BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13630

Length=880
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    382   2e-127   Sesamum indicum [beniseed]
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    381   6e-127   Cucumis melo [Oriental melon]
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    380   1e-126   Cucumis melo [Oriental melon]
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    380   1e-126   Mesembryanthemum crystallinum
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    378   6e-126   Sesamum indicum [beniseed]
gb|AAN84539.1|  putative plastidic glutamine synthetase                 370   7e-126   Gazania splendens
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    378   1e-125   Nelumbo nucifera [Indian lotus]
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    378   1e-125   Eucalyptus grandis [rose gum]
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    377   1e-125   Eucalyptus grandis [rose gum]
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    377   2e-125   Eucalyptus grandis [rose gum]
ref|XP_012069490.1|  PREDICTED: glutamine synthetase leaf isozyme...    377   3e-125   Jatropha curcas
ref|XP_010041423.1|  PREDICTED: glutamine synthetase leaf isozyme...    374   3e-125   Eucalyptus grandis [rose gum]
gb|AIR07818.1|  chloroplastic glutamine synthetase GS2                  370   4e-125   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        376   5e-125   Glycine soja [wild soybean]
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    376   6e-125   Glycine max [soybeans]
gb|ACF17656.1|  putative glutamine synthase 2                           376   6e-125   Capsicum annuum
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    375   7e-125   Glycine max [soybeans]
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    375   7e-125   Prunus mume [ume]
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    375   9e-125   Cucumis sativus [cucumbers]
gb|KJB28233.1|  hypothetical protein B456_005G035800                    375   1e-124   Gossypium raimondii
gb|ABL89188.2|  plastid glutamine synthetase 2                          375   1e-124   Spinacia oleracea
ref|XP_002516801.1|  glutamine synthetase plant, putative               375   1e-124   Ricinus communis
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    375   1e-124   Musa acuminata subsp. malaccensis [pisang utan]
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    375   2e-124   Daucus carota [carrots]
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    374   2e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             374   3e-124   Prunus persica
gb|AAF17703.1|AF031082_1  glutamine synthetase                          374   3e-124   Canavalia lineata
gb|EYU43846.1|  hypothetical protein MIMGU_mgv1a010285mg                370   4e-124   Erythranthe guttata [common monkey flower]
gb|ACU24520.1|  unknown                                                 374   4e-124   Glycine max [soybeans]
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    374   4e-124   Beta vulgaris subsp. vulgaris [field beet]
gb|ADK27329.1|  plastid glutamine synthetase                            373   5e-124   Vigna radiata [mung bean]
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    374   5e-124   Tarenaya hassleriana [spider flower]
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        373   6e-124   Gossypium arboreum [tree cotton]
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    373   6e-124   Vitis vinifera
gb|AGV54414.1|  glutamine synthetase                                    373   6e-124   Phaseolus vulgaris [French bean]
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    373   6e-124   Cicer arietinum [garbanzo]
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             373   6e-124   Phaseolus vulgaris [French bean]
dbj|BAF62340.1|  glutamine synthetase                                   373   1e-123   Avicennia marina
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    373   1e-123   Pyrus x bretschneideri [bai li]
emb|CAN61808.1|  hypothetical protein VITISV_014295                     373   1e-123   Vitis vinifera
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    372   1e-123   Vitis vinifera
gb|AAO37651.1|  glutamine synthetase                                    372   1e-123   Medicago truncatula
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    372   1e-123   Malus domestica [apple tree]
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    372   1e-123   Medicago sativa [alfalfa]
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     372   2e-123   Nicotiana sylvestris
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     372   2e-123   Nicotiana tomentosiformis
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             372   2e-123   Eutrema salsugineum [saltwater cress]
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    372   2e-123   Pyrus x bretschneideri [bai li]
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    372   2e-123   Tarenaya hassleriana [spider flower]
gb|KJB37729.1|  hypothetical protein B456_006G218100                    372   2e-123   Gossypium raimondii
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    371   3e-123   
gb|AAN84537.1|  putative plastidic glutamine synthetase                 371   4e-123   Crataegus crus-galli
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                371   5e-123   Juglans nigra
emb|CDO98975.1|  unnamed protein product                                370   6e-123   Coffea canephora [robusta coffee]
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     370   6e-123   Brassica rapa
gb|ABY87178.1|  chloroplast glutamine synthetase                        370   7e-123   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    370   8e-123   Brassica rapa
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     370   9e-123   
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                370   1e-122   Erythranthe guttata [common monkey flower]
prf||1601519A  Gln synthetase                                           370   1e-122
gb|AAN84563.1|  glutamine synthetase                                    370   1e-122   Lotus japonicus
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         369   2e-122   Lotus japonicus
ref|NP_001237784.1|  glutamine synthetase precursor                     369   3e-122   
gb|AJI44225.1|  plastid glutamine synthetase                            369   3e-122   Boehmeria nivea [Chinese silk-plant]
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    369   3e-122   Pisum sativum [garden pea]
emb|CAA29057.1|  gluthamine synthetase                                  366   4e-122   Pisum sativum [garden pea]
emb|CAA73062.1|  plastidic glutamine synthetase precursor               368   4e-122   Brassica napus [oilseed rape]
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             368   5e-122   
ref|NP_198413.1|  glutamine synthetase 2                                368   5e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    368   5e-122   Camelina sativa [gold-of-pleasure]
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   368   5e-122   Citrus sinensis [apfelsine]
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    368   6e-122   Camelina sativa [gold-of-pleasure]
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             368   7e-122   Capsella rubella
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    367   7e-122   
gb|ACU18743.1|  unknown                                                 367   7e-122   Glycine max [soybeans]
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   368   8e-122   Citrus sinensis [apfelsine]
emb|CDY33684.1|  BnaC04g29670D                                          370   9e-122   Brassica napus [oilseed rape]
gb|AJD14836.1|  plastid glutamine synthetase                            367   1e-121   Boehmeria nivea [Chinese silk-plant]
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    368   1e-121   
gb|AKA60251.1|  GS                                                      367   1e-121   Hevea brasiliensis subsp. brasiliensis
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         367   1e-121   Lotus japonicus
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   367   1e-121   Citrus sinensis [apfelsine]
gb|AFH88076.1|  chloroplast glutamine synthetase protein                367   2e-121   Sesuvium portulacastrum [sea-purslane]
gb|AAL67439.1|  glutamine synthetase precursor                          366   5e-121   Lotus japonicus
ref|XP_007034566.1|  Glutamine synthetase 2                             369   6e-121   
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    365   6e-121   Elaeis guineensis
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             365   7e-121   Citrus clementina [clementine]
emb|CAB72423.1|  glutamine synthetase                                   365   8e-121   Brassica napus [oilseed rape]
gb|AAN84538.1|  putative plastidic glutamine synthetase                 364   2e-120   Spiraea nipponica
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  364   2e-120   Morus notabilis
ref|XP_002314425.1|  glutamine synthetase family protein                363   4e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    363   5e-120   Populus euphratica
ref|XP_002312733.1|  glutamine synthetase family protein                363   7e-120   
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    363   7e-120   Populus euphratica
ref|XP_011462784.1|  PREDICTED: glutamine synthetase leaf isozyme...    362   1e-119   Fragaria vesca subsp. vesca
dbj|BAD12057.1|  plastidic glutamine synthetase                         360   8e-119   Phragmites australis
ref|NP_001054133.1|  Os04g0659100                                       360   8e-119   
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1            360   9e-119   Lemna minor
gb|ACO59263.1|  chloroplast glutamine synthetase                        356   1e-118   Populus x canadensis [Canadian poplar]
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           360   1e-118   Solanum tuberosum [potatoes]
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    358   2e-118   
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    358   4e-118   
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      358   5e-118   
dbj|BAD12059.1|  plastidic glutamine synthetase                         358   5e-118   Phragmites australis
gb|ACG31728.1|  hypothetical protein                                    356   5e-118   Zea mays [maize]
gb|ACG35376.1|  glutamine synthetase                                    357   1e-117   Zea mays [maize]
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        357   2e-117   Medicago truncatula
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    359   2e-117   Zea mays [maize]
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2            355   3e-117   Lemna minor
dbj|BAL45315.1|  glutamine synthetase                                   350   3e-117   Boykinia occidentalis
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    356   4e-117   Setaria italica
ref|XP_006850815.1|  PREDICTED: glutamine synthetase leaf isozyme...    355   8e-117   Amborella trichopoda
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     352   8e-116   Brachypodium distachyon [annual false brome]
ref|XP_003594092.1|  Glutamine synthetase                               374   6e-115   
gb|AAX18864.1|  chloroplast glutamine synthetase                        344   8e-115   Glycine max [soybeans]
emb|CDY49365.1|  BnaA08g29950D                                          348   8e-115   Brassica napus [oilseed rape]
dbj|BAJ91545.1|  predicted protein                                      349   2e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA34131.1|  unnamed protein product                                348   2e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            348   2e-114   Secale cereale
gb|AAX18865.1|  chloroplast glutamine synthetase                        343   3e-114   Glycine max [soybeans]
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    348   6e-114   Hordeum vulgare [barley]
gb|ACT22500.1|  plastid glutamine synthetase 2                          347   1e-113   Triticum aestivum [Canadian hard winter wheat]
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               347   1e-113   Triticum aestivum [Canadian hard winter wheat]
gb|ACT22496.1|  plastid glutamine synthetase 2                          347   1e-113   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ95492.1|  predicted protein                                      346   2e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               344   1e-112   Triticum aestivum [Canadian hard winter wheat]
dbj|BAG49063.1|  glutamine synthetase                                   338   1e-112   Lactuca sativa [cultivated lettuce]
gb|AAK49029.1|  cytosolic glutamine synthetase                          341   2e-112   Populus tremula x Populus alba [gray poplar]
emb|CAA47373.2|  glutamate--ammonia ligase                              343   3e-112   Nicotiana sylvestris
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        346   6e-112   Triticum urartu
gb|EPS69972.1|  glutamine synthetase                                    332   4e-111   Genlisea aurea
sp|P52783.1|GLNA_PINSY  RecName: Full=Glutamine synthetase cytoso...    337   5e-111   Pinus sylvestris [Scotch pine]
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               338   2e-110   Triticum aestivum [Canadian hard winter wheat]
gb|EPS57588.1|  glutamine synthetase                                    332   4e-110   Genlisea aurea
gb|ABK21449.1|  unknown                                                 335   4e-110   Picea sitchensis
ref|XP_010528562.1|  PREDICTED: glutamine synthetase cytosolic is...    334   5e-110   Tarenaya hassleriana [spider flower]
gb|AGC24240.1|  glutamine synthetase 1                                  331   7e-110   Brassica napus [oilseed rape]
gb|AGC24242.1|  glutamine synthetase 1                                  330   1e-109   Brassica napus [oilseed rape]
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...    334   1e-109   Tarenaya hassleriana [spider flower]
gb|AGC82199.1|  glutamine synthetase 1                                  330   1e-109   Brassica napus [oilseed rape]
emb|CAA52448.1|  glutamate--ammonia ligase                              334   1e-109   Pinus sylvestris [Scotch pine]
gb|AJD14835.1|  glutamine synthetase                                    333   2e-109   Boehmeria nivea [Chinese silk-plant]
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme     333   4e-109   Tarenaya hassleriana [spider flower]
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like        333   4e-109   Cucumis sativus [cucumbers]
emb|CDY38104.1|  BnaC02g06690D                                          332   5e-109   Brassica napus [oilseed rape]
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme     332   5e-109   Populus euphratica
gb|AGC24238.1|  glutamine synthetase 1                                  332   5e-109   Brassica napus [oilseed rape]
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg             332   6e-109   
emb|CDO98315.1|  unnamed protein product                                332   6e-109   Coffea canephora [robusta coffee]
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...    332   7e-109   Brassica rapa
pir||S22527  glutamate-ammonia ligase (EC 6.3.1.2) - tobacco            335   7e-109
emb|CDY49656.1|  BnaC09g41340D                                          332   8e-109   Brassica napus [oilseed rape]
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...    332   9e-109   Pyrus x bretschneideri [bai li]
gb|AGC82204.1|  glutamine synthetase 1                                  327   1e-108   Brassica napus [oilseed rape]
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozyme     331   1e-108   Fragaria vesca subsp. vesca
emb|CDX69442.1|  BnaA10g17910D                                          331   1e-108   
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...    331   1e-108   Brassica rapa
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...    331   1e-108   Camelina sativa [gold-of-pleasure]
gb|AGC24239.1|  glutamine synthetase 1                                  331   2e-108   Brassica napus [oilseed rape]
dbj|BAD11327.1|  glutamine synthetase                                   331   2e-108   Camellia sinensis [black tea]
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme             331   2e-108   Cucumis melo [Oriental melon]
ref|XP_008229355.1|  PREDICTED: glutamine synthetase cytosolic is...    330   2e-108   Prunus mume [ume]
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    331   2e-108   
ref|NP_568335.1|  glutamine synthetase 1;4                              331   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...    330   3e-108   Populus euphratica
gb|AIK03054.1|  glutamine synthetase                                    330   3e-108   Eichhornia crassipes
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...    330   3e-108   
ref|XP_003619869.1|  Glutamine synthetase                               330   3e-108   Medicago truncatula
gb|KEH36742.1|  glutamine synthetase domain protein                     332   3e-108   Medicago truncatula
ref|XP_011083120.1|  PREDICTED: glutamine synthetase cytosolic is...    330   3e-108   Sesamum indicum [beniseed]
emb|CAA73366.1|  glutamine synthetase                                   330   3e-108   Lotus japonicus
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...    330   4e-108   Lotus japonicus
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...    330   4e-108   Sesamum indicum [beniseed]
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...    330   4e-108   Camelina sativa [gold-of-pleasure]
ref|XP_008361978.1|  PREDICTED: glutamine synthetase leaf isozyme...    331   5e-108   
gb|AAW21273.1|  glutamine synthetase                                    330   5e-108   Saccharum officinarum [noble cane]
ref|XP_007043312.1|  Glutamine synthetase 1,4                           330   5e-108   
ref|XP_009370556.1|  PREDICTED: glutamine synthetase cytosolic is...    329   5e-108   Pyrus x bretschneideri [bai li]
dbj|BAA04995.1|  glutamine synthetase                                   330   6e-108   Raphanus sativus
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...    330   6e-108   
dbj|BAM84282.1|  glutamine synthetase                                   329   6e-108   Tulipa humilis var. pulchella
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...    330   7e-108   Medicago sativa [alfalfa]
gb|AID48673.1|  theanine synthetase                                     329   7e-108   Camellia oleifera [abura-tsubaki]
ref|XP_001755833.1|  predicted protein                                  330   7e-108   
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha               329   7e-108   Glycine max [soybeans]
ref|XP_006372556.1|  glutamate-ammonia ligase family protein            329   7e-108   Populus trichocarpa [western balsam poplar]
ref|XP_006391363.1|  hypothetical protein EUTSA_v10018774mg             329   8e-108   
gb|ABK95973.1|  unknown                                                 329   8e-108   Populus trichocarpa [western balsam poplar]
prf||1804333C  Gln synthetase                                           332   8e-108
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...    330   8e-108   Medicago truncatula
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg             329   9e-108   Eutrema salsugineum [saltwater cress]
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                    329   1e-107   Arabis alpina [alpine rockcress]
ref|XP_002888488.1|  ATGSR2                                             329   1e-107   
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...    329   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_002318305.1|  glutamine synthetase family protein                329   1e-107   
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...    329   1e-107   Pyrus x bretschneideri [bai li]
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg             329   1e-107   Eutrema salsugineum [saltwater cress]
emb|CAA73063.1|  cytosolic glutamine synthetase                         329   1e-107   Brassica napus [oilseed rape]
ref|XP_006844043.1|  PREDICTED: glutamine synthetase nodule isozyme     328   1e-107   Amborella trichopoda
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg                328   2e-107   Erythranthe guttata [common monkey flower]
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                    328   2e-107   Arabis alpina [alpine rockcress]
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...    328   2e-107   Nelumbo nucifera [Indian lotus]
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...    328   2e-107   Alnus glutinosa
ref|XP_008659016.1|  PREDICTED: glutamine synthetase root isozyme...    327   2e-107   Zea mays [maize]
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...    328   2e-107   
gb|KHG29839.1|  Glutamine synthetase cytosolic isozyme 1-1              328   2e-107   Gossypium arboreum [tree cotton]
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...    328   2e-107   Populus euphratica
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg             328   2e-107   Capsella rubella
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...    328   2e-107   Populus euphratica
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2               328   2e-107   Glycine max [soybeans]
gb|KCW69395.1|  hypothetical protein EUGRSUZ_F02872                     327   3e-107   Eucalyptus grandis [rose gum]
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...    328   3e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002306385.1|  glutamine synthetase family protein                328   3e-107   Populus trichocarpa [western balsam poplar]
dbj|BAL14865.1|  putative cytosolic glutamine synthetase                328   3e-107   Tulipa gesneriana
gb|AIR07817.1|  cytosolic glutamine synthetase 1-2                      327   3e-107   Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg             328   3e-107   Prunus persica
gb|AAB61597.1|  glutamine synthetase                                    328   3e-107   Hevea brasiliensis [jebe]
gb|KCW69394.1|  hypothetical protein EUGRSUZ_F02872                     327   3e-107   Eucalyptus grandis [rose gum]
gb|ACF42116.1|  cytosolic glutamine synthetase                          328   3e-107   Brassica oleracea var. italica [asparagus broccoli]
dbj|BAM84285.1|  glutamine synthetase                                   328   3e-107   Tulipa fosteriana
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...    328   4e-107   Eucalyptus grandis [rose gum]
gb|ABK23723.1|  unknown                                                 328   4e-107   Picea sitchensis
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...    328   4e-107   Setaria italica
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...    327   4e-107   Brassica rapa
gb|ACJ11724.1|  glutamine synthase                                      327   4e-107   Gossypium hirsutum [American cotton]
ref|XP_012065801.1|  PREDICTED: glutamine synthetase nodule isozy...    327   4e-107   Jatropha curcas
gb|AIR07816.1|  cytosolic glutamine synthetase 1-1                      326   4e-107   Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like               327   4e-107   Nicotiana sylvestris
emb|CAA54151.1|  glutamine                                              327   4e-107   Brassica napus [oilseed rape]
emb|CAA63963.1|  glutamate synthetase                                   327   5e-107   Lotus japonicus
ref|XP_012086426.1|  PREDICTED: glutamine synthetase cytosolic is...    327   5e-107   Jatropha curcas
emb|CAN68162.1|  hypothetical protein VITISV_015673                     327   5e-107   Vitis vinifera
emb|CBI33470.3|  unnamed protein product                                327   5e-107   Vitis vinifera
ref|XP_006374208.1|  glutamine synthetase family protein                327   5e-107   
gb|AAP33169.1|  cytosolic glutamine synthetase                          327   5e-107   Securigera parviflora
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...    327   6e-107   Zea mays [maize]
ref|NP_001105297.1|  glutamine synthetase root isozyme 5                327   6e-107   
ref|NP_001185327.1|  glutamine synthetase                               327   6e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176794.1|  glutamine synthetase                                  327   6e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1           327   6e-107   Vitis vinifera
emb|CAA29058.1|  glutamine synthetase                                   323   6e-107   Pisum sativum [garden pea]
gb|ACN40288.1|  unknown                                                 327   7e-107   Picea sitchensis
gb|ACG47508.1|  glutamine synthetase root isozyme 5                     327   7e-107   Zea mays [maize]
dbj|BAD99526.1|  glutamine synthetase                                   327   7e-107   Camellia sinensis [black tea]
ref|XP_002305885.1|  glutamate-ammonia ligase family protein            327   7e-107   Populus trichocarpa [western balsam poplar]
emb|CAJ87510.1|  putative glutamine synthetase                          327   7e-107   Pisum sativum [garden pea]
gb|ACD13217.1|  glutamine synthetase                                    327   7e-107   Brassica rapa subsp. chinensis [bok-choy]
gb|ABK94916.1|  unknown                                                 327   7e-107   Populus trichocarpa [western balsam poplar]
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...    327   7e-107   Oryza brachyantha
gb|ABK51388.1|  cytosolic glutamine synthetase                          327   8e-107   Camellia sinensis [black tea]
gb|AJD14834.1|  glutamine synthetase                                    327   8e-107   Boehmeria nivea [Chinese silk-plant]
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like               327   8e-107   Nicotiana tomentosiformis
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                    327   8e-107   Arabis alpina [alpine rockcress]
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g             327   8e-107   Phaseolus vulgaris [French bean]
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...    327   8e-107   Populus euphratica
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...    327   8e-107   Camelina sativa [gold-of-pleasure]
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...    327   9e-107   Setaria italica
ref|XP_010916212.1|  PREDICTED: glutamine synthetase nodule isozy...    327   1e-106   Elaeis guineensis
gb|EEC73954.1|  hypothetical protein OsI_08842                          327   1e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme     326   1e-106   Phoenix dactylifera
ref|XP_002310666.1|  glutamine synthetase family protein                326   1e-106   
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...    326   1e-106   Camelina sativa [gold-of-pleasure]
gb|AAP33167.1|  cytosolic glutamine synthetase                          326   1e-106   Securigera parviflora
gb|AAA50249.1|  glutamine synthetase                                    320   1e-106   Solanum lycopersicum
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...    326   1e-106   Cucumis melo [Oriental melon]
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g             326   1e-106   
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2           326   1e-106   Vitis vinifera
ref|XP_002873784.1|  GLN1_4                                             326   1e-106   
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase                326   1e-106   Mesembryanthemum crystallinum
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...    326   1e-106   Cicer arietinum [garbanzo]
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1         326   1e-106   Vitis vinifera
ref|XP_006828441.1|  PREDICTED: glutamine synthetase cytosolic is...    326   1e-106   Amborella trichopoda
dbj|BAD94626.1|  glutamate--ammonia ligase                              321   1e-106   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048045.1|  Os02g0735200                                       326   1e-106   
dbj|BAL45318.1|  glutamine synthetase                                   322   1e-106   Heuchera cylindrica
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...    328   1e-106   
ref|NP_001105296.1|  glutamine synthetase root isozyme 3                326   1e-106   Zea mays [maize]
gb|ABW89460.1|  glutamine synthetase                                    326   1e-106   Gossypium herbaceum [Arabian cotton]
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme                326   1e-106   Morus notabilis
gb|ABW89463.1|  glutamine synthetase                                    326   2e-106   
gb|AAR29057.1|  glutamine synthetase 1                                  326   2e-106   
gb|ABW89462.1|  glutamine synthetase                                    326   2e-106   
gb|ABW89464.1|  glutamine synthetase                                    326   2e-106   
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...    326   2e-106   
tpg|DAA50997.1|  TPA: glutamine synthetase2                             323   2e-106   
emb|CAA06383.1|  glutamine synthetase                                   326   2e-106   
gb|ACR38147.1|  unknown                                                 326   2e-106   
dbj|BAE98486.1|  glutamine synthetase like protein                      326   2e-106   
gb|ABX79672.1|  glutamine synthetase                                    325   2e-106   
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...    325   2e-106   
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...    325   2e-106   
gb|AGZ15411.1|  glutamine synthetase PR-2                               325   2e-106   
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...    325   2e-106   
emb|CCO25538.1|  glutamine synthetase                                   325   3e-106   
ref|NP_001241743.1|  glutamine synthetase root isozyme 3                325   3e-106   
prf||1804333B  Gln synthetase                                           328   3e-106
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg                325   3e-106   
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...    325   3e-106   
ref|XP_010250142.1|  PREDICTED: glutamine synthetase nodule isozyme     325   3e-106   
gb|AFN42876.1|  glutamine synthetase                                    325   3e-106   
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...    325   3e-106   
dbj|BAD99525.1|  glutamine synthetase                                   325   4e-106   
dbj|BAL45347.1|  glutamine synthetase                                   321   4e-106   
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g             325   4e-106   
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...    325   4e-106   
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...    325   4e-106   
gb|AAW21274.1|  glutamine synthetase                                    325   4e-106   
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme     325   4e-106   
gb|AAM63710.1|  glutamine synthetase, putative                          325   5e-106   
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                     325   5e-106   
dbj|BAL45339.1|  glutamine synthetase                                   321   5e-106   
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...    324   5e-106   
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1        325   5e-106   
dbj|BAL45327.1|  glutamine synthetase                                   321   5e-106   
ref|XP_006828438.1|  PREDICTED: glutamine synthetase nodule isozyme     325   5e-106   
dbj|BAL45353.1|  glutamine synthetase                                   321   5e-106   
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...    325   6e-106   
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...    325   6e-106   
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...    325   6e-106   
dbj|BAL45319.1|  glutamine synthetase                                   321   6e-106   
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1                325   6e-106   
dbj|BAL45337.1|  glutamine synthetase                                   321   6e-106   
gb|ACB06727.1|  glutamine synthetase                                    325   6e-106   
emb|CAA58118.1|  glutamate--ammonia ligase                              324   6e-106   
dbj|BAL45316.1|  glutamine synthetase                                   320   6e-106   
dbj|BAL45325.1|  glutamine synthetase                                   320   7e-106   
ref|XP_011655226.1|  PREDICTED: glutamine synthetase nodule isozyme     324   7e-106   
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg             327   7e-106   
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...    324   7e-106   
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...    324   8e-106   
gb|ACA50923.1|  glutamine synthetase                                    324   8e-106   
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1         324   8e-106   
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...    324   9e-106   
gb|ABW89461.1|  glutamine synthetase                                    324   9e-106   
gb|ACR45960.1|  glutamine synthetase 1b                                 324   9e-106   
emb|CAA46723.1|  glutamine synthetase                                   320   9e-106   
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...    324   1e-105   
ref|NP_001049424.1|  Os03g0223400                                       324   1e-105   
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1           324   1e-105   
gb|AAB03492.1|  cytosolic glutamine synthetase                          323   1e-105   
gb|AGI78872.1|  glutamine synthetase                                    324   1e-105   
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                    324   1e-105   
gb|ACN26845.1|  unknown                                                 323   1e-105   
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...    324   1e-105   
gb|AGI78873.1|  glutamine synthetase                                    324   1e-105   
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...    324   1e-105   
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...    324   1e-105   
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450          324   1e-105   
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...    324   1e-105   
gb|ACF78695.1|  unknown                                                 324   1e-105   
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...    324   1e-105   
gb|AGV07415.1|  glutamine synthetase                                    323   1e-105   
ref|NP_001105538.1|  glutamine synthetase root isozyme 1                323   2e-105   
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...    323   2e-105   
gb|AAW21275.1|  glutamine synthetase                                    324   2e-105   
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...    323   2e-105   
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like               323   2e-105   
dbj|BAL45333.1|  glutamine synthetase                                   319   2e-105   
ref|XP_008781316.1|  PREDICTED: glutamine synthetase cytosolic is...    323   2e-105   
dbj|BAL45335.1|  glutamine synthetase                                   319   2e-105   
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme     323   2e-105   
ref|NP_198576.1|  glutamine synthetase 1;1                              323   2e-105   
gb|ACL54769.1|  unknown                                                 323   2e-105   
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...    323   2e-105   
ref|XP_002870545.1|  ATGSR1                                             323   2e-105   
tpg|DAA44141.1|  TPA: glutamine synthetase6                             323   3e-105   
tpg|DAA44139.1|  TPA: glutamine synthetase6                             323   3e-105   
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...    323   3e-105   
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2               323   3e-105   
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like               323   3e-105   
dbj|BAL45352.1|  glutamine synthetase                                   319   3e-105   
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...    323   3e-105   
ref|XP_010036983.1|  PREDICTED: glutamine synthetase cytosolic is...    323   4e-105   
dbj|BAL45317.1|  glutamine synthetase                                   318   4e-105   
ref|XP_003600702.1|  Glutamine synthetase                               322   4e-105   
ref|XP_001782920.1|  predicted protein                                  322   4e-105   
emb|CAA71317.1|  glutamine synthetase                                   322   4e-105   
ref|XP_006405854.1|  hypothetical protein EUTSA_v10027817mg             321   4e-105   
gb|AAK08103.1|AF338444_1  glutamine synthetase                          322   4e-105   
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    322   4e-105   
gb|ABU45501.1|  cytosolic glutamine synthetase                          322   5e-105   
gb|KHG29838.1|  Glutamine synthetase cytosolic isozyme 1-1              322   5e-105   
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...    322   5e-105   
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...    322   6e-105   
ref|NP_001268104.1|  glutamine synthetase                               322   6e-105   
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg             322   6e-105   
dbj|BAL45326.1|  glutamine synthetase                                   318   6e-105   
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...    322   6e-105   
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg                322   6e-105   
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg             322   6e-105   
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...    322   7e-105   
gb|KJB79891.1|  hypothetical protein B456_013G070600                    322   7e-105   
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...    322   7e-105   
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...    322   7e-105   
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...    322   7e-105   
gb|KJB79890.1|  hypothetical protein B456_013G070600                    322   7e-105   
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...    322   7e-105   
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme     322   7e-105   
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme     322   8e-105   
gb|AFK48742.1|  unknown                                                 322   8e-105   
sp|O22504.1|GLNA1_DAUCA  RecName: Full=Glutamine synthetase cytos...    321   9e-105   
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...    322   1e-104   
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg             322   1e-104   
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...    321   1e-104   
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...    321   1e-104   
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817             322   1e-104   
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...    321   1e-104   
ref|XP_001782914.1|  predicted protein                                  321   1e-104   
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...    321   1e-104   
gb|ACR45959.1|  glutamine synthetase 1a                                 321   1e-104   
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1         321   2e-104   
dbj|BAL45322.1|  glutamine synthetase                                   317   2e-104   
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g             321   2e-104   
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...    321   2e-104   
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944             321   2e-104   
gb|AAR86718.1|  glutamine synthetase GS56                               321   2e-104   
dbj|BAL45321.1|  glutamine synthetase                                   318   2e-104   
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...    320   2e-104   
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2               320   2e-104   
emb|CAA73064.1|  cytosolic glutamine synthetase                         320   2e-104   
gb|AFB69880.1|  glutamine synthetase isoform 1r                         320   3e-104   
gb|AFP20991.1|  glutamine synthetase isozyme                            320   3e-104   
gb|AAZ30057.1|  glutamine synthetase isoform GS1a                       320   3e-104   
gb|AAR29058.1|  glutamine synthetase 2                                  318   3e-104   
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1              320   4e-104   
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...    320   4e-104   
ref|XP_010032725.1|  PREDICTED: glutamine synthetase nodule isozyme     320   4e-104   
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...    320   4e-104   
dbj|BAA04996.1|  glutamine synthetase                                   320   5e-104   
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...    320   5e-104   
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                      320   5e-104   
gb|AAK14401.1|AF343667_1  cytosolic glutamine synthetase                320   5e-104   
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...    320   5e-104   
ref|NP_001051067.1|  Os03g0712800                                       320   5e-104   
gb|EMT12639.1|  Glutamine synthetase                                    319   5e-104   
gb|AAP33168.1|  cytosolic glutamine synthetase                          317   6e-104   
gb|AEM42902.1|  cytosolic glutamine synthetase isoform                  319   6e-104   
ref|XP_002989575.1|  hypothetical protein SELMODRAFT_184683             319   6e-104   
dbj|BAK01909.1|  predicted protein                                      319   7e-104   
emb|CDP01645.1|  unnamed protein product                                319   7e-104   
gb|AAZ30059.1|  glutamine synthetase isoform GS1c                       319   8e-104   
gb|AAZ30058.1|  glutamine synthetase isoform GS1b                       319   8e-104   
emb|CAA65173.1|  glutamine synthetase                                   319   8e-104   
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme     319   8e-104   
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...    319   9e-104   
gb|ABF06665.1|  glutamine synthetase                                    319   1e-103   
gb|AEH16645.1|  glutamine synthetase                                    319   1e-103   
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2              318   1e-103   
gb|AEM42903.1|  cytosolic glutamine synthetase isoform                  318   1e-103   
gb|AAT39510.1|  glutamine synthetase                                    318   1e-103   
gb|AGT16433.1|  glutamine synthetase                                    319   1e-103   
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2         318   1e-103   
dbj|BAL45320.1|  glutamine synthetase                                   315   1e-103   
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...    318   2e-103   
gb|AGG19203.1|  glutamine synthetase                                    318   2e-103   
gb|AAD52008.1|  cytosolic glutamine synthetase                          318   2e-103   
gb|AAL87183.1|AF480497_11  putative precursor chloroplastic gluta...    322   2e-103   
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg             318   2e-103   
gb|KJB43163.1|  hypothetical protein B456_007G187300                    318   3e-103   
ref|NP_001241708.1|  uncharacterized protein LOC100856886               318   3e-103   
gb|AAR84347.1|  glutamine synthetase isoform GSr1                       318   3e-103   
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...    318   3e-103   
ref|XP_010688706.1|  PREDICTED: glutamine synthetase nodule isozyme     317   3e-103   
ref|XP_002964238.1|  hypothetical protein SELMODRAFT_82032              319   4e-103   
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...    317   4e-103   
gb|AAB71692.1|  cytosolic glutamine synthetase                          315   4e-103   
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...    317   5e-103   
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...    317   5e-103   
gb|EEC76061.1|  hypothetical protein OsI_13264                          317   5e-103   
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...    317   6e-103   
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...    317   8e-103   
ref|NP_001105444.1|  glutamine synthetase root isozyme 4                316   1e-102   
gb|AGV54248.1|  glutamine synthetase                                    316   1e-102   
gb|KDO52771.1|  hypothetical protein CISIN_1g018391mg                   313   1e-102   
gb|AFB69879.1|  glutamine synthetase isoform 1-1                        316   1e-102   
ref|XP_006437562.1|  hypothetical protein CICLE_v10031939mg             313   1e-102   
ref|XP_010450398.1|  PREDICTED: glutamine synthetase, chloroplast...    310   1e-102   
ref|XP_009401139.1|  PREDICTED: glutamine synthetase nodule isozy...    316   1e-102   
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...    316   2e-102   
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...    315   2e-102   
gb|AAG40237.2|  glutamine synthetase GS1                                315   3e-102   
ref|XP_006437564.1|  hypothetical protein CICLE_v10031939mg             314   3e-102   
gb|AAR84348.1|  glutamine synthetase isoform GSr2                       315   3e-102   
gb|EMT23121.1|  Glutamine synthetase cytosolic isozyme 1-2              315   4e-102   
gb|EMS46544.1|  Glutamine synthetase cytosolic isozyme 1-2              315   4e-102   
ref|XP_006484548.1|  PREDICTED: glutamine synthetase nodule isozy...    315   5e-102   
ref|XP_006437563.1|  hypothetical protein CICLE_v10031939mg             315   5e-102   
gb|AAR84349.1|  glutamine synthetase isoform GSe1                       314   7e-102   
ref|XP_002527139.1|  glutamine synthetase plant, putative               314   7e-102   
ref|XP_010549036.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    315   1e-101   
gb|ACU19484.1|  unknown                                                 314   1e-101   
pir||S30569  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic - b...    314   1e-101
gb|EMT08718.1|  Glutamine synthetase cytosolic isozyme 1-3              313   1e-101   
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                      313   2e-101   
sp|Q06378.1|GLNA3_HORVU  RecName: Full=Glutamine synthetase; AltN...    313   2e-101   
gb|EMS45858.1|  Glutamine synthetase cytosolic isozyme 1-3              313   2e-101   
gb|AFX60877.1|  glutamine synthetase isoform GS1_3                      313   3e-101   
gb|KCW44354.1|  hypothetical protein EUGRSUZ_L021752                    310   3e-101   
gb|AGW24652.1|  cytosolic glutamine synthetase                          312   5e-101   
gb|AGW24651.1|  cytosolic glutamine synthetase                          312   5e-101   



>ref|XP_011090823.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090824.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090825.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090827.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
Length=432

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 196/196 (100%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>ref|NP_001284439.1| glutamine synthetase leaf isozyme, chloroplastic [Cucumis melo]
 gb|AAX35343.1| glutamine synthetase [Cucumis melo]
Length=432

 Score =   381 bits (978),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>ref|XP_008438737.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
melo]
Length=432

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum 
crystallinum]
Length=433

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARYIL
Sbjct  223  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYIL  282

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQ GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI
Sbjct  283  ERITEQVGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKDHI  342

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  343  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKAGKGYLEDRRPASNMDPY  402

Query  339  VVtallaettlLWQPT  292
            VVT LLAETTLLW+PT
Sbjct  403  VVTGLLAETTLLWEPT  418



>ref|XP_011071523.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Sesamum indicum]
Length=429

 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  219  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAI NLSLRH++HI
Sbjct  279  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIFNLSLRHKEHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETT+LW+PT
Sbjct  399  IVTSLLAETTILWEPT  414



>gb|AAN84539.1| putative plastidic glutamine synthetase, partial [Gazania splendens]
Length=224

 Score =   370 bits (951),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  14   GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  73

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST +MRE+GGFEVIKKAILNLSLRH +HI
Sbjct  74   ERITEQAGVVLTLDPKPIDGDWNGAGCHTNYSTLAMREDGGFEVIKKAILNLSLRHMEHI  133

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  134  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKAGKGYLEDRRPASNMDPY  193

Query  339  VVtallaettlLWQPT  292
             VT LLAETTLLW+PT
Sbjct  194  TVTGLLAETTLLWEPT  209



>ref|XP_010255852.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Nelumbo 
nucifera]
Length=432

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLY+GINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYSGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETANINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>ref|XP_010035896.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW84319.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=438

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+L
Sbjct  228  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLL  287

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQ GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  288  ERITEQIGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  347

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  348  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  407

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  408  IVTSLLAETTLLWEPT  423



>ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=432

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+L
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQ GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQTGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  402  IVTSLLAETTLLWEPT  417



>ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=432

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+L
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQ GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQIGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  402  IVTSLLAETTLLWEPT  417



>ref|XP_012069490.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Jatropha 
curcas]
 ref|XP_012069491.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Jatropha 
curcas]
 gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas]
Length=432

 Score =   377 bits (967),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 196/196 (100%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GG+EVIKKAILNLSLRHR+HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEVIKKAILNLSLRHREHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>ref|XP_010041423.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X2 [Eucalyptus grandis]
Length=369

 Score =   374 bits (961),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+L
Sbjct  159  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLL  218

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQ GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  219  ERITEQTGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  278

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  279  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  338

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  339  IVTSLLAETTLLWEPT  354



>gb|AIR07818.1| chloroplastic glutamine synthetase GS2, partial [Vitis labrusca 
x Vitis vinifera]
Length=273

 Score =   370 bits (950),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  63   GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  122

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GG+E+IKKAILNLSLRH++HI
Sbjct  123  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYELIKKAILNLSLRHKEHI  182

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCS+RVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  183  SAYGEGNERRLTGKHETANINTFSWGVANRGCSVRVGRDTEKQGKGYLEDRRPASNMDPY  242

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETT+LW+PT
Sbjct  243  IVTSLLAETTILWEPT  258



>gb|KHN37551.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=434

 Score =   376 bits (965),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  224  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  283

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHI
Sbjct  284  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHI  343

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  344  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  403

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  404  VVTSLLAETTLLWEPT  419



>ref|XP_006593484.1| PREDICTED: glutamine synthetase precursor isoform X1 [Glycine 
max]
Length=432

 Score =   376 bits (965),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum]
Length=432

 Score =   376 bits (965),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYST SMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+LW+PT
Sbjct  402  VVTGLLAETTILWEPT  417



>ref|XP_003546121.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597566.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN33081.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=432

 Score =   375 bits (964),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>ref|XP_008223033.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Prunus 
mume]
Length=432

 Score =   375 bits (964),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH DHI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHTDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
sativus]
 ref|XP_011651002.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
sativus]
 gb|KGN57036.1| Glutamine synthetase [Cucumis sativus]
Length=432

 Score =   375 bits (963),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>gb|KJB28233.1| hypothetical protein B456_005G035800 [Gossypium raimondii]
Length=431

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 196/196 (100%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  221  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  280

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH++HI
Sbjct  281  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHI  340

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  341  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  400

Query  339  VVtallaettlLWQPT  292
            VVTALLAETTLL++PT
Sbjct  401  VVTALLAETTLLYEPT  416



>gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea]
Length=431

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRD+SDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  221  GADKSFGRDVSDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  280

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQ GVV+TLDPKPIEGDWNGAGCHTNYSTK+MREEGGFEVIKKAILNLSLRH+DHI
Sbjct  281  ERITEQIGVVMTLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEVIKKAILNLSLRHKDHI  340

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  341  SAYGEGNERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  400

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+LW+PT
Sbjct  401  VVTGLLAETTILWEPT  416



>ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis]
Length=432

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 196/196 (100%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGV+LTLDPKPIEGDWNGAGCHTNYSTKSMR+EGG+EVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVILTLDPKPIEGDWNGAGCHTNYSTKSMRDEGGYEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>ref|XP_009391592.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391594.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  223  GADKTFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  282

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MREEGG+EVIKKAILNLSLRH DHI
Sbjct  283  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEVIKKAILNLSLRHMDHI  342

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  343  SAYGEGNERRLTGKHETANINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  402

Query  339  VVtallaettlLWQPT  292
            VV +LLAETT+LWQPT
Sbjct  403  VVISLLAETTILWQPT  418



>sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Daucus carota]
 gb|AAB71693.1| glutamine synthetase [Daucus carota]
Length=432

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLTLDPKPIDGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVA+RGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDSFSWGVADRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETTLLW+PT
Sbjct  402  VVTGLLAETTLLWEPT  417



>ref|XP_009417914.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417915.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  223  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  282

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGV+L+LDPKPIEGDWNGAGCHTN+STKSMREEGG+EVIKKAILNLSLRH DHI
Sbjct  283  ERITEQAGVILSLDPKPIEGDWNGAGCHTNFSTKSMREEGGYEVIKKAILNLSLRHMDHI  342

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  343  SAYGEGNERRLTGKHETANINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPY  402

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LWQP+
Sbjct  403  VVTSLLAETTILWQPS  418



>ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
 gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
Length=432

 Score =   374 bits (960),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE+AGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH DHI
Sbjct  282  ERITEEAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHTDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata]
Length=430

 Score =   374 bits (960),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIW ARYIL
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWAARYIL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPI+GDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH DHI
Sbjct  280  ERITEQAGVVLSLDPKPIQGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHSDHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  340  RAYGEGNERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  400  VVTSLLAETTLLWEPT  415



>gb|EYU43846.1| hypothetical protein MIMGU_mgv1a010285mg [Erythranthe guttata]
Length=317

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  123  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  182

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAI NLSLRH++HI
Sbjct  183  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIYNLSLRHKEHI  242

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  243  SAYGEGNERRLTGKHETASIDKFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  302

Query  339  VVtallaettlLWQP  295
            VVTALLAETTLLW+P
Sbjct  303  VVTALLAETTLLWKP  317



>gb|ACU24520.1| unknown [Glycine max]
Length=432

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPAS+MDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASSMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris]
 gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris]
Length=431

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  221  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  280

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTK+MRE+GGFEVIKKAILNLSLRH++HI
Sbjct  281  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKTMREDGGFEVIKKAILNLSLRHKEHI  340

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA I+TFSWGVANRGCSIRVGRDTEK GKGY+EDRRPASNMDPY
Sbjct  341  SAYGEGNERRLTGKHETADIDTFSWGVANRGCSIRVGRDTEKEGKGYMEDRRPASNMDPY  400

Query  339  VVtallaettlLWQPT  292
            VVT LLAE+TLLW+PT
Sbjct  401  VVTGLLAESTLLWEPT  416



>gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata]
Length=429

 Score =   373 bits (958),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  219  GADKSFGRDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH++HI
Sbjct  279  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  399  VVTSLLAETTLLWEPT  414



>ref|XP_010542001.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010542002.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=434

 Score =   374 bits (959),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  224  GADKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  283

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GG+EVIKKAILNLSLRH++HI
Sbjct  284  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEVIKKAILNLSLRHKEHI  343

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  344  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  403

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  404  VVTSLLAETTLLWEPT  419



>gb|KHG04493.1| Glutamine synthetase leaf isozyme, chloroplastic [Gossypium arboreum]
Length=432

 Score =   373 bits (958),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+L++PT
Sbjct  402  VVTGLLAETTILYEPT  417



>ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI26165.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   373 bits (958),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GG+E+IKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYELIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCS+RVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETANINTFSWGVANRGCSVRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETT+LW+PT
Sbjct  402  IVTSLLAETTILWEPT  417



>gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris]
Length=429

 Score =   373 bits (958),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  219  GADKSFGRDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH++HI
Sbjct  279  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            VVT+LLAE+TLLW+PT
Sbjct  399  VVTSLLAESTLLWEPT  414



>ref|XP_004486102.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cicer arietinum]
Length=430

 Score =   373 bits (958),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH+ HI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKVHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY
Sbjct  340  EAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
             VTALLAE+TLLW+PT
Sbjct  400  TVTALLAESTLLWEPT  415



>ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme 
delta; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
Length=429

 Score =   373 bits (958),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  219  GADKSFGRDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH++HI
Sbjct  279  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            VVT+LLAE+TLLW+PT
Sbjct  399  VVTSLLAESTLLWEPT  414



>dbj|BAF62340.1| glutamine synthetase [Avicennia marina]
Length=432

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLY+GINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWC+RY+L
Sbjct  222  GADKSFGRDISDAHYKACLYSGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCSRYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGG EVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGLEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+I+TFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETANIDTFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>ref|XP_009352136.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=432

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH +HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHGEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  402  IVTSLLAETTLLWEPT  417



>emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera]
Length=433

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  223  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  282

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH  HI
Sbjct  283  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHEVHI  342

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  343  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  402

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  403  VVTSLLAETTILWEPT  418



>ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI32325.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  223  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  282

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH  HI
Sbjct  283  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHEVHI  342

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  343  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  402

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  403  VVTSLLAETTILWEPT  418



>gb|AAO37651.1| glutamine synthetase [Medicago truncatula]
 gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  218  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  338  EAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            VVTALLAE+TLLW+PT
Sbjct  398  VVTALLAESTLLWEPT  413



>ref|XP_008390805.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH +HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHGEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  402  IVTSLLAETTLLWEPT  417



>sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Medicago sativa]
 gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa]
Length=428

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  218  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKVHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  338  EAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            VVTALLAE+TLLW+PT
Sbjct  398  VVTALLAESTLLWEPT  413



>ref|XP_009773609.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana sylvestris]
Length=432

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYST SMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRG SIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDKFSWGVANRGASIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+LW+PT
Sbjct  402  VVTGLLAETTILWEPT  417



>ref|XP_009629915.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana tomentosiformis]
 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata]
Length=432

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYST SMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRG SIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDKFSWGVANRGASIRVGRDTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+LW+PT
Sbjct  402  VVTGLLAETTILWEPT  417



>ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
Length=426

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  216  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  275

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH +HI
Sbjct  276  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHMEHI  335

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  336  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  395

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  396  IVTSLLAETTLLWEPT  411



>ref|XP_009339932.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Pyrus 
x bretschneideri]
Length=432

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHVEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  402  IVTSLLAETTLLWEPT  417



>ref|XP_010557680.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=434

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 196/196 (100%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  224  GADKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  283

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMR++GG+EVIKKAILNLSLRH++HI
Sbjct  284  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRDDGGYEVIKKAILNLSLRHKEHI  343

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  344  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  403

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  404  VVTSLLAETTILWEPT  419



>gb|KJB37729.1| hypothetical protein B456_006G218100 [Gossypium raimondii]
Length=432

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 195/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+L++PT
Sbjct  402  VVTGLLAETTILYEPT  417



>ref|XP_008353244.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHGEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  402  IVTSLLAETTLLWEPT  417



>gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli]
Length=432

 Score =   371 bits (953),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHVEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  402  IVTSLLAETTLLWEPT  417



>gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra]
Length=432

 Score =   371 bits (952),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGD NGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDRNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETT+LW+PT
Sbjct  402  IVTSLLAETTILWEPT  417



>emb|CDO98975.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   370 bits (951),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ FGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  222  GADKIFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GG+E IKKAIL+LSLRH+DHI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEKIKKAILSLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTFSWGVANRGCSIRVGR+TEK+GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETADINTFSWGVANRGCSIRVGRETEKNGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa]
 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Brassica napus]
 emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus]
 emb|CDX74644.1| BnaA04g07450D [Brassica napus]
Length=428

 Score =   370 bits (951),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  218  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  338  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  398  IVTSLLAETTLLWEPT  413



>gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis]
Length=428

 Score =   370 bits (950),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  218  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  338  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  398  IVTSLLAETTLLWEPT  413



>ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica 
rapa]
Length=428

 Score =   370 bits (950),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  218  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGF+VIKKAILNLSLRH +HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFDVIKKAILNLSLRHMEHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  338  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  398  IVTSLLAETTLLWEPT  413



>ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
 ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
Length=432

 Score =   370 bits (950),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIE GDHIWCARY+L
Sbjct  222  GAEKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEGGDHIWCARYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYST SMREEGGFEVIKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+LW+PT
Sbjct  402  VVTGLLAETTILWEPT  417



>gb|EYU45601.1| hypothetical protein MIMGU_mgv1a007136mg [Erythranthe guttata]
Length=418

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAI NLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIHNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQP  295
            VVTALLAETTLLW P
Sbjct  402  VVTALLAETTLLWDP  416



>prf||1601519A Gln synthetase
Length=429

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  219  GADKSFGRDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH++HI
Sbjct  279  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGK ETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGKMETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            VVT+LLAE+TLLW+PT
Sbjct  399  VVTSLLAESTLLWEPT  414



>gb|AAN84563.1| glutamine synthetase [Lotus japonicus]
Length=430

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+L
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  340  RAYGEGNERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            VVTALLAETTLLW+PT
Sbjct  400  VVTALLAETTLLWEPT  415



>gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus]
Length=430

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+L
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  340  RAYGEGNERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            VVTALLAETTLLW+PT
Sbjct  400  VVTALLAETTLLWEPT  415



>ref|NP_001237784.1| glutamine synthetase precursor [Glycine max]
 gb|AAK43833.1|AF353620_1 glutamine synthetase precursor [Glycine max]
Length=432

 Score =   369 bits (947),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGT GEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTIGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRP SNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPTSNMDPY  401

Query  339  VVtallaettlLWQPT  292
            V T+LLAETTLLW+PT
Sbjct  402  VATSLLAETTLLWEPT  417



>gb|AJI44225.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   369 bits (947),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+L
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWMSRYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTN+STK+MRE+GG+E IKKAILNLSLRH+DHI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNFSTKTMREDGGYEAIKKAILNLSLRHKDHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY
Sbjct  340  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW PT
Sbjct  400  IVTSLLAETTLLWAPT  415



>sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Pisum sativum]
 gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum]
Length=430

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  220  GADKSFGRDISDAHYKACIYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASIN FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  340  EAYGEGNERRLTGKHETASINDFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            VVTALLAE+TLLW+PT
Sbjct  400  VVTALLAESTLLWEPT  415



>emb|CAA29057.1| gluthamine synthetase [Pisum sativum]
Length=373

 Score =   366 bits (940),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  163  GADKSFGRDISDAHYKACIYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  222

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI
Sbjct  223  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHI  282

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASIN FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  283  EAYGEGNERRLTGKHETASINDFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  342

Query  339  VVtallaettlLWQPT  292
            VVTALLAE+TLLW+PT
Sbjct  343  VVTALLAESTLLWEPT  358



>emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus]
Length=428

 Score =   368 bits (945),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  218  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGF+VIKK ILNLSLRH +HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFDVIKKDILNLSLRHMEHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  338  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  398  IVTSLLAETTLLWEPT  413



>ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   368 bits (945),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ +GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+L
Sbjct  219  GADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  279  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  399  IVTSLLAETTLLWEPT  414



>ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana]
 sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana]
 dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana]
 dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
(clone lambdaAtgsl1) [Arabidopsis thaliana]
 gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana]
 gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
[Arabidopsis thaliana]
 gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana]
 gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana]
 prf||1804333A Gln synthetase
Length=430

 Score =   368 bits (945),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ +GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+L
Sbjct  220  GADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  340  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  400  IVTSLLAETTLLWEPT  415



>ref|XP_010435449.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
 ref|XP_010435451.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X4 [Camelina sativa]
 ref|XP_010440748.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=430

 Score =   368 bits (945),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ +GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+L
Sbjct  220  GADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  340  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  400  IVTSLLAETTLLWEPT  415



>gb|KDO74872.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74873.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74874.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=432

 Score =   368 bits (945),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+L
Sbjct  222  GADKSFGRDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGG+E IKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYETIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>ref|XP_010450396.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
 ref|XP_010450397.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=430

 Score =   368 bits (945),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ +GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+L
Sbjct  220  GADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  340  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  400  IVTSLLAETTLLWEPT  415



>ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
 gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
Length=429

 Score =   368 bits (944),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ +GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+L
Sbjct  219  GADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  279  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  399  IVTSLLAETTLLWEPT  414



>ref|XP_010435452.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X5 [Camelina sativa]
 ref|XP_010435453.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X6 [Camelina sativa]
 ref|XP_010440749.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
Length=418

 Score =   367 bits (943),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ +GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+L
Sbjct  208  GADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLL  267

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  268  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  327

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  328  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  387

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  388  IVTSLLAETTLLWEPT  403



>gb|ACU18743.1| unknown [Glycine max]
Length=420

 Score =   367 bits (943),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLS RH+DHI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSPRHKDHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+T+K+GKGYLEDRRPASNM+PY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRNTKKNGKGYLEDRRPASNMNPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETTLLW+PT
Sbjct  402  VVTSLLAETTLLWEPT  417



>gb|KDO74871.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=428

 Score =   368 bits (944),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+L
Sbjct  218  GADKSFGRDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGG+E IKKAILNLSLRH++HI
Sbjct  278  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYETIKKAILNLSLRHKEHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  338  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  398  VVTSLLAETTILWEPT  413



>emb|CDY33684.1| BnaC04g29670D [Brassica napus]
Length=489

 Score =   370 bits (949),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  279  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  338

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  339  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHI  398

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  399  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  458

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  459  IVTSLLAETTLLWEPT  474



>gb|AJD14836.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+L
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWMSRYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTN+STK+MRE+GG+E IKKAILNLSLRH+DHI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNFSTKTMREDGGYEAIKKAILNLSLRHKDHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  340  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW PT
Sbjct  400  IVTSLLAETTLLWAPT  415



>ref|XP_010435447.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010435448.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
 ref|XP_010435454.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X7 [Camelina sativa]
 ref|XP_010440747.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=441

 Score =   368 bits (944),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+ +GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+L
Sbjct  231  GADKIWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLL  290

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  291  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  350

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  351  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  410

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  411  IVTSLLAETTLLWEPT  426



>gb|AKA60251.1| GS [Hevea brasiliensis subsp. brasiliensis]
Length=432

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+A DHIWC+RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAADHIWCSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK MRE+GG+EVIKKAILNLSLRH +HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKRMREDGGYEVIKKAILNLSLRHNEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA+INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  342  NAYGEGNERRLTGKHETANINTFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus]
Length=430

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY L
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYHL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI
Sbjct  280  ERITEQAGVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  340  RAYGEGNERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            VVTALLAETTLLW+PT
Sbjct  400  VVTALLAETTLLWEPT  415



>gb|KDO74875.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=442

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+L
Sbjct  232  GADKSFGRDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLL  291

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGG+E IKKAILNLSLRH++HI
Sbjct  292  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYETIKKAILNLSLRHKEHI  351

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  352  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  411

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  412  VVTSLLAETTILWEPT  427



>gb|AFH88076.1| chloroplast glutamine synthetase protein, partial [Sesuvium portulacastrum]
Length=433

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  223  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  282

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQ GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILN S RH +HI
Sbjct  283  ERITEQVGVVLTLDPKPIEGDWNGAGAHTNYSTKSMREDGGFEVIKKAILNPSPRHTEHI  342

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  343  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  402

Query  339  VVtallaettlLWQPT  292
            VVTALLAETT+LW+PT
Sbjct  403  VVTALLAETTILWEPT  418



>gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus]
Length=430

 Score =   366 bits (939),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGP VGIEAGDHIW +RY+L
Sbjct  220  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPXVGIEAGDHIWASRYLL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERIT QAGVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI
Sbjct  280  ERITXQAGVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  340  RAYGEGNERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            VVTALLAETTLLW+PT
Sbjct  400  VVTALLAETTLLWEPT  415



>ref|XP_007034566.1| Glutamine synthetase 2 [Theobroma cacao]
 gb|EOY05492.1| Glutamine synthetase 2 [Theobroma cacao]
Length=549

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINI GTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYIL
Sbjct  339  GADKSFGRDISDAHYKACLYAGINIGGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYIL  398

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GG+EVIKKAILNLSLRH++HI
Sbjct  399  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEVIKKAILNLSLRHQEHI  458

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  459  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  518

Query  339  VVtallaettlLWQPT  292
            VV +LLAETT+L++PT
Sbjct  519  VVISLLAETTILYEPT  534



>ref|XP_010938796.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Elaeis 
guineensis]
Length=434

 Score =   365 bits (938),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIE+GDHIWC+RYIL
Sbjct  224  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIESGDHIWCSRYIL  283

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTN+STK MRE+GG+EVIKKA+LNLSLRH++HI
Sbjct  284  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNFSTKRMREDGGYEVIKKAVLNLSLRHKEHI  343

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCSIRVGR+TE+ GKGYLEDRRPASNMDPY
Sbjct  344  SAYGEGNERRLTGKHETANINTFSWGVANRGCSIRVGRETERRGKGYLEDRRPASNMDPY  403

Query  339  VVtallaettlLWQPT  292
            VVT++LAETT+LW+PT
Sbjct  404  VVTSMLAETTILWEPT  419



>ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
 ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
Length=432

 Score =   365 bits (937),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+L
Sbjct  222  GADKSFGRDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKS REEGG+E IKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSTREEGGYETIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  402  VVTSLLAETTILWEPT  417



>emb|CAB72423.1| glutamine synthetase [Brassica napus]
Length=428

 Score =   365 bits (937),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSV IEAGDH+WCARY+L
Sbjct  218  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVRIEAGDHVWCARYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  338  IAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  398  IVTSLLAETTLLWEPT  413



>gb|AAN84538.1| putative plastidic glutamine synthetase [Spiraea nipponica]
Length=429

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 189/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAI  LSLRH++HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIHKLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQ  298
            +VT LLAETTLLW+
Sbjct  402  IVTGLLAETTLLWE  415



>ref|XP_010105702.1| Glutamine synthetase leaf isozyme [Morus notabilis]
 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis]
Length=433

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  223  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYIL  282

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTN+STKSMRE+GG+E IKKAILNLSLRH++HI
Sbjct  283  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNFSTKSMREDGGYEAIKKAILNLSLRHKEHI  342

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  343  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  402

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETTLLW+PT
Sbjct  403  IVTSLLAETTLLWEPT  418



>ref|XP_002314425.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEF00596.1| glutamine synthetase family protein [Populus trichocarpa]
Length=432

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACMYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MREEGGFE IKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEAIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            +VT+LLAETT+L++PT
Sbjct  402  IVTSLLAETTILYEPT  417



>ref|XP_011006593.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Populus 
euphratica]
Length=432

 Score =   363 bits (932),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MREEGG+E IKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEAIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+L++PT
Sbjct  402  VVTSLLAETTILYEPT  417



>ref|XP_002312733.1| glutamine synthetase family protein [Populus trichocarpa]
 ref|XP_006380049.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ABK94955.1| unknown [Populus trichocarpa]
 gb|EEE90100.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP57846.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=432

 Score =   363 bits (931),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGIN+SGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINVSGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MREEGG+E IKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEAIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVTALLAETT+L++PT
Sbjct  402  VVTALLAETTILYEPT  417



>ref|XP_011009035.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009036.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=432

 Score =   363 bits (931),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGIN+SGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINVSGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MREEGG+E IKKAILNLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEAIKKAILNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+L++PT
Sbjct  402  VVTSLLAETTILYEPT  417



>ref|XP_011462784.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  221  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  280

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  281  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  340

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HET +IN FSWGVANRG SIRVGRDTEK GKGYLEDRRPASNMDPY
Sbjct  341  SAYGEGNERRLTGLHETQNINKFSWGVANRGASIRVGRDTEKEGKGYLEDRRPASNMDPY  400

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  401  TVTALLAETTILWEPT  416



>dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis]
 dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   360 bits (924),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  219  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAG+VLTLDPKPI+GDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH  HI
Sbjct  279  ERITEQAGIVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  399  VVTSLLAETTILWEPT  414



>ref|NP_001054133.1| Os04g0659100 [Oryza sativa Japonica Group]
 sp|P14655.1|GLNA2_ORYSJ RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=Glutamate--ammonia 
ligase; AltName: Full=OsGS2; Short=GS2; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAA32462.1| unnamed protein product [Oryza sativa]
 emb|CAE02885.2| OSJNBa0015K02.2 [Oryza sativa Japonica Group]
 emb|CAE54574.1| OSJNBa0011F23.15 [Oryza sativa Japonica Group]
 dbj|BAF16047.1| Os04g0659100 [Oryza sativa Japonica Group]
 emb|CAH67797.1| OSIGBa0132E09-OSIGBa0108L24.11 [Oryza sativa Indica Group]
 gb|EEC78171.1| hypothetical protein OsI_17756 [Oryza sativa Indica Group]
 gb|EEE61834.1| hypothetical protein OsJ_16481 [Oryza sativa Japonica Group]
Length=428

 Score =   360 bits (924),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  218  GSDKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH  HI
Sbjct  278  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  338  SAYGEGNERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            VVTALLAETT+LW+PT
Sbjct  398  VVTALLAETTILWEPT  413



>gb|AHJ10961.1| chloroplast glutamine synthetase 2 isoform 1 [Lemna minor]
Length=424

 Score =   360 bits (923),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++SFGRDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  222  GAEKSFGRDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSVGIDAGDHIWVSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MREEGGFEVIKKA++NLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEVIKKAVVNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCS+RVGR+TEK GKGY+EDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETANINTFSWGVANRGCSVRVGRETEKEGKGYMEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+P+
Sbjct  402  VVTSLLAETTILWEPS  417



>gb|ACO59263.1| chloroplast glutamine synthetase [Populus x canadensis]
 gb|ACT83378.1| chloroplast glutamine synthetase [Populus sp. FZ-2009]
Length=316

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  129  GADKSFGRDISDAHYKACMYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYIL  188

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MREEGGFE IKKAILNL LRH++HI
Sbjct  189  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEAIKKAILNLPLRHKEHI  248

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  249  SAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  308

Query  339  VV  334
            +V
Sbjct  309  IV  310



>ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum]
 gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum]
Length=432

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G ++SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIE GDHIWCARY+L
Sbjct  222  GVEKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEGGDHIWCARYLL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYST S+REEGGFEVIKKAILNLSLRH+ HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTLSIREEGGFEVIKKAILNLSLRHKGHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGR TEK  +GYLEDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRYTEKEARGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVTALLAETT+LW+PT
Sbjct  402  VVTALLAETTILWEPT  417



>ref|XP_006653841.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase, chloroplastic-like 
[Oryza brachyantha]
Length=410

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  200  GSDKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  259

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH  HI
Sbjct  260  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHI  319

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  320  SAYGEGNERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAQGKGYLEDRRPASNMDPY  379

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  380  VVTSLLAETTILWEPT  395



>ref|XP_008662331.1| PREDICTED: glutamine synthetase, chloroplastic isoform X1 [Zea 
mays]
 gb|ACF83467.1| unknown [Zea mays]
 gb|ACN27769.1| unknown [Zea mays]
 gb|ACF86733.2| unknown [Zea mays]
 gb|AFW59720.1| glutamine synthetase1 isoform 1 [Zea mays]
 gb|AFW59721.1| glutamine synthetase1 isoform 2 [Zea mays]
Length=423

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  213  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  272

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTK+MRE+GGFE IK+AILNLSLRH  HI
Sbjct  273  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHI  332

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  333  SAYGEGNERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  392

Query  339  VVtallaettlLWQPT  292
            +VT LLAETT+LWQP+
Sbjct  393  IVTGLLAETTILWQPS  408



>ref|NP_001105725.1| glutamine synthetase, chloroplastic precursor [Zea mays]
 sp|P25462.1|GLNAC_MAIZE RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Zea mays]
 emb|CAA46724.1| glutamine synthetase [Zea mays]
Length=423

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  213  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  272

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTK+MRE+GGFE IK+AILNLSLRH  HI
Sbjct  273  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHI  332

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  333  SAYGEGNERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  392

Query  339  VVtallaettlLWQPT  292
            +VT LLAETT+LWQP+
Sbjct  393  IVTGLLAETTILWQPS  408



>dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYK CLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  219  GADKSFGRDISDAHYKPCLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  278

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH  HI
Sbjct  279  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHI  338

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  339  SAYGEGNERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  398

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+PT
Sbjct  399  VVTSLLAETTILWEPT  414



>gb|ACG31728.1| hypothetical protein [Zea mays]
Length=382

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  172  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  231

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTK+MRE+GGFE IK+AILNLSLRH  HI
Sbjct  232  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHI  291

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  292  SAYGEGNERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  351

Query  339  VVtallaettlLWQPT  292
             VT LLAETT+LWQP+
Sbjct  352  TVTGLLAETTILWQPS  367



>gb|ACG35376.1| glutamine synthetase [Zea mays]
Length=427

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  217  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  276

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTK+MRE+GGFE IK+AILNLSLRH  HI
Sbjct  277  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHI  336

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  337  SAYGEGNERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  396

Query  339  VVtallaettlLWQPT  292
             VT LLAETT+LWQP+
Sbjct  397  TVTGLLAETTILWQPS  412



>gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula]
 gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula]
 gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPSVG EA DHIW +RYIL
Sbjct  218  GADKSFGRDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSVGTEAADHIWASRYIL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ H+
Sbjct  278  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKVHM  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASI+TFSWG+  RGCSIRVGR+TEK+GKGYLEDRRPASNMDPY
Sbjct  338  EAYGEGNERRLTGKHETASIDTFSWGIGKRGCSIRVGRETEKNGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            VVTALLAE+TLLW+PT
Sbjct  398  VVTALLAESTLLWEPT  413



>ref|XP_008662330.1| PREDICTED: glutamine synthetase, chloroplastic isoform X2 [Zea 
mays]
Length=512

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  302  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYIL  361

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTK+MRE+GGFE IK+AILNLSLRH  HI
Sbjct  362  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHI  421

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  422  SAYGEGNERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  481

Query  339  VVtallaettlLWQPT  292
            +VT LLAETT+LWQP+
Sbjct  482  IVTGLLAETTILWQPS  497



>gb|AHJ10962.1| chloroplast glutamine synthetase 2 isoform 2 [Lemna minor]
Length=424

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPS GI+AGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSAGIDAGDHIWVSRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTK+MRE+GGFE IKKA++NLSLRH++HI
Sbjct  282  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKTMREDGGFEEIKKAVVNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA+INTFSWGVANRGCS+RVGR+TEK GKGY+EDRRPASNMDPY
Sbjct  342  SAYGEGNERRLTGKHETANINTFSWGVANRGCSVRVGRETEKEGKGYMEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT+LLAETT+LW+P+
Sbjct  402  VVTSLLAETTILWEPS  417



>dbj|BAL45315.1| glutamine synthetase, partial [Boykinia occidentalis]
Length=274

 Score =   350 bits (898),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGIN+SGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RYIL
Sbjct  98   GADKSFGRDISDAHYKACLYAGINVSGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYIL  157

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRH++HI
Sbjct  158  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHI  217

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNM  349
            SAYGEGNERRLTGKHETASIN FSWGVANRGCS+RVGR+TE+ GKGYLEDRRPASNM
Sbjct  218  SAYGEGNERRLTGKHETASINQFSWGVANRGCSVRVGRETEQQGKGYLEDRRPASNM  274



>ref|XP_004960149.1| PREDICTED: glutamine synthetase, chloroplastic-like [Setaria 
italica]
Length=428

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+L
Sbjct  218  GAEKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI GDWNGAGCHTNYSTKSMRE+GGFE+IKKAILNLSLRH  HI
Sbjct  278  ERITEQAGVVLTLDPKPIPGDWNGAGCHTNYSTKSMREDGGFELIKKAILNLSLRHDLHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETASI+TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  338  SAYGEGNERRLTGLHETASIDTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            +VT LLAETT+LW+PT
Sbjct  398  IVTGLLAETTILWEPT  413



>ref|XP_006850815.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Amborella 
trichopoda]
 gb|ERN12396.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
Length=433

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDH+WC+RY+L
Sbjct  226  GADKAFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHVWCSRYLL  285

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPIEGDWNGAGCHTN+STKSMR+EGG+ VIKKAI NLSLRH++HI
Sbjct  286  ERITEMAGVVLSLDPKPIEGDWNGAGCHTNFSTKSMRDEGGYAVIKKAIRNLSLRHKEHI  345

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY
Sbjct  346  GAYGEGNERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPY  405

Query  339  VVtallaettlLWQPT  292
            VVT+LLAET +L++PT
Sbjct  406  VVTSLLAETAILFEPT  421



>ref|XP_003580719.1| PREDICTED: glutamine synthetase, chloroplastic [Brachypodium 
distachyon]
Length=430

 Score =   352 bits (904),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKAC+YAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  220  GSDKSFGRDISDAHYKACIYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTK+MRE+GGFEVIKKAILNLSLRH  HI
Sbjct  280  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKAMREDGGFEVIKKAILNLSLRHDLHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE +GKGYLEDRRPASNMDPY
Sbjct  340  SAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRDTEANGKGYLEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
             VTALLAETTLLW+PT
Sbjct  400  TVTALLAETTLLWEPT  415



>ref|XP_003594092.1| Glutamine synthetase [Medicago truncatula]
Length=1639

 Score =   374 bits (960),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  218  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
             AYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY
Sbjct  338  EAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPY  397

Query  339  VVtallaettlLWQPT  292
            VVTALLAE+TLLW+PT
Sbjct  398  VVTALLAESTLLWEPT  413


 Score =   357 bits (917),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  879   GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
             GAD+SFGRDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPSVG EA DHIW +RYIL
Sbjct  1429  GADKSFGRDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSVGTEAADHIWASRYIL  1488

Query  699   ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
             ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ H+
Sbjct  1489  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKVHM  1548

Query  519   SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
              AYGEGNERRLTGKHETASI+TFSWG+  RGCSIRVGR+TEK+GKGYLEDRRPASNMDPY
Sbjct  1549  EAYGEGNERRLTGKHETASIDTFSWGIGKRGCSIRVGRETEKNGKGYLEDRRPASNMDPY  1608

Query  339   VVtallaettlLWQPT  292
             VVTALLAE+TLLW+PT
Sbjct  1609  VVTALLAESTLLWEPT  1624


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 98/181 (54%), Gaps = 56/181 (31%)
 Frame = -2

Query  822  YAGINISGTNGEVMPGQWE---FQVGPSVGIEAGDHIWCARYILERITEQAGVVL-TLDP  655
            +  + I  T+G ++P  ++     +  +  ++ GDHIW +++  +RI +QAGVVL TL+P
Sbjct  848  FKSLEIQSTDGWMVPQVYQQSTRSMAFANSVKDGDHIWASKF--KRIAKQAGVVLLTLNP  905

Query  654  KPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKH  475
            +PIE   NGAG                                 +S   EGNER+LT KH
Sbjct  906  QPIE---NGAG---------------------------------MSGNNEGNERKLTVKH  929

Query  474  ETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  295
            ET SINTFSW              TEK+GKGYLEDR   SNMDPYVVT LLAE+TLLW+ 
Sbjct  930  ETVSINTFSW--------------TEKNGKGYLEDRPLVSNMDPYVVTTLLAESTLLWEQ  975

Query  294  T  292
            T
Sbjct  976  T  976



>gb|AAX18864.1| chloroplast glutamine synthetase, partial [Glycine max]
Length=281

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  106  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  165

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGC+TNYSTKSMRE+GGFEVIKKAILNLSLRH+DHI
Sbjct  166  ERITEQAGVVLSLDPKPIEGDWNGAGCYTNYSTKSMREDGGFEVIKKAILNLSLRHKDHI  225

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASN  352
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASN
Sbjct  226  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASN  281



>emb|CDY49365.1| BnaA08g29950D [Brassica napus]
Length=394

 Score =   348 bits (894),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GA++S+GRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+L
Sbjct  218  GAEKSWGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPAS  355
            SAYGEGNERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPAS
Sbjct  338  SAYGEGNERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPAS  392



>dbj|BAJ91545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  225  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  284

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  285  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  344

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  345  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  404

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  405  TVTALLAETTILWEPT  420



>emb|CAA34131.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  216  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  275

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  276  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  335

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  336  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  395

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  396  TVTALLAETTILWEPT  411



>gb|AFB69878.1| chloroplast glutamine synthetase isoform 2-1 [Secale cereale]
Length=427

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  217  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  276

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  277  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  336

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  337  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  396

Query  339  VVtallaettlLWQPT  292
             VTALLAE+T+LW+PT
Sbjct  397  TVTALLAESTILWEPT  412



>gb|AAX18865.1| chloroplast glutamine synthetase, partial [Glycine max]
Length=281

 Score =   343 bits (879),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKAC+YAGINISG NGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  106  GADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  165

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+LDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+D I
Sbjct  166  ERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDRI  225

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASN  352
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASN
Sbjct  226  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASN  281



>sp|P13564.2|GLNA2_HORVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA37643.1| unnamed protein product [Hordeum vulgare]
Length=434

 Score =   348 bits (892),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  224  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  283

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  284  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  343

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY
Sbjct  344  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPY  403

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  404  TVTALLAETTILWEPT  419



>gb|ACT22500.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  217  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  276

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  277  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  336

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY
Sbjct  337  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPY  396

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  397  TVTALLAETTILWEPT  412



>gb|AAZ30062.1| plastid glutamine synthetase isoform GS2c [Triticum aestivum]
 gb|AAZ80474.1| GS2 [Triticum aestivum]
 gb|ACT22493.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22495.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22498.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|AEH16638.1| glutamine synthetase [Triticum aestivum]
 gb|AEM42904.1| plastid glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|EMT11272.1| Glutamine synthetase leaf isozyme, chloroplastic [Aegilops tauschii]
Length=427

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  217  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  276

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  277  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  336

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY
Sbjct  337  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPY  396

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  397  TVTALLAETTILWEPT  412



>gb|ACT22496.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22497.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  217  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  276

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  277  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  336

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY
Sbjct  337  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPY  396

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  397  TVTALLAETTILWEPT  412



>dbj|BAJ95492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  225  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  284

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  285  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  344

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GK YLEDRRPASNMDPY
Sbjct  345  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKRYLEDRRPASNMDPY  404

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  405  TVTALLAETTILWEPT  420



>gb|AAZ30061.1| plastid glutamine synthetase isoform GS2b [Triticum aestivum]
Length=427

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGR ISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  217  GSDKSFGRGISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  276

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  277  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  336

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY
Sbjct  337  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPY  396

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  397  TVTALLAETTILWEPT  412



>dbj|BAG49063.1| glutamine synthetase [Lactuca sativa]
Length=266

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/168 (96%), Positives = 166/168 (99%), Gaps = 0/168 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+L
Sbjct  99   GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLL  158

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYST SMREEGGFEVIK+AILNLSLRH DHI
Sbjct  159  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKEAILNLSLRHADHI  218

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYL  376
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYL
Sbjct  219  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKAGKGYL  266



>gb|AAK49029.1| cytosolic glutamine synthetase [Populus tremula x Populus alba]
Length=356

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGDHIW ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDHIWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEQAGVVLSFDPKPIKGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>emb|CAA47373.2| glutamate--ammonia ligase [Nicotiana sylvestris]
Length=432

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFG DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL
Sbjct  222  GADKSFGLDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERIT QAGVVL+LDPKPIEGDWNGAGCHTNYST SMRE+GGFEVIKKA LNLSLRH++HI
Sbjct  282  ERITGQAGVVLSLDPKPIEGDWNGAGCHTNYSTLSMREDGGFEVIKKANLNLSLRHKEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEG   +LTG HETASI+ FSWGVA RG SIRVG DTEK GKGYLEDRRPASNMDPY
Sbjct  342  NAYGEGILEKLTGNHETASIDKFSWGVAFRGASIRVGADTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLAETT+LW+PT
Sbjct  402  VVTGLLAETTILWEPT  417



>gb|EMS53309.1| Glutamine synthetase leaf isozyme, chloroplastic [Triticum urartu]
Length=535

 Score =   346 bits (887),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYIL
Sbjct  209  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYIL  268

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  269  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  328

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY
Sbjct  329  AAYGEGNERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPY  388

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  389  TVTALLAETTILWEPT  404



>gb|EPS69972.1| glutamine synthetase, partial [Genlisea aurea]
Length=201

 Score =   332 bits (851),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  8    GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQIWAARYIL  67

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMR EGG+EVIKKAI  L LRH+ HI
Sbjct  68   ERITEIAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKHHI  127

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTE +GKGY EDRRPASNMDPY
Sbjct  128  AAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEAAGKGYFEDRRPASNMDPY  187

Query  339  VVtallaettlLWQ  298
            VVT+L+AETT+LW+
Sbjct  188  VVTSLIAETTILWK  201



>sp|P52783.1|GLNA_PINSY RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Pinus sylvestris]
 emb|CAA49476.1| glutamate--ammonia ligase [Pinus sylvestris]
Length=357

 Score =   337 bits (865),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLY+GINISG NGEVMPGQWEFQVGPSVGI A D +WCAR+I+
Sbjct  163  GADKAWGRDIVDAHYKACLYSGINISGINGEVMPGQWEFQVGPSVGISAADELWCARFIM  222

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE+AGVVL+ DPKPIEGDWNGAGCHTNYSTKSMR+EGGFEVIKKAI  L LRH++HI
Sbjct  223  ERITEKAGVVLSFDPKPIEGDWNGAGCHTNYSTKSMRKEGGFEVIKKAIEKLKLRHKEHI  282

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA +NTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  283  SAYGEGNERRLTGRHETADMNTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  342

Query  339  VVtallaettlLWQP  295
            +VT+++AETT+LW+P
Sbjct  343  IVTSMIAETTILWKP  357



>gb|AAZ30060.1| plastid glutamine synthetase isoform GS2a [Triticum aestivum]
Length=427

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G+D+SFGRDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW + YIL
Sbjct  217  GSDKSFGRDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASGYIL  276

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPI+GDWNGAGCHTNYST SMRE+GGF+VIKKAILNLSLRH  HI
Sbjct  277  ERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHI  336

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETASI+ FSW VANRGCSIRVGR+TE  GKGYLEDRRP SNMDPY
Sbjct  337  AAYGEGNERRLTGLHETASISDFSWCVANRGCSIRVGRETEAKGKGYLEDRRPPSNMDPY  396

Query  339  VVtallaettlLWQPT  292
             VTALLAETT+LW+PT
Sbjct  397  TVTALLAETTILWEPT  412



>gb|EPS57588.1| glutamine synthetase, partial [Genlisea aurea]
Length=283

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  89   GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQIWAARYIL  148

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMR EGG+EVIKKAI  L LRH+ HI
Sbjct  149  ERITEIAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKHHI  208

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTE +GKGY EDRRPASNMDPY
Sbjct  209  AAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEAAGKGYFEDRRPASNMDPY  268

Query  339  VVtallaettlLWQP  295
            VVT+L+AETT+LW+P
Sbjct  269  VVTSLIAETTILWKP  283



>gb|ABK21449.1| unknown [Picea sitchensis]
 gb|ABK23372.1| unknown [Picea sitchensis]
Length=357

 Score =   335 bits (859),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGPSVGI A D +WCARYI+
Sbjct  163  GADKAWGRDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPSVGISAADELWCARYIM  222

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE+ GVVL+ DPKPIEGDWNGAGCHTNYSTKS R+EGGFEVIKKAI  L LRH++HI
Sbjct  223  ERITEKEGVVLSFDPKPIEGDWNGAGCHTNYSTKSTRKEGGFEVIKKAIEKLRLRHKEHI  282

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA I+TFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  283  SAYGEGNERRLTGRHETADIHTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPASNMDPY  342

Query  339  VVtallaettlLWQP  295
            +VT+++AETT+LW+P
Sbjct  343  IVTSMIAETTILWKP  357



>ref|XP_010528562.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like isoform 
X2 [Tarenaya hassleriana]
Length=326

 Score =   334 bits (856),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  132  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYIL  191

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L +RH+DHI
Sbjct  192  ERITEIAGVVLSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIKKLEMRHKDHI  251

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  252  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  311

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW P
Sbjct  312  VVTSMIAETTILWNP  326



>gb|AGC24240.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC24241.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC82197.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC82198.1| glutamine synthetase 1, partial [Brassica napus]
Length=257

 Score =   331 bits (848),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  63   GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  122

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  123  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  182

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  183  SAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  242

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  243  TVTSMIAETTILWKP  257



>gb|AGC24242.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC24243.1| glutamine synthetase 1, partial [Brassica napus]
Length=249

 Score =   330 bits (846),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  55   GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  114

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  115  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  174

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  175  SAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  234

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  235  TVTSMIAETTILWKP  249



>ref|XP_010528561.1| PREDICTED: glutamine synthetase nodule isozyme-like isoform X1 
[Tarenaya hassleriana]
Length=356

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L +RH+DHI
Sbjct  222  ERITEIAGVVLSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIKKLEMRHKDHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW P
Sbjct  342  VVTSMIAETTILWNP  356



>gb|AGC82199.1| glutamine synthetase 1, partial [Brassica napus]
Length=255

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  61   GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  120

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  121  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  180

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  181  SAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  240

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  241  TVTSMIAETTILWKP  255



>emb|CAA52448.1| glutamate--ammonia ligase [Pinus sylvestris]
Length=357

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +WCAR+I+
Sbjct  163  GADKAWGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADELWCARFIM  222

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE+AGVVL+ DPKPIEGDWNGAGCHTNYSTKSMR+EGGFEVIKKAI  L LRH++HI
Sbjct  223  ERITEKAGVVLSFDPKPIEGDWNGAGCHTNYSTKSMRKEGGFEVIKKAIEKLKLRHKEHI  282

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA +NTFS GVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  283  SAYGEGNERRLTGRHETADMNTFSRGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  342

Query  339  VVtallaettlLWQP  295
            +VT+++AETT+LW+P
Sbjct  343  IVTSMIAETTILWKP  357



>gb|AJD14835.1| glutamine synthetase [Boehmeria nivea]
Length=356

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR EGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMVAETTILWKP  356



>ref|XP_010553887.1| PREDICTED: glutamine synthetase nodule isozyme [Tarenaya hassleriana]
Length=356

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRH+DHI
Sbjct  222  ERITEIAGVVLSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLRHKDHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            VV
Sbjct  342  VV  343



>ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus]
 gb|AEZ56958.1| glutamine synthetase [Cucumis sativus]
 gb|KGN57792.1| hypothetical protein Csa_3G304140 [Cucumis sativus]
Length=356

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G D++FGRDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GVDKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLKLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA I+TFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADIHTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMVAETTILWKP  356



>emb|CDY38104.1| BnaC02g06690D [Brassica napus]
Length=356

 Score =   332 bits (852),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  342  TVTSMVAETTILWKP  356



>ref|XP_011003750.1| PREDICTED: glutamine synthetase nodule isozyme [Populus euphratica]
Length=356

 Score =   332 bits (852),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDVVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMR +GGFEVIKKAI NL LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIAGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIGNLKLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A+TT+LW+P
Sbjct  342  VVTSMIADTTILWKP  356



>gb|AGC24238.1| glutamine synthetase 1 [Brassica napus]
Length=356

 Score =   332 bits (852),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  342  TVTSMVAETTVLWKP  356



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AE+T+LW+P
Sbjct  342  TVTSMIAESTILWKP  356



>emb|CDO98315.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI ++HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVNSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDEVWMARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GGF VIKKAI  L LRH+DHI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSDGGFNVIKKAIEKLKLRHKDHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT++W+P
Sbjct  342  VVTSMIAETTIVWKP  356



>ref|XP_009121474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 [Brassica 
rapa]
Length=356

 Score =   332 bits (851),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGKHETADINTFVWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  342  TVTSMIAETTILWKP  356



>pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco
Length=432

 Score =   335 bits (858),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFG DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL
Sbjct  222  GADKSFGLDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERIT QAGVVL+LDP PIEGD NGAGCHTNYST SMRE+GGFEVIKKA LNLSLRH +HI
Sbjct  282  ERITGQAGVVLSLDPLPIEGDTNGAGCHTNYSTLSMREDGGFEVIKKANLNLSLRHLEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEG   +LTG HETASI+ FSWGVA RG SIRVG DTEK GKGYLEDRRPASNMDPY
Sbjct  342  NAYGEGILEKLTGNHETASIDYFSWGVAFRGASIRVGADTEKQGKGYLEDRRPASNMDPY  401

Query  339  VVtallaettlLWQPT  292
            VVT LLA+TT+LW+PT
Sbjct  402  VVTGLLAQTTILWEPT  417



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score =   332 bits (851),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  342  TVTSMIAETTILWKP  356



>ref|XP_009370058.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   332 bits (850),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAINKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            VV
Sbjct  342  VV  343



>gb|AGC82204.1| glutamine synthetase 1, partial [Brassica napus]
Length=235

 Score =   327 bits (838),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  47   GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  106

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  107  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  166

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  167  SAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  226

Query  339  VV  334
             V
Sbjct  227  TV  228



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI GDWNGAG HTNYSTKSMR EGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT++W+P
Sbjct  342  VVTSMIAETTIVWKP  356



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  342  TVTSMIAETTILWKP  356



>ref|XP_009126124.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Brassica 
rapa]
Length=356

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  342  TVTSMVAETTILWKP  356



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AE+T+LW+P
Sbjct  342  TVTSMIAESTILWKP  356



>gb|AGC24239.1| glutamine synthetase 1 [Brassica napus]
 emb|CDX85499.1| BnaA02g03140D [Brassica napus]
Length=356

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETT+LW+P
Sbjct  342  TVTSMVAETTILWKP  356



>dbj|BAD11327.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDQLWMARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPIEGDWNGAG HTNYSTKSMR +GGFEVIKKAI  L L+H++HI
Sbjct  222  ERITEIAGVVVSFDPKPIEGDWNGAGAHTNYSTKSMRSDGGFEVIKKAIEKLGLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A TT+LW+P
Sbjct  342  VVTSMIANTTILWKP  356



>ref|NP_001284433.1| glutamine synthetase cytosolic isozyme [Cucumis melo]
 gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo]
Length=356

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G D++FGRDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GVDKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLKLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNM PY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMGPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMVAETTILWKP  356



>ref|XP_008229355.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Prunus mume]
Length=326

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  132  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  191

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR  GGFEVIKKAI  L LRH++HI
Sbjct  192  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRANGGFEVIKKAIEKLGLRHKEHI  251

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  252  AAYGEGNERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  311

Query  339  VVtallaettlLWQ  298
            VVT+L+AETTL+W+
Sbjct  312  VVTSLIAETTLVWK  325



>ref|XP_007036933.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
 gb|EOY21434.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
Length=356

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARY+L
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYLL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GG+E+IKKAI NL LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIENLKLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASVRVGRDTEKCGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>ref|NP_568335.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
 sp|Q9FMD9.1|GLN14_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-4; AltName: 
Full=Glutamate--ammonia ligase GLN1;4; Short=GLN1;4 [Arabidopsis 
thaliana]
 dbj|BAB10184.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL24414.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAM91149.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED92312.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
Length=356

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AE+T+LW+P
Sbjct  342  TVTSMIAESTILWKP  356



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G D++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYIL
Sbjct  162  GVDKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR EGG+EVIKKAI  L LRHR+HI
Sbjct  222  ERITEVAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHREHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>gb|AIK03054.1| glutamine synthetase [Eichhornia crassipes]
Length=356

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGR+TEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRETEKNGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMVAETTILWKP  356



>ref|XP_009338856.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAINKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            VV
Sbjct  342  VV  343



>ref|XP_003619869.1| Glutamine synthetase [Medicago truncatula]
 emb|CAA71316.1| glutamine synthetase [Medicago truncatula]
 gb|AES76087.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMRE GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRENGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRP+SNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPSSNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETTLLW+P
Sbjct  342  VVTSMIAETTLLWKP  356



>gb|KEH36742.1| glutamine synthetase domain protein [Medicago truncatula]
Length=393

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  218  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  277

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI
Sbjct  278  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHI  337

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKG  382
             AYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKG
Sbjct  338  EAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKG  383



>ref|XP_011083120.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Sesamum 
indicum]
Length=356

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISAGDQLWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI+GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH+ HI
Sbjct  222  ERITEIAGVVVSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKHHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>emb|CAA73366.1| glutamine synthetase [Lotus japonicus]
Length=356

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTK+MRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIKGDWNGAGAHTNYSTKTMREDGGYEVIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A+TT+LW+P
Sbjct  342  VVTSMIADTTILWKP  356



>sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus]
Length=356

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTK+MRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIKGDWNGAGAHTNYSTKTMREDGGYEVIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A+TT+LW+P
Sbjct  342  VVTSMIADTTILWKP  356



>ref|XP_011085871.1| PREDICTED: glutamine synthetase cytosolic isozyme [Sesamum indicum]
Length=356

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPIEGDWNGAG HTNYSTKSMR+EGG+E+IKKAI  L  RH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIEGDWNGAGAHTNYSTKSMRKEGGYEIIKKAIEKLGHRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA+INTF WGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETANINTFKWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W AR+IL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARFIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AE+T+LW+P
Sbjct  342  TVTSMIAESTILWKP  356



>ref|XP_008361978.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=396

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYIL
Sbjct  222  GADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYIL  281

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI
Sbjct  282  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHGEHI  341

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKG  382
            SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKG
Sbjct  342  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKG  387



>gb|AAW21273.1| glutamine synthetase [Saccharum officinarum]
Length=356

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVLT DPKPI GDWNGAG HTNYSTKSMR EGG+EVIK AI  L LRH++HI
Sbjct  222  ERITEIAGVVLTFDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEVIKAAIEKLKLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG S+RVGR+TE++GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A+TT+LW+P
Sbjct  342  VVTSMIADTTILWKP  356



>ref|XP_007043312.1| Glutamine synthetase 1,4 [Theobroma cacao]
 gb|EOX99143.1| Glutamine synthetase 1,4 [Theobroma cacao]
Length=356

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQLWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GG  VIKKAI  L LRH++HI
Sbjct  222  ERITEVAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGIHVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA IN+FSWGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINSFSWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTMLWKP  356



>ref|XP_009370556.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X2 
[Pyrus x bretschneideri]
Length=326

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  132  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  191

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  192  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEIIKKAIDKLGLRHKEHI  251

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  252  AAYGEGNERRLTGKHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  311

Query  339  VV  334
            +V
Sbjct  312  IV  313



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            +VT+++AETT+LW P
Sbjct  342  IVTSMVAETTILWNP  356



>ref|XP_008365754.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            +V
Sbjct  342  IV  343



>dbj|BAM84282.1| glutamine synthetase [Tulipa pulchella]
Length=353

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI+GDWNGAG HTNYSTKSMR +GG+EVI KAI  LSL+H++HI
Sbjct  222  ERITEIAGVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVILKAIEKLSLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            VV
Sbjct  342  VV  343



>sp|Q43785.1|GLNA3_MEDSA RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Glutamate--ammonia 
ligase [Medicago sativa]
 gb|AAB41554.1| cytosolic glutamine synthetase [Medicago sativa]
Length=356

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHET  INTFSWGVANRG S+RVGRDTEK GKGY EDRRP+SNMDPY
Sbjct  282  AAYGEGNERRLTGKHETTDINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPSSNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETTLLW+P
Sbjct  342  VVTSMIAETTLLWKP  356



>gb|AID48673.1| theanine synthetase [Camellia oleifera]
Length=356

 Score =   329 bits (844),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDQLWMARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPIEGDWNGAG HTNYSTKSMR +GGFEVIKKAI  L L+H++HI
Sbjct  222  ERITEIAGVVVSFDPKPIEGDWNGAGAHTNYSTKSMRSDGGFEVIKKAIEKLGLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPA NMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPAPNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A TT+LW+P
Sbjct  342  VVTSMIANTTILWKP  356



>ref|XP_001755833.1| predicted protein [Physcomitrella patens]
 gb|EDQ79506.1| predicted protein [Physcomitrella patens]
Length=360

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI +AHYKACLYAGI ISG NGEVMPGQWEFQVGPS GI A D +W ARYIL
Sbjct  162  GADKAWGRDIVNAHYKACLYAGIQISGINGEVMPGQWEFQVGPSKGIAAADQLWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPIEGDWNGAGCHTNYSTKSMREEGG+EVIKKAI  L LRHR+HI
Sbjct  222  ERITEIAGVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYEVIKKAIEKLGLRHREHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            ++YGEGNERRLTGKHETA +NTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  ASYGEGNERRLTGKHETADMNTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT ++A TT+LW P
Sbjct  342  VVTGMIAYTTILWSP  356



>ref|NP_001239821.1| cytosolic glutamine synthetase alpha [Glycine max]
 gb|ACU18102.1| unknown [Glycine max]
 gb|KHN43648.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   329 bits (844),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGV+++ DPKPI GDWNGAG H+NYSTKSMR+EGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEMAGVIVSFDPKPIPGDWNGAGAHSNYSTKSMRDEGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGSSIRVGRDTEKNGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>ref|XP_006372556.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|ABK94934.1| unknown [Populus trichocarpa]
 gb|ABK95264.1| unknown [Populus trichocarpa]
 gb|ERP50353.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   329 bits (844),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G D++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYIL
Sbjct  162  GVDKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR EGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEVAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>ref|XP_006391363.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28649.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=340

 Score =   329 bits (843),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  146  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYIL  205

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRH++HI
Sbjct  206  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIDKLGLRHKEHI  265

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  266  SAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  325

Query  339  VVtallaettlLWQP  295
            +VT+++AETTLLW P
Sbjct  326  IVTSMIAETTLLWNP  340



>gb|ABK95973.1| unknown [Populus trichocarpa]
Length=356

 Score =   329 bits (844),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDVVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMR +GGFEVIKKAI  L L+H++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIGKLQLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A+TT+LW+P
Sbjct  342  VVTSMIADTTILWKP  356



>prf||1804333C Gln synthetase
Length=430

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKA LYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYIL
Sbjct  220  GADKSFGRDIVDAHYKASLYAGINISGINGEVMPGQWEFQVGPSVGISAADEIWIARYIL  279

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  280  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHI  339

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  340  SAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  399

Query  339  VVtallaettlLWQPT  292
            VVT+++AETTLLW PT
Sbjct  400  VVTSMIAETTLLWNPT  415



>pdb|4IS4|A Chain A, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|B Chain B, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|C Chain C, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|D Chain D, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|E Chain E, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|F Chain F, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|G Chain G, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|H Chain H, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|I Chain I, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|J Chain J, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
Length=378

 Score =   330 bits (846),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  184  GADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYIL  243

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMRE GG+E+IKKAI  L LRH++HI
Sbjct  244  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRENGGYEIIKKAIEKLGLRHKEHI  303

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRP+SNMDPY
Sbjct  304  AAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPSSNMDPY  363

Query  339  VVtallaettlLWQP  295
            VVT+++AETTLLW+P
Sbjct  364  VVTSMIAETTLLWKP  378



>ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=356

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            +VT+++AETTLLW P
Sbjct  342  IVTSMIAETTLLWNP  356



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+EVI KAI  L LRH++HI
Sbjct  222  ERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVILKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AE+T+LW+P
Sbjct  342  TVTSMVAESTILWKP  356



>ref|XP_002888488.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64747.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISASDEVWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            +VT+++AETTLLW P
Sbjct  342  IVTSMIAETTLLWNP  356



>ref|XP_010453820.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Camelina 
sativa]
Length=356

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERIT+ AGVVL+LDPKPI GDWNGAG HTNYSTKSMRE+GG+E IKKAI  L LRH++HI
Sbjct  222  ERITQLAGVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEAIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AE+T+LW+P
Sbjct  342  TVTSMIAESTILWKP  356



>ref|XP_002318305.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE96525.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDVVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMR +GGFEVIKKAI  L L+H++HI
Sbjct  222  ERITEIAGVVVSFDPKPIAGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIGKLQLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A+TT+LW+P
Sbjct  342  VVTSMIADTTILWKP  356



>ref|XP_009370554.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X1 
[Pyrus x bretschneideri]
Length=356

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEIIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            +V
Sbjct  342  IV  343



>ref|XP_006400196.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
 dbj|BAJ34289.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41649.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
Length=356

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISGTNGEVMPGQWEFQVGP+VGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV +LDPKPI GDWNGAG HTNYSTK MRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITELAGVVPSLDPKPIPGDWNGAGAHTNYSTKPMREDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGKHETADINTFLWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AE+T+LW+P
Sbjct  342  TVTSMIAESTILWKP  356



>emb|CAA73063.1| cytosolic glutamine synthetase [Brassica napus]
 gb|ACF42115.1| cytosolic glutamine synthetase [Brassica oleracea var. botrytis]
 emb|CDY52941.1| BnaCnng23850D [Brassica napus]
Length=356

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETTLLW P
Sbjct  342  TVTSMIAETTLLWNP  356



>ref|XP_006844043.1| PREDICTED: glutamine synthetase nodule isozyme [Amborella trichopoda]
 gb|ERN05718.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda]
Length=356

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD IW ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDEIWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMRE+GG +VIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREDGGIDVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>gb|EYU45782.1| hypothetical protein MIMGU_mgv1a009017mg [Erythranthe guttata]
Length=355

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  161  GADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPAVGISAGDEVWIARYIL  220

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPIEGDWNGAG HTNYSTKSMRE+GG+E+I KAI  LSLRH++HI
Sbjct  221  ERITEIAGVVLSFDPKPIEGDWNGAGAHTNYSTKSMREDGGYEIILKAIEKLSLRHKEHI  280

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  281  AAYGEGNERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  340

Query  339  VV  334
            +V
Sbjct  341  IV  342



>gb|KFK41041.1| hypothetical protein AALP_AA2G077900 [Arabis alpina]
Length=356

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEIWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            +VT+++AETTLLW P
Sbjct  342  IVTSMIAETTLLWNP  356



>ref|XP_010271383.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Nelumbo 
nucifera]
Length=356

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAWGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR EGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSEGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGRHETADINTFVWGVANRGASIRVGRDTERAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>sp|O04867.1|GLNA1_ALNGL RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Alnus glutinosa]
 emb|CAA69937.1| glutamate synthetase [Alnus glutinosa]
Length=356

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAWGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI+GDWNGAG HTNYSTKSMR  GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSLDPKPIQGDWNGAGAHTNYSTKSMRNNGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETTLLW+P
Sbjct  342  VVTSMIAETTLLWKP  356



>ref|XP_008659016.1| PREDICTED: glutamine synthetase root isozyme 5 isoform X1 [Zea 
mays]
 gb|AFW89162.1| glutamine synthetase3 [Zea mays]
Length=306

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  111  GADKAFGRDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYIL  170

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AG+VL+LDPKPI+GDWNGAG HTNYSTKSMRE GG+EVIK+AI  L  RHR+HI
Sbjct  171  ERITEMAGIVLSLDPKPIKGDWNGAGAHTNYSTKSMREAGGYEVIKEAIEKLGKRHREHI  230

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  231  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  290

Query  339  VVtallaettlLWQ  298
            VVT ++A+TT+LW+
Sbjct  291  VVTGMIADTTILWK  304



>ref|XP_008358170.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
             V
Sbjct  342  XV  343



>gb|KHG29839.1| Glutamine synthetase cytosolic isozyme 1-1 [Gossypium arboreum]
Length=356

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDQIWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI GDWNGAG HTNYSTKSMR +GG +VIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGIDVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA IN+FSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINSFSWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>ref|XP_011022058.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Populus 
euphratica]
Length=356

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERI E AGVV++ DPKPI GDWNGAG HTNYSTKSMR EGG  VIKKAI  L LRH++HI
Sbjct  222  ERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNEGGIAVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT++W+P
Sbjct  342  VVTSMIAETTIIWKP  356



>ref|XP_006300523.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
 gb|EOA33421.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
Length=356

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISASDEIWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRP+SNMDPY
Sbjct  282  AAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPSSNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETTLLW P
Sbjct  342  VVTSMIAETTLLWNP  356



>ref|XP_011002191.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Populus 
euphratica]
Length=356

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G D++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPS+GI AGD +W ARYIL
Sbjct  162  GVDKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSIGISAGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYST+SMR EGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEVAGVVLSFDPKPIQGDWNGAGAHTNYSTESMRNEGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>ref|XP_003528974.1| PREDICTED: glutamine synthetase PR-2 [Glycine max]
 gb|KHN45263.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AG +++ DPKPI GDWNGAG H+NYSTKSMREEGG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGAIVSFDPKPIPGDWNGAGAHSNYSTKSMREEGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGSSIRVGRDTEKNGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>gb|KCW69395.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=313

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  119  GADKAFGRDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISASDELWVARYIL  178

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTK+MR EGG+E+IKKAI  L LRH++HI
Sbjct  179  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKTMRNEGGYEIIKKAIEKLGLRHKEHI  238

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  239  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  298

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  299  VVTSMIAETTILWKP  313



>ref|XP_009414782.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like [Musa 
acuminata subsp. malaccensis]
Length=357

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP VG+ AGD +W ARY+L
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPCVGVSAGDQLWVARYVL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI+GDWNGAG HTNYSTKSMR +GG+EVIK+AI  L  RH++HI
Sbjct  222  ERITEMAGVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVIKQAIEKLGWRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEKSGKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFVWGVANRGASIRVGRDTEKSGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQPT  292
             VT+++AETT+LW+PT
Sbjct  342  AVTSMIAETTILWKPT  357



>ref|XP_002306385.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE93381.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERI E AGVV++ DPKPI GDWNGAG HTNYSTKSMR EGG  VIKKAI  L LRH++HI
Sbjct  222  ERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNEGGIAVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT++W+P
Sbjct  342  VVTSMIAETTIIWRP  356



>dbj|BAL14865.1| putative cytosolic glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84283.1| glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84284.1| glutamine synthetase [Tulipa gesneriana]
Length=353

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI+GDWNGAG HTNYSTKSMR +GG+EVI KAI  L L+H++HI
Sbjct  222  ERITELAGVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVILKAIEKLGLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            VV
Sbjct  342  VV  343



>gb|AIR07817.1| cytosolic glutamine synthetase 1-2, partial [Vitis labrusca x 
Vitis vinifera]
Length=321

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  127  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  186

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI+GDWNGAG HTNYSTKSMR +GG+E+IKKAI  L LRH++HI
Sbjct  187  ERITEIAGVVVSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIEKLGLRHKEHI  246

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  247  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  306

Query  339  VVtallaettlLWQP  295
            VVT+++AE+T+LW+P
Sbjct  307  VVTSMIAESTILWKP  321



>ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
Length=356

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR  GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRANGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            VV
Sbjct  342  VV  343



>gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis]
Length=356

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRD+ D+HYK+CLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  162  GADKSFGRDVVDSHYKSCLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRHDGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKQGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>gb|KCW69394.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=348

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  154  GADKAFGRDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISASDELWVARYIL  213

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTK+MR EGG+E+IKKAI  L LRH++HI
Sbjct  214  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKTMRNEGGYEIIKKAIEKLGLRHKEHI  273

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  274  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  333

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  334  VVTSMIAETTILWKP  348



>gb|ACF42116.1| cytosolic glutamine synthetase [Brassica oleracea var. italica]
Length=356

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSSDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETTLLW P
Sbjct  342  TVTSMIAETTLLWNP  356



>dbj|BAM84285.1| glutamine synthetase [Tulipa fosteriana]
Length=353

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+LDPKPI+GDWNGAG HTNYSTKSMR +GG+EVI KAI  L L+H++HI
Sbjct  222  ERITETAGVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVILKAIEKLGLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            +V
Sbjct  342  IV  343



>ref|XP_010062276.1| PREDICTED: glutamine synthetase nodule isozyme-like [Eucalyptus 
grandis]
 gb|KCW69392.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=356

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISASDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTK+MR EGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKTMRNEGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>gb|ABK23723.1| unknown [Picea sitchensis]
 gb|ABR17424.1| unknown [Picea sitchensis]
Length=355

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI +GD +W ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPTVGISSGDQVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMREEGG +VIKKAI  L LRH++HI
Sbjct  222  ERITEVAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGIKVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTE+ GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEREGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            +V
Sbjct  342  IV  343



>ref|XP_004953842.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Setaria 
italica]
Length=356

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV+T DPKPI GDWNGAG HTNYSTKSMR +GG+EVIK AI  L LRH++HI
Sbjct  222  ERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTKSMRNDGGYEVIKAAIEKLKLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA INTFSWGVANRG S+RVGR+TE++GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT++W+P
Sbjct  342  VVTSMIAETTIIWKP  356



>ref|XP_009127474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 isoform 
X1 [Brassica rapa]
Length=356

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W AR+IL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARFIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETTLLW P
Sbjct  342  TVTSMIAETTLLWNP  356



>gb|ACJ11724.1| glutamine synthase [Gossypium hirsutum]
 gb|KJB77349.1| hypothetical protein B456_012G133400 [Gossypium raimondii]
 gb|KJB77350.1| hypothetical protein B456_012G133400 [Gossypium raimondii]
Length=356

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI D+HYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKSFGRDIVDSHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDQIWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI GDWNGAG HTNYSTKSMR +GG  VIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGINVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA IN+FSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINSFSWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT++W+P
Sbjct  342  VVTSMIAETTIIWKP  356



>ref|XP_012065801.1| PREDICTED: glutamine synthetase nodule isozyme-like [Jatropha 
curcas]
 gb|KDP43303.1| hypothetical protein JCGZ_24224 [Jatropha curcas]
Length=356

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GG  VIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGLAVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA I+TFSWGVANRG SIRVGRDTEKSGKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADIHTFSWGVANRGASIRVGRDTEKSGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>gb|AIR07816.1| cytosolic glutamine synthetase 1-1, partial [Vitis labrusca x 
Vitis vinifera]
Length=318

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWE+QVGPSVGI AGD +W +RYIL
Sbjct  124  GADKAWGRDIVDAHYKACLYAGINISGINGEVMPGQWEYQVGPSVGISAGDELWVSRYIL  183

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GGFEVIKKAI  L LRH++HI
Sbjct  184  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIEKLGLRHKEHI  243

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  244  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  303

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  304  VVTSMIAETTILWKP  318



>ref|XP_009800983.1| PREDICTED: glutamine synthetase-like [Nicotiana sylvestris]
Length=356

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDEVWTARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERI E AGVV++ DPKPI GDWNGAG HTNYSTKSMR +GG+EVIKKAI  L LRH++HI
Sbjct  222  ERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRADGGYEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTGKHETA+INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGKHETANINTFKWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT++W+P
Sbjct  342  VVTSMIAETTIIWKP  356



>emb|CAA54151.1| glutamine [Brassica napus]
 gb|AAX35342.1| glutamine synthetase [Brassica rapa subsp. pekinensis]
 emb|CDY16439.1| BnaA02g12430D [Brassica napus]
Length=356

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W AR+IL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARFIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETTLLW P
Sbjct  342  TVTSMIAETTLLWNP  356



>emb|CAA63963.1| glutamate synthetase [Lotus japonicus]
Length=356

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTK+MRE+GG+EVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIKGDWNGAGAHTNYSTKTMREDGGYEVIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPAS MDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASYMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A+TT+LW+P
Sbjct  342  VVTSMIADTTILWKP  356



>ref|XP_012086426.1| PREDICTED: glutamine synthetase cytosolic isozyme [Jatropha curcas]
 gb|KDP25795.1| hypothetical protein JCGZ_22517 [Jatropha curcas]
Length=356

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPAVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GG+EVIKKAI  L LRH+ HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEVIKKAIEKLGLRHKKHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVA+RG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVADRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>emb|CAN68162.1| hypothetical protein VITISV_015673 [Vitis vinifera]
Length=356

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI+GDWNGAG HTNYSTKSMR +GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AE+T+LW+P
Sbjct  342  VVTSMIAESTILWKP  356



>emb|CBI33470.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI+GDWNGAG HTNYSTKSMR +GG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>ref|XP_006374208.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP52005.1| glutamine synthetase family protein [Populus trichocarpa]
Length=348

 Score =   327 bits (838),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  154  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  213

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMR +GGFE+IKKAI  L LRH++HI
Sbjct  214  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGFEIIKKAIGKLQLRHKEHI  273

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA I+TFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  274  AAYGEGNERRLTGRHETADIHTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  333

Query  339  VVtallaettlLWQP  295
            +VT+++AETT+LW+P
Sbjct  334  IVTSMIAETTILWKP  348



>gb|AAP33169.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AG V++ DPKPI GDWNGAG HTNYSTKSMRE+GGFE+IKKAI  L L+H++HI
Sbjct  222  ERITEIAGAVVSFDPKPIPGDWNGAGAHTNYSTKSMREDGGFEIIKKAIEKLGLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYG+GNERRLTGKHETA INTFSWGVANRG S+RVGR+TEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGKGNERRLTGKHETADINTFSWGVANRGASVRVGRETEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            +VT+++AETT+LW+P
Sbjct  342  IVTSMIAETTILWKP  356



>sp|P38563.2|GLNA5_MAIZE RecName: Full=Glutamine synthetase root isozyme 5; AltName: Full=GS117; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
Length=357

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKAFGRDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AG+VL+LDPKPI+GDWNGAG HTNYSTKSMRE GG+EVIK+AI  L  RHR+HI
Sbjct  222  ERITEMAGIVLSLDPKPIKGDWNGAGAHTNYSTKSMREAGGYEVIKEAIEKLGRRHREHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQ  298
            VVT ++A+TT+LW+
Sbjct  342  VVTGMIADTTILWK  355



>ref|NP_001105297.1| glutamine synthetase root isozyme 5 [Zea mays]
 dbj|BAA03432.1| glutamine synthetase [Zea mays]
Length=357

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKAFGRDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AG+VL+LDPKPI+GDWNGAG HTNYSTKSMRE GG+EVIK+AI  L  RHR+HI
Sbjct  222  ERITEMAGIVLSLDPKPIKGDWNGAGAHTNYSTKSMREAGGYEVIKEAIEKLGRRHREHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQ  298
            VVT ++A+TT+LW+
Sbjct  342  VVTGMIADTTILWK  355



>ref|NP_001185327.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34476.1| glutamine synthetase [Arabidopsis thaliana]
Length=365

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKA LYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYIL
Sbjct  171  GADKSFGRDIVDAHYKASLYAGINISGINGEVMPGQWEFQVGPSVGISAADEIWIARYIL  230

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  231  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHI  290

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  291  SAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  350

Query  339  VVtallaettlLWQP  295
            VVT+++AETTLLW P
Sbjct  351  VVTSMIAETTLLWNP  365



>ref|NP_176794.1| glutamine synthetase [Arabidopsis thaliana]
 sp|Q8LCE1.2|GLN12_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-2; AltName: 
Full=Glutamate--ammonia ligase GLN1;2; Short=GLN1;2 [Arabidopsis 
thaliana]
 gb|AAG51310.1|AC026480_17 glutamine synthetase, putative [Arabidopsis thaliana]
 gb|AAM14052.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AAM67495.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34474.1| glutamine synthetase [Arabidopsis thaliana]
Length=356

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKA LYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYIL
Sbjct  162  GADKSFGRDIVDAHYKASLYAGINISGINGEVMPGQWEFQVGPSVGISAADEIWIARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETTLLW P
Sbjct  342  VVTSMIAETTLLWNP  356



>ref|NP_001268175.1| glutamine synthetase cytosolic isozyme 1 [Vitis vinifera]
 sp|P51118.1|GLNA1_VITVI RecName: Full=Glutamine synthetase cytosolic isozyme 1; AltName: 
Full=Glutamate--ammonia ligase [Vitis vinifera]
 emb|CAA63981.1| glutamine synthetase [Vitis vinifera]
 emb|CBI15615.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWE+QVGPSVGI AGD +W +RYIL
Sbjct  162  GADKAWGRDIVDAHYKACLYAGINISGINGEVMPGQWEYQVGPSVGISAGDELWVSRYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMR +GGFEVIKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>emb|CAA29058.1| glutamine synthetase [Pisum sativum]
Length=259

 Score =   323 bits (829),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ +AHYKACL+AGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  65   GADKAFGRDVVEAHYKACLFAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYIL  124

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVLT DPKPI+GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L  R  +HI
Sbjct  125  ERITEVAGVVLTFDPKPIKGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGKRLPEHI  184

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  185  SAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  244

Query  339  VV  334
            VV
Sbjct  245  VV  246



>gb|ACN40288.1| unknown [Picea sitchensis]
Length=355

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+++GRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI +GD +W ARYIL
Sbjct  162  GADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPTVGISSGDQVWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYSTKSMREEGG +VIKKAI  L LRH++HI
Sbjct  222  ERITEVAGVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGIKVIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG+HETA INTFSWGVANRG SIRVGRDTE+ GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEREGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            +V
Sbjct  342  IV  343



>gb|ACG47508.1| glutamine synthetase root isozyme 5 [Zea mays]
Length=357

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKAFGRDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AG+VL+LDPKPI+GDWNGAG HTNYSTKSMRE GG+EVIK+AI  L  RHR+HI
Sbjct  222  ERITEMAGIVLSLDPKPIKGDWNGAGAHTNYSTKSMREAGGYEVIKEAIEKLGRRHREHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQ  298
            VVT ++A+TT+LW+
Sbjct  342  VVTGMIADTTILWK  355



>dbj|BAD99526.1| glutamine synthetase [Camellia sinensis]
 gb|ADK46866.1| cytosolic glutamine synthetase [Camellia sinensis]
Length=356

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPIEGDWNGAG HTNYSTKSMR++GG++VIKKAI  L L+H++HI
Sbjct  222  ERITEIAGVVVSFDPKPIEGDWNGAGAHTNYSTKSMRKDGGYQVIKKAIEKLGLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A TT+LW+P
Sbjct  342  VVTSMIAATTILWKP  356



>ref|XP_002305885.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|EEE86396.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            G D++FGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GVDKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVL+ DPKPI+GDWNGAG HTNYST+SMR EGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEVAGVVLSFDPKPIQGDWNGAGAHTNYSTESMRNEGGYEIIKKAIEKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVA+RG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVADRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++AETT+LW+P
Sbjct  342  VVTSMIAETTILWKP  356



>emb|CAJ87510.1| putative glutamine synthetase [Pisum sativum]
Length=356

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRD+ +AHYKACL+AGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYIL
Sbjct  162  GADKAFGRDVVEAHYKACLFAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVVLT DPKPI+GDWNGAG HTNYSTKSMRE+GG+E+IKKAI  L  RH +HI
Sbjct  222  ERITEVAGVVLTFDPKPIKGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGKRHAEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTGKHETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VV  334
            VV
Sbjct  342  VV  343



>gb|ACD13217.1| glutamine synthetase [Brassica rapa subsp. chinensis]
Length=356

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD+SFGRDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W AR+IL
Sbjct  162  GADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARFIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGV+++ DPKPI GDWNGAG HTNYSTKSMREEGG+E+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVIVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            SAYGEGNERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  SAYGEGNERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
             VT+++AETTLLW P
Sbjct  342  TVTSMIAETTLLWNP  356



>gb|ABK94916.1| unknown [Populus trichocarpa]
Length=356

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPI GDWNGAG HTNYSTKSMR +GGFE+IKKAI  L LRH++HI
Sbjct  222  ERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGFEIIKKAIGKLQLRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA I+TFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADIHTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            +VT+++AETT+LW+P
Sbjct  342  IVTSMIAETTILWKP  356



>ref|XP_006649656.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like [Oryza 
brachyantha]
Length=356

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYIL
Sbjct  162  GADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGIAAADQVWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ER+TE AGVVL+LDPKPI+GDWNGAG HTN+STKSMRE GG+EVIKKAI  L+LRH++HI
Sbjct  222  ERVTEVAGVVLSLDPKPIQGDWNGAGAHTNFSTKSMREPGGYEVIKKAIDKLALRHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQ  298
            VVT ++AETTLLW+
Sbjct  342  VVTGMIAETTLLWK  355



>gb|ABK51388.1| cytosolic glutamine synthetase [Camellia sinensis]
Length=356

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -2

Query  879  GADQSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYIL  700
            GAD++FGRDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYIL
Sbjct  162  GADKAFGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYIL  221

Query  699  ERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHI  520
            ERITE AGVV++ DPKPIEGDWNGAG HTNYSTKSMR++GG++VIKKAI  L L+H++HI
Sbjct  222  ERITEIAGVVVSFDPKPIEGDWNGAGAHTNYSTKSMRKDGGYQVIKKAIEKLGLKHKEHI  281

Query  519  SAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY  340
            +AYGEGNERRLTG+HETA INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY
Sbjct  282  AAYGEGNERRLTGRHETADINTFLWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPY  341

Query  339  VVtallaettlLWQP  295
            VVT+++A TT+LW+P
Sbjct  342  VVTSMIAATTILWKP  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1991073159785