKRLDVIR  592



>ref|XP_008462314.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Cucumis melo]
Length=675

 Score =   137 bits (344),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 97/134 (72%), Gaps = 5/134 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E   ++L KR IQ+LV+Q+DP GKL+ EVED+L++IAD+F++S+TTF C+LAKH
Sbjct  506  SSSQGTEAATQVLGKRKIQDLVSQVDPHGKLEPEVEDLLLEIADDFIDSVTTFSCNLAKH  565

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPL-TSDIHRERLAAIK----RSSV  484
            RKSSTLE+KD+LLH E++W + +P +S DE + + K L +SD+H++RL  I+     S V
Sbjct  566  RKSSTLESKDLLLHLEKNWQLNVPGYSSDEWKNHNKNLSSSDVHKKRLDMIRLLKEASCV  625

Query  483  AVKTTNTKSAVGQG  442
                 + K  V QG
Sbjct  626  ETNLNSPKEMVRQG  639



>ref|XP_007135452.1| hypothetical protein PHAVU_010G130700g [Phaseolus vulgaris]
 gb|ESW07446.1| hypothetical protein PHAVU_010G130700g [Phaseolus vulgaris]
Length=587

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV Q+DP G LD EV D+L+++AD+F++S TT GC LAKH
Sbjct  416  SSSQGTEATNQVLGKRKIQDLVAQVDPQGTLDPEVIDLLLELADDFIDSTTTHGCILAKH  475

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK---RSSVAV  478
            RKS TLE+KD+LLH E++W++T+P +S +E +   KP  +D+H+ RL  I+    SS + 
Sbjct  476  RKSPTLESKDLLLHLEKNWDLTVPGYSSEEKKYQSKPQLNDLHKRRLDMIRTLMESSASE  535

Query  477  KTTNTKSAVGQGGNSKTTPLGKG  409
               N+   + + G S  TP+  G
Sbjct  536  SNINSSKELSRQGISNPTPVAVG  558



>ref|XP_003528481.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Glycine max]
Length=599

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV Q+DP G+LD EV D+L+++AD+F++S TT GC LAKH
Sbjct  430  SSSQGTEATNQVLGKRKIQDLVAQVDPQGRLDPEVIDLLLELADDFIDSATTHGCILAKH  489

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W++T+P +S +E +   KP  +D+H+ RL  ++
Sbjct  490  RKSSTLESKDLLLHLEKNWDLTIPGYSSEEKKNQSKPQLNDLHKRRLDMVR  540



>ref|XP_010923230.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X2 [Elaeis guineensis]
Length=636

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+L +Q+DP  KLD EVE++L+++AD+F+ S+TTF CSLAKH
Sbjct  469  SSSQGMEATNQLLGKRRIQDLASQVDPQCKLDPEVEELLLEMADDFINSVTTFACSLAKH  528

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLEAKD+LLH E++WN+T+P +S +E     K +  D+H++RL  ++
Sbjct  529  RKSSTLEAKDVLLHLEKNWNLTIPGYSKEEQNQQGKSVPVDVHKKRLETVR  579



>ref|XP_010923229.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X1 [Elaeis guineensis]
Length=638

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+L +Q+DP  KLD EVE++L+++AD+F+ S+TTF CSLAKH
Sbjct  471  SSSQGMEATNQLLGKRRIQDLASQVDPQCKLDPEVEELLLEMADDFINSVTTFACSLAKH  530

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLEAKD+LLH E++WN+T+P +S +E     K +  D+H++RL  ++
Sbjct  531  RKSSTLEAKDVLLHLEKNWNLTIPGYSKEEQNQQGKSVPVDVHKKRLETVR  581



>gb|AAC50601.1| TAF15 [Homo sapiens]
Length=131

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  25   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  84

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  85   DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  129



>ref|XP_010674214.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=722

 Score =   135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 98/136 (72%), Gaps = 5/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF C+LAKH
Sbjct  554  SSSQGTEAMNQLLGKRKIQDLVSQVDAHGKLDPEVEDLLLEIADDFIDSVTTFACNLAKH  613

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KD+LLH E++W++T+P +S ++ ++     + D HR+RL    A ++ S   
Sbjct  614  RKSSTLESKDVLLHLEKNWHLTIPGYSSEDRKSNTDNPSCDAHRKRLDMIRALMESSQSG  673

Query  480  VKTTNTKSAVGQG-GN  436
                N+K  V QG GN
Sbjct  674  FYPNNSKEMVRQGIGN  689



>ref|XP_010674213.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=723

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 98/136 (72%), Gaps = 5/136 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+TTF C+LAKH
Sbjct  555  SSSQGTEAMNQLLGKRKIQDLVSQVDAHGKLDPEVEDLLLEIADDFIDSVTTFACNLAKH  614

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE+KD+LLH E++W++T+P +S ++ ++     + D HR+RL    A ++ S   
Sbjct  615  RKSSTLESKDVLLHLEKNWHLTIPGYSSEDRKSNTDNPSCDAHRKRLDMIRALMESSQSG  674

Query  480  VKTTNTKSAVGQG-GN  436
                N+K  V QG GN
Sbjct  675  FYPNNSKEMVRQGIGN  690



>ref|NP_938182.1| transcription initiation factor TFIID subunit 12 [Danio rerio]
 ref|XP_009290705.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Danio rerio]
 gb|AAH56696.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor [Danio rerio]
 gb|AAH65878.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor [Danio rerio]
 gb|AAI52199.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor [Danio rerio]
Length=162

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  798  RILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKD  619
            ++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE KD
Sbjct  57   QVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKD  116

Query  618  ILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            + LH ER WN+ +P F  DEIR YKK  T++ H++R+A I++++
Sbjct  117  VQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>emb|CDP11601.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  N++L KR IQ+LV+Q+DP GKLD EVED+L+ +AD+F++S+T+F C LAKHRKSSTL
Sbjct  307  EASNQLLGKRRIQDLVSQVDPQGKLDPEVEDLLLQVADDFIDSVTSFACGLAKHRKSSTL  366

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLA---AIKRSSVAVKTTN  466
            EAKD+LLH E+++ +T+P FS +E +  +    SD HR+R+    A+  SS    T+N
Sbjct  367  EAKDVLLHLEKNYKLTIPGFSSEEKKHQQNHPPSDAHRKRMEVIHALMESSSEASTSN  424



>ref|XP_010105507.1| Transcription initiation factor TFIID subunit 12 [Morus notabilis]
 gb|EXC04958.1| Transcription initiation factor TFIID subunit 12 [Morus notabilis]
Length=641

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD+F++S+T F CSLAKH
Sbjct  474  SSSQGTEATNQLLGKRKIQDLVSQVDSQGKLDPEVEDLLLEIADDFIDSVTAFACSLAKH  533

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W +T+P F  +E +   K L+SD+H++RL  ++
Sbjct  534  RKSSTLESKDLLLHLEKNWQLTIPGF--EEQKHQNKLLSSDVHKKRLDLVR  582



>ref|XP_011072579.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 12b [Sesamum indicum]
Length=604

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD EVED+L++IAD F++S+TTF C+LAKH
Sbjct  437  SSSQGTEASNQLLGKRKIQDLVSQLDVNGKLDPEVEDLLLEIADNFIDSVTTFACTLAKH  496

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD+LLH E++W +T+P FS +E R       SD H++RL  I+
Sbjct  497  RKSSTLESKDVLLHLEKNWKLTIPGFSSEERRHVTDHPPSDAHKKRLDVIR  547



>ref|XP_003229639.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Anolis carolinensis]
Length=161

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N+ILSK+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQILSKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_007892954.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Callorhinchus milii]
 ref|XP_007892955.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Callorhinchus milii]
Length=161

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ +  C LA+HRKS+TLE K
Sbjct  55   NQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVSAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  DEIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|KFU83685.1| Transcription initiation factor TFIID subunit 12 [Chaetura pelagica]
Length=161

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_006631324.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Lepisosteus oculatus]
Length=165

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  798  RILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKD  619
            ++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE KD
Sbjct  60   QVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVKD  119

Query  618  ILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            + LH ER WN+ +P F  DEIR YKK  T++ H++R+A I++++
Sbjct  120  VQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTT  163



>gb|EYU21330.1| hypothetical protein MIMGU_mgv1a008631mg [Erythranthe guttata]
Length=367

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD +VED+L++IAD F++S+T F C+LAKH
Sbjct  205  SSSQGTEANNQLLGKRKIQDLVSQLDLNGKLDPDVEDLLLEIADNFIDSVTAFSCTLAKH  264

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSST+EAKD+L H E++WN+T+P FS +E +   +   SD H++R+ AI+
Sbjct  265  RKSSTVEAKDVLFHLEKNWNLTIPGFSSEEKKNKPEHPQSDAHKKRMDAIR  315



>ref|NP_079855.2| transcription initiation factor TFIID subunit 12 [Mus musculus]
 ref|XP_006539172.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Mus musculus]
 ref|XP_006539173.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Mus musculus]
 ref|XP_006539170.2| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Mus musculus]
 sp|Q8VE65.1|TAF12_MOUSE RecName: Full=Transcription initiation factor TFIID subunit 12; 
AltName: Full=Transcription initiation factor TFIID 20 kDa 
subunits; Short=TAFII-20; Short=TAFII20 [Mus musculus]
 gb|AAH19668.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor [Mus musculus]
 dbj|BAE21426.1| unnamed protein product [Mus musculus]
 gb|EDL30115.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor [Mus musculus]
Length=161

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_004425897.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
2 [Ceratotherium simum simum]
 ref|XP_004425898.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
3 [Ceratotherium simum simum]
Length=161

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_011810901.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Colobus angolensis palliatus]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|ADO28126.1| transcription initiation factor tfIId subunit 12 [Ictalurus furcatus]
Length=162

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  798  RILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKD  619
            ++LSK+ +Q+LV +IDP  +LD +VE++L+ +AD+F+ES+ T  C LA+HRKS+TLE KD
Sbjct  57   QVLSKKKLQDLVREIDPNEQLDEDVEEMLLQVADDFIESVVTAACQLARHRKSNTLEVKD  116

Query  618  ILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            + LH ER WN+ +P F  DEIR YKK  T++ H++R+A I++++
Sbjct  117  VQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>ref|NP_001108508.1| transcription initiation factor TFIID subunit 12 [Rattus norvegicus]
 ref|XP_006239130.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Rattus norvegicus]
 gb|EDL80620.1| rCG31161, isoform CRA_a [Rattus norvegicus]
 gb|AAI58611.1| LOC682902 protein [Rattus norvegicus]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_008052974.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Tarsius 
syrichta]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|NP_005635.1| transcription initiation factor TFIID subunit 12 [Homo sapiens]
 ref|NP_001128690.1| transcription initiation factor TFIID subunit 12 [Homo sapiens]
 ref|XP_010828487.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Bison bison bison]
 ref|XP_010828488.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Bison bison bison]
 ref|XP_010828489.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Bison bison bison]
 sp|Q16514.1|TAF12_HUMAN RecName: Full=Transcription initiation factor TFIID subunit 12; 
AltName: Full=Transcription initiation factor TFIID 20/15 
kDa subunits; Short=TAFII-20/TAFII-15; Short=TAFII20/TAFII15 
[Homo sapiens]
 emb|CAA58826.1| PolII transcription factor TFTIID [Homo sapiens]
 dbj|BAA09112.1| TFIID subunit p22 [Homo sapiens]
 gb|AAC50600.1| TAF20 [Homo sapiens]
 gb|AAH11986.1| TAF12 protein [Homo sapiens]
 gb|AAO13491.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa [Homo sapiens]
 gb|AAP35678.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa [Homo sapiens]
 gb|AAX41842.1| TAF12 RNA polymerase II TATA box binding protein-associated factor 
[synthetic construct]
 gb|AAX41843.1| TAF12 RNA polymerase II TATA box binding protein-associated factor 
[synthetic construct]
 gb|EAX07682.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa, isoform CRA_c [Homo sapiens]
 gb|EAX07683.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa, isoform CRA_c [Homo sapiens]
 gb|ABM84665.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa [synthetic construct]
 gb|ABM92197.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa [synthetic construct]
 dbj|BAI46687.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa [synthetic construct]
 gb|AIC49832.1| TAF12, partial [synthetic construct]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_003471311.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Cavia porcellus]
 ref|XP_006175516.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Camelus ferus]
 ref|XP_006175517.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Camelus ferus]
 ref|XP_006196939.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Vicugna 
pacos]
 ref|XP_008846165.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Nannospalax galili]
 ref|XP_010979964.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Camelus dromedarius]
 ref|XP_010979965.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Camelus dromedarius]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|KHN01400.1| Transcription initiation factor TFIID subunit 12 [Glycine soja]
Length=570

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV Q+DP G+LD EV D+L+++AD+F++S TT GC LAKH
Sbjct  401  SSSQGTEATNQVLGKRKIQDLVAQVDPQGRLDPEVIDLLLELADDFLDSATTHGCVLAKH  460

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+ D+LLH E++W++T+P +S +E +   KP  +D+H+ RL  ++
Sbjct  461  RKSSTLESNDLLLHLEKNWDLTIPGYSSEEKKNQSKPQLNDLHKRRLDMVR  511



>ref|NP_001029926.1| transcription initiation factor TFIID subunit 12 [Bos taurus]
 ref|XP_004005109.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Ovis aries]
 ref|XP_004005110.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Ovis aries]
 ref|XP_005203291.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Bos taurus]
 ref|XP_005203292.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Bos taurus]
 ref|XP_005676821.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Capra hircus]
 ref|XP_005676822.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Capra hircus]
 ref|XP_006862276.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Chrysochloris 
asiatica]
 ref|XP_006049560.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Bubalus bubalis]
 ref|XP_006049561.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X4 [Bubalus bubalis]
 ref|XP_012005882.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Ovis aries]
 ref|XP_011968948.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Ovis aries musimon]
 ref|XP_011981743.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X5 [Ovis aries musimon]
 ref|XP_011981744.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X5 [Ovis aries musimon]
 ref|XP_011981745.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X5 [Ovis aries musimon]
 ref|XP_012009542.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Ovis 
aries musimon]
 sp|Q3T174.1|TAF12_BOVIN RecName: Full=Transcription initiation factor TFIID subunit 12; 
AltName: Full=Transcription initiation factor TFIID 20/15 
kDa subunits; Short=TAFII-20/TAFII-15; Short=TAFII20/TAFII15 
[Bos taurus]
 gb|AAI02083.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa [Bos taurus]
 tpg|DAA32140.1| TPA: transcription initiation factor TFIID subunit 12 [Bos taurus]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_004705110.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Echinops 
telfairi]
 ref|XP_005079593.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Mesocricetus auratus]
 ref|XP_005079594.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Mesocricetus auratus]
 ref|XP_007522497.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Erinaceus 
europaeus]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|AAP36430.1| Homo sapiens TAF12 RNA polymerase II, TATA box binding protein 
(TBP)-associated factor, 20kDa [synthetic construct]
 gb|AAX43441.1| TAF12 RNA polymerase II TATA box binding protein-associated factor, 
partial [synthetic construct]
 gb|AAX43442.1| TAF12 RNA polymerase II TATA box binding protein-associated factor, 
partial [synthetic construct]
Length=162

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_004592230.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Ochotona 
princeps]
 ref|XP_005875161.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Myotis 
brandtii]
 ref|XP_006097305.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Myotis 
lucifugus]
 ref|XP_006776566.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Myotis 
davidii]
 ref|XP_006924397.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pteropus alecto]
 ref|XP_006924398.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Pteropus alecto]
 ref|XP_008146205.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Eptesicus 
fuscus]
 ref|XP_008146206.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Eptesicus 
fuscus]
 ref|XP_011356057.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pteropus vampyrus]
 ref|XP_011356058.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pteropus vampyrus]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|NP_001273972.1| transcription initiation factor TFIID subunit 12 [Canis lupus 
familiaris]
 ref|XP_001153380.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pan troglodytes]
 ref|XP_513257.2| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pan troglodytes]
 ref|XP_002716122.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Oryctolagus cuniculus]
 ref|XP_003271760.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
1 [Nomascus leucogenys]
 ref|XP_003271761.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
2 [Nomascus leucogenys]
 ref|XP_003415489.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Loxodonta 
africana]
 ref|XP_003498423.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Cricetulus griseus]
 ref|XP_003989820.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Felis catus]
 ref|XP_004025361.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
1 [Gorilla gorilla gorilla]
 ref|XP_004025362.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
2 [Gorilla gorilla gorilla]
 ref|XP_004266628.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
1 [Orcinus orca]
 ref|XP_004266629.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
2 [Orcinus orca]
 ref|XP_004331041.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Tursiops truncatus]
 ref|XP_004377084.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
1 [Trichechus manatus latirostris]
 ref|XP_004377085.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
2 [Trichechus manatus latirostris]
 ref|XP_004394702.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
1 [Odobenus rosmarus divergens]
 ref|XP_004394703.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
2 [Odobenus rosmarus divergens]
 ref|XP_004603576.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Sorex araneus]
 ref|XP_004603577.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Sorex araneus]
 ref|XP_004671312.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Jaculus 
jaculus]
 ref|XP_004642949.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Octodon degus]
 ref|XP_004642950.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Octodon degus]
 ref|XP_004741069.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Mustela putorius furo]
 ref|XP_004783334.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Mustela putorius furo]
 ref|XP_005353189.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Microtus ochrogaster]
 ref|XP_005353190.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Microtus ochrogaster]
 ref|XP_005317752.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Ictidomys tridecemlineatus]
 ref|XP_005317753.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Ictidomys tridecemlineatus]
 ref|XP_005544278.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Macaca fascicularis]
 ref|XP_005544279.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Macaca fascicularis]
 ref|XP_006975645.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Peromyscus maniculatus bairdii]
 ref|XP_007097966.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Panthera tigris altaica]
 ref|XP_007100940.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Physeter catodon]
 ref|XP_007100941.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X4 [Physeter catodon]
 ref|XP_007100942.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X5 [Physeter catodon]
 ref|XP_007170601.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Balaenoptera acutorostrata scammoni]
 ref|XP_007461872.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Lipotes vexillifer]
 ref|XP_007461873.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Lipotes vexillifer]
 ref|XP_007625010.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Cricetulus griseus]
 ref|XP_007625017.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Cricetulus griseus]
 ref|XP_007634564.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Cricetulus griseus]
 ref|XP_007934019.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Orycteropus 
afer afer]
 ref|XP_007934020.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Orycteropus 
afer afer]
 ref|XP_007977949.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Chlorocebus 
sabaeus]
 ref|XP_007977950.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Chlorocebus 
sabaeus]
 ref|XP_008566901.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Galeopterus variegatus]
 ref|XP_008566903.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Galeopterus variegatus]
 ref|XP_008566904.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Galeopterus variegatus]
 ref|XP_008566905.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Galeopterus variegatus]
 ref|XP_008692733.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Ursus 
maritimus]
 ref|XP_008999008.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Callithrix jacchus]
 ref|XP_008999009.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Callithrix jacchus]
 ref|XP_008999010.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Callithrix jacchus]
 ref|XP_008951663.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Pan 
paniscus]
 ref|XP_008951664.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Pan 
paniscus]
 ref|XP_009450295.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pan troglodytes]
 ref|XP_009450302.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Pan troglodytes]
 ref|XP_010378637.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Rhinopithecus roxellana]
 ref|XP_010378638.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Rhinopithecus roxellana]
 ref|XP_010378640.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Rhinopithecus roxellana]
 ref|XP_010630494.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Fukomys 
damarensis]
 ref|XP_010630498.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Fukomys 
damarensis]
 ref|XP_010630507.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Fukomys 
damarensis]
 ref|XP_010593438.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Loxodonta 
africana]
 ref|XP_011227546.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Ailuropoda 
melanoleuca]
 ref|XP_011837127.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Mandrillus leucophaeus]
 ref|XP_011837128.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Mandrillus leucophaeus]
 ref|XP_011935239.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Cercocebus atys]
 ref|XP_011935240.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Cercocebus atys]
 ref|XP_011761414.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Macaca nemestrina]
 ref|XP_011761415.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Macaca nemestrina]
 gb|EGW01156.1| Transcription initiation factor TFIID subunit 12 [Cricetulus 
griseus]
 gb|EHH14525.1| hypothetical protein EGK_00467 [Macaca mulatta]
 gb|EHH62274.1| hypothetical protein EGM_20513 [Macaca fascicularis]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|NP_001187960.1| transcription initiation factor TFIID subunit 12 [Ictalurus punctatus]
 gb|ADO29359.1| transcription initiation factor tfIId subunit 12 [Ictalurus punctatus]
Length=162

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  798  RILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKD  619
            ++LSK+ +Q+LV +IDP  +LD +VE++L+ +AD+F+ES+ T  C LA+HRKS+TLE KD
Sbjct  57   QVLSKKKLQDLVREIDPNEQLDEDVEEMLLQVADDFIESVVTAACQLARHRKSNTLEVKD  116

Query  618  ILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            + LH ER WN+ +P F  DEIR YKK  T++ H++R+A I++++
Sbjct  117  VQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>ref|XP_006739953.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006739954.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Leptonychotes weddellii]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_004878186.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004878187.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Heterocephalus glaber]
 ref|XP_004850827.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004850828.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Heterocephalus glaber]
 gb|EHA98853.1| Transcription initiation factor TFIID subunit 12 [Heterocephalus 
glaber]
Length=161

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|KFH73728.1| transcription initiation factor TFIID subunit D10, partial [Mortierella 
verticillata NRRL 6337]
Length=127

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -3

Query  810  EPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTL  631
            E  + +++KR IQE+V QIDP  +L+ EVEDIL+++ADEF+ES+T F C LA HRKSSTL
Sbjct  12   ESSSSLITKRKIQEMVAQIDPSERLEPEVEDILLELADEFIESVTQFACKLATHRKSSTL  71

Query  630  EAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVKTTN  466
            E KD+ LH ER+WNI +P F+ +EIR+ +K      H +++ A+  +  A+  T+
Sbjct  72   EVKDVQLHLERNWNIRIPGFASEEIRSVRKSNVPASHTQKVTAVNNAKAAMAGTS  126



>ref|XP_007249707.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Astyanax mexicanus]
Length=162

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  798  RILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKD  619
            ++LSK+ +Q+LV +IDP  +LD +VE++L+ +AD+F+ES+ T  C LA+HRKS+TLE KD
Sbjct  57   QVLSKKKLQDLVREIDPNEQLDEDVEEMLLQVADDFIESVVTAACQLARHRKSNTLEVKD  116

Query  618  ILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            + LH ER WN+ +P F  DEIR YKK  T++ H++R+A I++++
Sbjct  117  VQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>ref|XP_007442021.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X2 [Python bivittatus]
 ref|XP_007442022.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X3 [Python bivittatus]
 ref|XP_007442023.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X4 [Python bivittatus]
 ref|XP_007442024.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X5 [Python bivittatus]
 ref|XP_007442025.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X6 [Python bivittatus]
 ref|XP_007442026.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X7 [Python bivittatus]
Length=161

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N+IL+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQILTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_004078314.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Oryzias 
latipes]
Length=131

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  25   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  84

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR YKK  T++ H++R+A I++++
Sbjct  85   DVQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTT  129



>dbj|BAB25276.1| unnamed protein product [Mus musculus]
Length=161

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I+ ++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRNTT  159



>gb|KFP43820.1| Transcription initiation factor TFIID subunit 12 [Chlamydotis 
macqueenii]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|KFO93706.1| Transcription initiation factor TFIID subunit 12 [Buceros rhinoceros 
silvestris]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|ACO09956.1| Transcription initiation factor TFIID subunit 12 [Osmerus mordax]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  798  RILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKD  619
            ++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE KD
Sbjct  56   QVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVKD  115

Query  618  ILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            + LH ER WN+ +P +  DEIR YKK  T++ H++R+A I++++
Sbjct  116  VQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_002189028.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
1 [Taeniopygia guttata]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_005993185.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Latimeria chalumnae]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  804  CNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEA  625
             N++L+K+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE 
Sbjct  54   ANQVLTKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEV  113

Query  624  KDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            KD+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  114  KDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_005509739.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Columba livia]
 gb|EMC82789.1| Transcription initiation factor TFIID subunit 12 [Columba livia]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_005529902.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pseudopodoces humilis]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_007170600.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Balaenoptera acutorostrata scammoni]
Length=195

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  89   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  148

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  149  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  193



>ref|XP_005286224.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Chrysemys picta bellii]
 ref|XP_005286225.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Chrysemys picta bellii]
 ref|XP_007064900.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Chelonia mydas]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_005058471.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Ficedula albicollis]
 ref|XP_006267189.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Alligator mississippiensis]
 ref|XP_009095776.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Serinus 
canaria]
 ref|XP_009469160.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Nipponia nippon]
 ref|XP_009886630.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Charadrius vociferus]
 ref|XP_010411020.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Corvus cornix cornix]
 ref|XP_010574503.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X3 [Haliaeetus leucocephalus]
 ref|XP_011582472.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Aquila chrysaetos canadensis]
 ref|XP_011582473.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Aquila chrysaetos canadensis]
 ref|XP_011582474.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Aquila chrysaetos canadensis]
 gb|KFM05448.1| Transcription initiation factor TFIID subunit 12 [Aptenodytes 
forsteri]
 gb|KFO62519.1| Transcription initiation factor TFIID subunit 12 [Corvus brachyrhynchos]
 gb|KFP21704.1| Transcription initiation factor TFIID subunit 12 [Egretta garzetta]
 gb|KFP51930.1| Transcription initiation factor TFIID subunit 12 [Cathartes aura]
 gb|KFP57184.1| Transcription initiation factor TFIID subunit 12 [Cariama cristata]
 gb|KFP83358.1| Transcription initiation factor TFIID subunit 12 [Acanthisitta 
chloris]
 gb|KFP93511.1| Transcription initiation factor TFIID subunit 12 [Haliaeetus 
albicilla]
 gb|KFQ19461.1| Transcription initiation factor TFIID subunit 12 [Mesitornis 
unicolor]
 gb|KFQ42089.1| Transcription initiation factor TFIID subunit 12 [Nestor notabilis]
 gb|KFQ53878.1| Transcription initiation factor TFIID subunit 12 [Pelecanus crispus]
 gb|KFQ67139.1| Transcription initiation factor TFIID subunit 12 [Phaethon lepturus]
 gb|KFQ81503.1| Transcription initiation factor TFIID subunit 12 [Phoenicopterus 
ruber ruber]
 gb|KFR03601.1| Transcription initiation factor TFIID subunit 12 [Nipponia nippon]
 gb|KFV01878.1| Transcription initiation factor TFIID subunit 12 [Tauraco erythrolophus]
 gb|KFV40851.1| Transcription initiation factor TFIID subunit 12 [Gavia stellata]
 gb|KFW07569.1| Transcription initiation factor TFIID subunit 12 [Fulmarus glacialis]
 gb|KFW65898.1| Transcription initiation factor TFIID subunit 12 [Pygoscelis 
adeliae]
 gb|KFW79645.1| Transcription initiation factor TFIID subunit 12 [Manacus vitellinus]
 gb|KFW94420.1| Transcription initiation factor TFIID subunit 12 [Phalacrocorax 
carbo]
 gb|KGL95976.1| Transcription initiation factor TFIID subunit 12 [Charadrius 
vociferus]
Length=161

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|KFQ24471.1| Transcription initiation factor TFIID subunit 12 [Merops nubicus]
Length=161

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|KFO79426.1| Transcription initiation factor TFIID subunit 12 [Cuculus canorus]
Length=161

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_005494213.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Zonotrichia 
albicollis]
Length=161

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|NP_001026065.1| transcription initiation factor TFIID subunit 12 [Gallus gallus]
 ref|XP_006021947.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Alligator sinensis]
 emb|CAG31620.1| hypothetical protein RCJMB04_8m22 [Gallus gallus]
 gb|KFO04700.1| Transcription initiation factor TFIID subunit 12 [Balearica regulorum 
gibbericeps]
 gb|KFP90524.1| Transcription initiation factor TFIID subunit 12 [Apaloderma 
vittatum]
Length=161

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_007625003.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Cricetulus griseus]
 ref|XP_007634563.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Cricetulus griseus]
Length=190

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  84   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  143

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  144  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  188



>gb|KFV70710.1| Transcription initiation factor TFIID subunit 12 [Picoides pubescens]
Length=161

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|KFR17297.1| Transcription initiation factor TFIID subunit 12 [Opisthocomus 
hoazin]
 gb|KFV11800.1| Transcription initiation factor TFIID subunit 12 [Pterocles gutturalis]
Length=160

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  54   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  113

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  114  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  158



>ref|XP_004678750.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Condylura cristata]
 ref|XP_004678751.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Condylura cristata]
Length=161

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSTTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_010796175.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Notothenia 
coriiceps]
Length=131

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -3

Query  825  AAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHR  646
            A  T    +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HR
Sbjct  17   AGRTSPEGSQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHR  76

Query  645  KSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            KS+TLE KD+ LH ER WN+ +P +  DEIR +KK  T++ H++R+A I++++
Sbjct  77   KSNTLEVKDVQLHLERQWNMWIPGYGSDEIRPFKKACTTEAHKQRMALIRKTT  129



>ref|XP_008496666.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Calypte 
anna]
 gb|KFP04447.1| Transcription initiation factor TFIID subunit 12 [Calypte anna]
Length=160

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  54   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  113

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  114  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  158



>gb|KFZ62102.1| Transcription initiation factor TFIID subunit 12 [Podiceps cristatus]
Length=161

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_005142495.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Melopsittacus 
undulatus]
Length=161

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>gb|EAX07681.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa, isoform CRA_b [Homo sapiens]
Length=199

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  93   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  152

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  153  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  197



>ref|XP_007892953.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Callorhinchus milii]
Length=222

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ +  C LA+HRKS+TLE K
Sbjct  116  NQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVSAACQLARHRKSNTLEVK  175

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  DEIR YKK  T++ H++R+A I++++
Sbjct  176  DVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTT  220



>ref|XP_010199699.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Colius 
striatus]
 gb|KFP31501.1| Transcription initiation factor TFIID subunit 12 [Colius striatus]
Length=161

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_006883493.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Elephantulus edwardii]
Length=161

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+E++ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIENVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_008121977.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Anolis carolinensis]
Length=212

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N+ILSK+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  106  NQILSKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



>ref|XP_001520104.2| PREDICTED: transcription initiation factor TFIID subunit 12 [Ornithorhynchus 
anatinus]
Length=161

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_011810900.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Colobus angolensis palliatus]
Length=199

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  93   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  152

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  153  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  197



>ref|XP_010531871.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Tarenaya hassleriana]
Length=671

 Score =   132 bits (331),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+D  GKLD +VED+L++IAD+F++S+TTF CSLAKH
Sbjct  500  SSSQGTEATNQLLGKRKIQDLVSQVDIHGKLDPDVEDLLLEIADDFIDSVTTFACSLAKH  559

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSSVAVK--  475
            RKSSTLE +D+LLH E++ ++T+P FS ++    K  + SD+H++RL  ++    + K  
Sbjct  560  RKSSTLEPRDVLLHLEKNLHLTVPGFSSEDRHRKKTVVPSDLHKKRLEMVRTLLESSKPE  619

Query  474  ---TTNTKSAVGQGGNSKTTPLGKGPINIL  394
                +N +  + QG      P+G GP ++L
Sbjct  620  TNNASNPRETIRQG---MVNPMGPGPSHVL  646



>ref|XP_010006473.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Chaetura 
pelagica]
Length=212

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  106  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



>ref|XP_003341073.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Monodelphis domestica]
 ref|XP_003765069.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Sarcophilus 
harrisii]
 ref|XP_007491542.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X6 [Monodelphis domestica]
Length=161

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_004398021.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Odobenus rosmarus divergens]
Length=193

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  87   NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  146

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  147  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  191



>ref|XP_002811215.3| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 12, partial [Pongo abelii]
Length=112

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -3

Query  795  ILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKDI  616
            +L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE KD+
Sbjct  8    VLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDV  67

Query  615  LLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
             LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  68   QLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  110



>ref|XP_006239129.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Rattus norvegicus]
Length=213

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_008777545.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
isoform X1 [Phoenix dactylifera]
Length=623

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQ+LV+Q+DP  KLD EVED+L+++AD F+ S+TTF CSLAKH
Sbjct  456  SSSQGMEATNQLLGKRKIQDLVSQVDPLCKLDPEVEDLLLEMADNFINSVTTFACSLAKH  515

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSS LEAKD+LLH E++W +T+P ++ +E     K L  D+H++RL  ++
Sbjct  516  RKSSMLEAKDVLLHLEKNWKLTVPGYTKEEQNHQGKSLPVDVHKKRLEMVQ  566



>ref|XP_006934549.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Felis catus]
 ref|XP_007097965.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Panthera tigris altaica]
 ref|XP_010378636.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Rhinopithecus roxellana]
Length=213

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>dbj|BAB28669.1| unnamed protein product [Mus musculus]
Length=161

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +L  +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   NQVLTKKKLQDLVREVDPNEQLGEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WNI +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNIWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_003976007.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Takifugu 
rubripes]
 ref|XP_011615134.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Takifugu 
rubripes]
Length=131

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++L+K+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  25   SQVLTKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  84

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  DEIR +KK  T++ H++R+A I++++
Sbjct  85   DVQLHLERQWNMWIPGFGSDEIRPFKKACTTEAHKQRMALIRKTT  129



>gb|KFO37660.1| Transcription initiation factor TFIID subunit 12 [Fukomys damarensis]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_005353188.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Microtus ochrogaster]
 ref|XP_007634562.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Cricetulus griseus]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_011810899.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Colobus angolensis palliatus]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_010979962.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Camelus dromedarius]
 ref|XP_010979963.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Camelus dromedarius]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_006975644.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Peromyscus maniculatus bairdii]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_004005111.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Ovis aries]
 ref|XP_005203287.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Bos taurus]
 ref|XP_005203290.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Bos taurus]
 ref|XP_005676820.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Capra hircus]
 ref|XP_006049558.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Bubalus bubalis]
 ref|XP_006049559.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Bubalus bubalis]
 ref|XP_012005836.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Ovis aries]
 ref|XP_012005857.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Ovis aries]
 ref|XP_011981740.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X4 [Ovis aries musimon]
 ref|XP_011981741.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X4 [Ovis aries musimon]
 ref|XP_011981742.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X4 [Ovis aries musimon]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_002750565.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Callithrix jacchus]
 ref|XP_001113189.2| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
2 [Macaca mulatta]
 ref|XP_004741068.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Mustela putorius furo]
 ref|XP_004783333.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Mustela putorius furo]
 ref|XP_005317751.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Ictidomys tridecemlineatus]
 ref|XP_005544277.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Macaca fascicularis]
 ref|XP_005617755.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Canis lupus familiaris]
 ref|XP_007100938.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Physeter catodon]
 ref|XP_007100939.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Physeter catodon]
 ref|XP_007170599.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Balaenoptera acutorostrata scammoni]
 ref|XP_008264086.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Oryctolagus cuniculus]
 ref|XP_009450286.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pan troglodytes]
 ref|XP_011837125.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Mandrillus leucophaeus]
 ref|XP_011935238.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Cercocebus atys]
 ref|XP_011761413.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Macaca nemestrina]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_006924396.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pteropus alecto]
 ref|XP_011356056.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pteropus vampyrus]
 gb|ELK02051.1| Transcription initiation factor TFIID subunit 12 [Pteropus alecto]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_005246035.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Homo sapiens]
 ref|XP_010828483.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Bison bison bison]
 ref|XP_010828484.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Bison bison bison]
 ref|XP_010828485.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Bison bison bison]
 ref|XP_010828486.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Bison bison bison]
 gb|EAX07680.1| TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated 
factor, 20kDa, isoform CRA_a [Homo sapiens]
Length=213

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_010946253.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 12 [Camelus bactrianus]
Length=213

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_004425896.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
1 [Ceratotherium simum simum]
Length=213

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  107  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  166

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  167  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  211



>ref|XP_006164631.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X4 [Tupaia chinensis]
 ref|XP_006164632.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X5 [Tupaia chinensis]
 ref|XP_006164633.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X6 [Tupaia chinensis]
Length=161

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  55   SQVLTKKKLQDLVREVDPSEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  114

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  115  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  159



>ref|XP_010540091.1| PREDICTED: transcription initiation factor TFIID subunit 12b 
[Tarenaya hassleriana]
Length=702

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 95/133 (71%), Gaps = 5/133 (4%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  N++L KR IQELV+Q+D  GKLD +VED+L++IAD+F++S+TTF CSLAKH
Sbjct  534  SSSQGTEATNQLLGKRKIQELVSQVDIRGKLDPDVEDLLLEIADDFIDSVTTFACSLAKH  593

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERL----AAIKRSSVA  481
            RKSSTLE KD+LLH E++ ++T+P FS  E R  KK + SD+H++RL    A +  S   
Sbjct  594  RKSSTLEPKDVLLHLEKNLHLTVPGFS-REDRHQKKTVPSDLHKKRLEMVRALLDSSETV  652

Query  480  VKTTNTKSAVGQG  442
               +N +  + QG
Sbjct  653  TNGSNPRETIRQG  665



>gb|EXX73443.1| Taf12p [Rhizophagus irregularis DAOM 197198w]
Length=428

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -3

Query  795  ILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAKDI  616
            +L KR +Q+LV QIDP  +L+ EVE++L++IADEF+ S+ +F C LAKHRKS TLE KD+
Sbjct  313  LLPKRKVQQLVDQIDPKERLEPEVEEMLLEIADEFISSVASFACLLAKHRKSDTLEVKDL  372

Query  615  LLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
             LH ER+WNI +P F+ DEIR+ +KP+ S  H+++LAA+ ++
Sbjct  373  QLHLERNWNIRIPGFASDEIRSVRKPVVSAGHQQKLAAVAQA  414



>ref|XP_010866711.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Esox 
lucius]
 ref|XP_010866712.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Esox 
lucius]
Length=162

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++L+K+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  56   SQVLTKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  115

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR YKK  T++ H++R+A I++++
Sbjct  116  DVQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>ref|XP_010729903.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Larimichthys 
crocea]
Length=131

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  25   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  84

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR +KK  T++ H++R+A I++++
Sbjct  85   DVQLHLERQWNMWIPGYGSDEIRPFKKACTTEAHKQRMALIRKTT  129



>ref|XP_008566899.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Galeopterus variegatus]
Length=230

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKSSTLE K
Sbjct  124  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK  183

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  184  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  228



>ref|XP_008322428.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Cynoglossus 
semilaevis]
 ref|XP_008322429.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Cynoglossus 
semilaevis]
Length=132

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  26   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  85

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR +KK  T++ H++R+A I++++
Sbjct  86   DVQLHLERQWNMWIPGYGSDEIRPFKKACTTEAHKQRMALIRKTT  130



>ref|NP_001135281.1| transcription initiation factor TFIID subunit 12 [Salmo salar]
 gb|ACI34218.1| Transcription initiation factor TFIID subunit 12 [Salmo salar]
 gb|ACM08247.1| Transcription initiation factor TFIID subunit 12 [Salmo salar]
 gb|ACM08271.1| Transcription initiation factor TFIID subunit 12 [Salmo salar]
 gb|ACM08394.1| Transcription initiation factor TFIID subunit 12 [Salmo salar]
 gb|ACM09667.1| Transcription initiation factor TFIID subunit 12 [Salmo salar]
Length=162

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F++S+ T  C LA+HRKS+TLE K
Sbjct  56   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIDSVVTAACQLARHRKSNTLEVK  115

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR YKK  T++ H++R+A I++++
Sbjct  116  DVQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>emb|CDQ72656.1| unnamed protein product [Oncorhynchus mykiss]
Length=162

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F++S+ T  C LA+HRKS+TLE K
Sbjct  56   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIDSVVTAACQLARHRKSNTLEVK  115

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR YKK  T++ H++R+A I++++
Sbjct  116  DVQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>gb|ACM08607.1| Transcription initiation factor TFIID subunit 12 [Salmo salar]
 gb|ACM09757.1| Transcription initiation factor TFIID subunit 12 [Salmo salar]
Length=162

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F++S+ T  C LA+HRKS+TLE K
Sbjct  56   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIDSVVTAACQLARHRKSNTLEVK  115

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR YKK  T++ H++R+A I++++
Sbjct  116  DVQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTT  160



>ref|XP_010931213.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Elaeis guineensis]
Length=604

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  828  SAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKH  649
            S+++  E  +++L KR IQ+LV+Q+DP  KLD EVED+L+++AD F++S+TTF CSLAKH
Sbjct  437  SSSQGMEATDQLLGKRKIQDLVSQVDPLCKLDPEVEDLLLEMADNFIDSVTTFACSLAKH  496

Query  648  RKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIK  496
            RKSSTLE+KD++LH E++W +T+P ++ +E     K L  D+H++RL  ++
Sbjct  497  RKSSTLESKDVMLHLEKNWKLTVPGYTKEEQNHQGKSLPVDVHKKRLEMVR  547



>gb|ETE65469.1| Transcription initiation factor TFIID subunit 12, partial [Ophiophagus 
hannah]
Length=212

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N+IL+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  106  NQILTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



>ref|XP_010322827.1| PREDICTED: transcription initiation factor TFIID subunit 12b-like 
[Solanum lycopersicum]
Length=305

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  831  TSAAETEEPCNRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAK  652
            +S+++  E  N+ L KR IQ+LV+Q+DP G++D EVE  L++IAD+F++S+TTF C+LAK
Sbjct  143  SSSSQGAEASNQFLGKRKIQDLVSQVDPQGRVDPEVEQFLLEIADDFIDSVTTFSCNLAK  202

Query  651  HRKSSTLEAKDILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAI  499
            HRKSSTLE+KDILLH E+ WN+T+P FS ++ +   +  + D+ +ERL  I
Sbjct  203  HRKSSTLESKDILLHLEKDWNLTVPGFSSEDKKHCPEHSSGDLCKERLEMI  253



>ref|XP_008275627.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Stegastes 
partitus]
Length=131

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  25   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  84

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR +KK  T++ H++R+A I++++
Sbjct  85   DVQLHLERQWNMWIPGYGSDEIRPFKKACTTEAHKQRMALIRKTT  129



>ref|XP_005795997.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X1 [Xiphophorus maculatus]
 ref|XP_005795998.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X2 [Xiphophorus maculatus]
 ref|XP_007557335.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Poecilia 
formosa]
 ref|XP_007557336.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Poecilia 
formosa]
 ref|XP_008429368.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Poecilia 
reticulata]
 ref|XP_008429370.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Poecilia 
reticulata]
Length=131

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  25   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  84

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR +KK  T++ H++R+A I++++
Sbjct  85   DVQLHLERQWNMWIPGYGSDEIRPFKKACTTEAHKQRMALIRKTT  129



>ref|XP_007442020.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X1 [Python bivittatus]
Length=212

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N+IL+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  106  NQILTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



>ref|XP_003450546.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X1 [Oreochromis niloticus]
 ref|XP_004551006.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Maylandia zebra]
 ref|XP_005455325.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X2 [Oreochromis niloticus]
 ref|XP_005736196.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Pundamilia nyererei]
 ref|XP_005938279.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Haplochromis burtoni]
 ref|XP_006791723.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Neolamprologus brichardi]
Length=131

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  25   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  84

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR +KK  T++ H++R+A I++++
Sbjct  85   DVQLHLERQWNMWIPGYGSDEIRPFKKACTTEAHKQRMALIRKTT  129



>ref|XP_006112036.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X4 [Pelodiscus sinensis]
Length=207

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  101  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  160

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  161  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  205



>ref|XP_009903229.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Picoides 
pubescens]
Length=212

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  106  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



>ref|NP_001081155.1| transcription initiation factor TFIID subunit 12 [Xenopus laevis]
 sp|Q91858.1|TAF12_XENLA RecName: Full=Transcription initiation factor TFIID subunit 12; 
AltName: Full=TFIID subunit p22; AltName: Full=Transcription 
initiation factor TFIID 20/15 kDa subunits; Short=TAFII-20/TAFII-15; 
Short=TAFII20/TAFII15 [Xenopus laevis]
 dbj|BAA09789.1| TFIID subunit p22 [Xenopus laevis]
 gb|AAH68646.1| Taf12-a protein [Xenopus laevis]
Length=164

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++LSK+ + +LV ++DP  +LD +VE++L+ IAD+F+ES+ +  C LA+HRKS+TLE K
Sbjct  58   NQVLSKKKLHDLVREVDPNEQLDEDVEEMLLQIADDFIESVVSAACQLARHRKSNTLEVK  117

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRS  490
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A IK++
Sbjct  118  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIKKT  161



>emb|CDQ80222.1| unnamed protein product [Oncorhynchus mykiss]
Length=163

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++LSK+ +Q+LV +IDP  +LD +VE++L+ IAD+F++S+ T  C LA+HRKS+TLE K
Sbjct  57   SQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIDSVVTAACQLARHRKSNTLEVK  116

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P +  DEIR YKK  T++ H++R+A I++++
Sbjct  117  DVQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTT  161



>ref|XP_008948260.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Merops 
nubicus]
Length=212

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  106  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



>emb|CAF94342.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=160

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            +++L+K+ +Q+LV +IDP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  54   SQVLTKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  113

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  DEIR +KK  T++ H++R+A I++++
Sbjct  114  DVQLHLERQWNMWIPGFGSDEIRPFKKACTTEAHKQRMALIRKTT  158



>ref|XP_005028592.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Anas 
platyrhynchos]
Length=212

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  106  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



>ref|XP_010122593.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Chlamydotis 
macqueenii]
Length=212

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  801  NRILSKRSIQELVTQIDPPGKLDAEVEDILVDIADEFVESLTTFGCSLAKHRKSSTLEAK  622
            N++L+K+ +Q+LV ++DP  +LD +VE++L+ IAD+F+ES+ T  C LA+HRKS+TLE K
Sbjct  106  NQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVK  165

Query  621  DILLHAERHWNITLPVFSGDEIRTYKKPLTSDIHRERLAAIKRSS  487
            D+ LH ER WN+ +P F  +EIR YKK  T++ H++R+A I++++
Sbjct  166  DVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTT  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798831613323