BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1350

Length=838
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07546.1|  unnamed protein product                                246   6e-74   Coffea canephora [robusta coffee]
ref|XP_004252785.1|  PREDICTED: probable protein phosphatase 2C 55      245   2e-73   Solanum lycopersicum
ref|XP_011083714.1|  PREDICTED: probable protein phosphatase 2C 5...    244   6e-73   Sesamum indicum [beniseed]
ref|XP_011083717.1|  PREDICTED: probable protein phosphatase 2C 5...    244   6e-73   Sesamum indicum [beniseed]
ref|XP_006342592.1|  PREDICTED: probable protein phosphatase 2C 5...    243   8e-73   Solanum tuberosum [potatoes]
ref|XP_011074517.1|  PREDICTED: probable protein phosphatase 2C 55      243   9e-73   Sesamum indicum [beniseed]
ref|XP_009614756.1|  PREDICTED: probable protein phosphatase 2C 55      243   9e-73   Nicotiana tomentosiformis
ref|XP_009805012.1|  PREDICTED: probable protein phosphatase 2C 55      241   7e-72   Nicotiana sylvestris
gb|EYU32793.1|  hypothetical protein MIMGU_mgv1a004775mg                241   8e-72   Erythranthe guttata [common monkey flower]
ref|XP_009761616.1|  PREDICTED: probable protein phosphatase 2C 55      241   1e-71   Nicotiana sylvestris
ref|XP_009612193.1|  PREDICTED: probable protein phosphatase 2C 55      239   3e-71   Nicotiana tomentosiformis
ref|XP_010028040.1|  PREDICTED: probable protein phosphatase 2C 55      239   6e-71   Eucalyptus grandis [rose gum]
emb|CBI19663.3|  unnamed protein product                                231   1e-70   Vitis vinifera
gb|KJB14505.1|  hypothetical protein B456_002G129300                    236   6e-70   Gossypium raimondii
ref|XP_007017484.1|  Phosphatase 2c, putative isoform 6                 235   1e-69   
gb|EPS68754.1|  hypothetical protein M569_06015                         232   1e-69   Genlisea aurea
gb|KDP38477.1|  hypothetical protein JCGZ_04402                         233   3e-69   Jatropha curcas
ref|XP_008377320.1|  PREDICTED: probable protein phosphatase 2C 55      234   4e-69   Malus domestica [apple tree]
emb|CAN83089.1|  hypothetical protein VITISV_042874                     229   6e-69   Vitis vinifera
ref|XP_012071802.1|  PREDICTED: probable protein phosphatase 2C 5...    233   1e-68   Jatropha curcas
ref|XP_002510354.1|  protein phosphatase 2c, putative                   232   1e-68   
ref|XP_008466602.1|  PREDICTED: probable protein phosphatase 2C 5...    232   2e-68   Cucumis melo [Oriental melon]
ref|XP_008466601.1|  PREDICTED: probable protein phosphatase 2C 5...    232   2e-68   Cucumis melo [Oriental melon]
ref|XP_011652405.1|  PREDICTED: probable protein phosphatase 2C 5...    231   2e-68   Cucumis sativus [cucumbers]
ref|XP_011652404.1|  PREDICTED: probable protein phosphatase 2C 5...    231   3e-68   Cucumis sativus [cucumbers]
gb|KDO84475.1|  hypothetical protein CISIN_1g010417mg                   231   4e-68   Citrus sinensis [apfelsine]
ref|XP_006434953.1|  hypothetical protein CICLE_v10000910mg             231   4e-68   Citrus clementina [clementine]
ref|XP_006473471.1|  PREDICTED: probable protein phosphatase 2C 5...    231   4e-68   Citrus sinensis [apfelsine]
ref|XP_009365583.1|  PREDICTED: probable protein phosphatase 2C 55      231   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_010664663.1|  PREDICTED: probable protein phosphatase 2C 55      231   6e-68   Vitis vinifera
gb|KJB14503.1|  hypothetical protein B456_002G129300                    231   7e-68   Gossypium raimondii
emb|CBI17553.3|  unnamed protein product                                224   1e-67   Vitis vinifera
ref|XP_007017480.1|  Phosphatase 2c, putative isoform 2                 230   1e-67   
ref|XP_009364699.1|  PREDICTED: probable protein phosphatase 2C 55      229   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_010244316.1|  PREDICTED: probable protein phosphatase 2C 5...    229   2e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007017479.1|  Phosphatase 2c, putative isoform 1                 230   3e-67   
gb|KHG04398.1|  hypothetical protein F383_28830                         229   3e-67   Gossypium arboreum [tree cotton]
ref|XP_012071803.1|  PREDICTED: probable protein phosphatase 2C 5...    229   4e-67   Jatropha curcas
ref|XP_010244315.1|  PREDICTED: probable protein phosphatase 2C 5...    229   4e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007017482.1|  Phosphatase 2c, putative isoform 4                 228   6e-67   
ref|XP_007017483.1|  Phosphatase 2c, putative isoform 5                 228   7e-67   
ref|XP_009386157.1|  PREDICTED: probable protein phosphatase 2C 5...    224   7e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS48221.1|  putative protein phosphatase 2C 55                      220   7e-67   Triticum urartu
ref|XP_009386156.1|  PREDICTED: probable protein phosphatase 2C 5...    225   1e-66   
ref|XP_009416847.1|  PREDICTED: probable protein phosphatase 2C 55      225   3e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003544423.1|  PREDICTED: probable protein phosphatase 2C 5...    226   3e-66   Glycine max [soybeans]
gb|EMT00499.1|  Putative protein phosphatase 2C 55                      219   3e-66   
ref|XP_009386155.1|  PREDICTED: probable protein phosphatase 2C 8...    225   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268376.2|  PREDICTED: probable protein phosphatase 2C 5...    226   4e-66   Vitis vinifera
ref|XP_006595942.1|  PREDICTED: probable protein phosphatase 2C 5...    226   4e-66   Glycine max [soybeans]
ref|XP_010649173.1|  PREDICTED: probable protein phosphatase 2C 5...    226   4e-66   Vitis vinifera
dbj|BAC42578.1|  unknown protein                                        220   4e-66   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ98946.1|  predicted protein                                      222   5e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB58309.1|  hypothetical protein B456_009G204100                    225   8e-66   Gossypium raimondii
ref|XP_006434954.1|  hypothetical protein CICLE_v10000910mg             225   9e-66   Citrus clementina [clementine]
gb|KDO84477.1|  hypothetical protein CISIN_1g010417mg                   225   9e-66   Citrus sinensis [apfelsine]
ref|XP_006473470.1|  PREDICTED: probable protein phosphatase 2C 5...    225   9e-66   Citrus sinensis [apfelsine]
emb|CAB46038.1|  hypothetical protein                                   219   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574421.1|  PREDICTED: probable protein phosphatase 2C 55      220   2e-65   Brachypodium distachyon [annual false brome]
gb|EYU45128.1|  hypothetical protein MIMGU_mgv1a005010mg                223   3e-65   Erythranthe guttata [common monkey flower]
gb|KHN12726.1|  Hypothetical protein glysoja_008689                     223   3e-65   Glycine soja [wild soybean]
ref|XP_006425719.1|  hypothetical protein CICLE_v10025600mg             222   4e-65   Citrus clementina [clementine]
ref|XP_003550371.1|  PREDICTED: probable protein phosphatase 2C 5...    223   4e-65   Glycine max [soybeans]
ref|XP_006601312.1|  PREDICTED: probable protein phosphatase 2C 5...    223   5e-65   Glycine max [soybeans]
ref|XP_008798754.1|  PREDICTED: probable protein phosphatase 2C 55      222   7e-65   Phoenix dactylifera
ref|XP_007160777.1|  hypothetical protein PHAVU_001G015900g             223   7e-65   Phaseolus vulgaris [French bean]
ref|XP_009414756.1|  PREDICTED: probable protein phosphatase 2C 55      222   8e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025730.1|  PREDICTED: probable protein phosphatase 2C 80      219   1e-64   Populus euphratica
ref|XP_006375083.1|  hypothetical protein POPTR_0014s04230g             221   2e-64   
ref|XP_008241643.1|  PREDICTED: probable protein phosphatase 2C 80      219   3e-64   Prunus mume [ume]
gb|KJB58311.1|  hypothetical protein B456_009G204100                    221   3e-64   Gossypium raimondii
ref|XP_006414328.1|  hypothetical protein EUTSA_v10025106mg             220   3e-64   Eutrema salsugineum [saltwater cress]
ref|XP_010434801.1|  PREDICTED: probable protein phosphatase 2C 55      220   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010440128.1|  PREDICTED: probable protein phosphatase 2C 55      220   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006283668.1|  hypothetical protein CARUB_v10004725mg             220   4e-64   
ref|XP_002525110.1|  protein phosphatase 2c, putative                   218   4e-64   Ricinus communis
ref|XP_010905077.1|  PREDICTED: probable protein phosphatase 2C 55      220   4e-64   Elaeis guineensis
ref|NP_193391.3|  putative protein phosphatase 2C                       219   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375084.1|  hypothetical protein POPTR_0014s04230g             220   6e-64   
ref|XP_011031594.1|  PREDICTED: probable protein phosphatase 2C 55      220   6e-64   Populus euphratica
ref|XP_008338675.1|  PREDICTED: probable protein phosphatase 2C 80      218   6e-64   Malus domestica [apple tree]
ref|XP_004499136.1|  PREDICTED: probable protein phosphatase 2C 5...    220   6e-64   
ref|XP_007202065.1|  hypothetical protein PRUPE_ppa005911mg             218   9e-64   Prunus persica
ref|XP_006856074.1|  PREDICTED: probable protein phosphatase 2C 55      220   9e-64   Amborella trichopoda
ref|XP_010449755.1|  PREDICTED: probable protein phosphatase 2C 55      218   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009356669.1|  PREDICTED: probable protein phosphatase 2C 80      216   2e-63   Pyrus x bretschneideri [bai li]
gb|KFK26524.1|  hypothetical protein AALP_AA8G260300                    218   3e-63   Arabis alpina [alpine rockcress]
gb|KHG28173.1|  hypothetical protein F383_08076                         219   3e-63   Gossypium arboreum [tree cotton]
ref|XP_006599388.1|  PREDICTED: probable protein phosphatase 2C 5...    214   4e-63   
gb|KHN44501.1|  Hypothetical protein glysoja_035733                     214   5e-63   Glycine soja [wild soybean]
ref|XP_002868114.1|  hypothetical protein ARALYDRAFT_493218             216   5e-63   
emb|CDY40532.1|  BnaC01g19800D                                          216   6e-63   Brassica napus [oilseed rape]
ref|XP_010556299.1|  PREDICTED: probable protein phosphatase 2C 55      217   7e-63   Tarenaya hassleriana [spider flower]
ref|XP_009145699.1|  PREDICTED: probable protein phosphatase 2C 55      216   1e-62   
ref|XP_008786118.1|  PREDICTED: probable protein phosphatase 2C 5...    216   1e-62   Phoenix dactylifera
emb|CDY60192.1|  BnaA01g35420D                                          215   1e-62   Brassica napus [oilseed rape]
ref|XP_003547993.2|  PREDICTED: probable protein phosphatase 2C 5...    212   2e-62   
ref|XP_006599390.1|  PREDICTED: probable protein phosphatase 2C 5...    213   2e-62   
ref|XP_008377406.1|  PREDICTED: probable protein phosphatase 2C 55      216   2e-62   
ref|XP_010923448.1|  PREDICTED: probable protein phosphatase 2C 55      216   2e-62   Elaeis guineensis
ref|XP_009407379.1|  PREDICTED: probable protein phosphatase 2C 55      215   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006599391.1|  PREDICTED: probable protein phosphatase 2C 5...    212   2e-62   
ref|XP_006599386.1|  PREDICTED: probable protein phosphatase 2C 5...    213   3e-62   
ref|XP_007156917.1|  hypothetical protein PHAVU_002G028000g             214   3e-62   Phaseolus vulgaris [French bean]
ref|XP_006599387.1|  PREDICTED: probable protein phosphatase 2C 5...    212   3e-62   
ref|XP_004300615.1|  PREDICTED: probable protein phosphatase 2C 80      213   9e-62   Fragaria vesca subsp. vesca
ref|XP_007223264.1|  hypothetical protein PRUPE_ppa004472mg             213   2e-61   Prunus persica
ref|XP_008220774.1|  PREDICTED: probable protein phosphatase 2C 55      213   2e-61   Prunus mume [ume]
gb|KDP31794.1|  hypothetical protein JCGZ_12255                         209   3e-61   Jatropha curcas
ref|XP_010936931.1|  PREDICTED: probable protein phosphatase 2C 5...    213   4e-61   Elaeis guineensis
gb|KEH40106.1|  protein phosphatase 2C family protein                   213   4e-61   Medicago truncatula
ref|XP_006341911.1|  PREDICTED: probable protein phosphatase 2C 5...    209   6e-61   Solanum tuberosum [potatoes]
ref|XP_012079067.1|  PREDICTED: probable protein phosphatase 2C 80      209   1e-60   Jatropha curcas
gb|ACU19890.1|  unknown                                                 204   1e-60   Glycine max [soybeans]
ref|XP_006574705.1|  PREDICTED: probable protein phosphatase 2C 5...    207   2e-60   Glycine max [soybeans]
ref|XP_004238238.1|  PREDICTED: probable protein phosphatase 2C 55      207   3e-60   Solanum lycopersicum
ref|XP_008453722.1|  PREDICTED: probable protein phosphatase 2C 80      209   4e-60   Cucumis melo [Oriental melon]
gb|KHN00560.1|  Hypothetical protein glysoja_000228                     208   5e-60   Glycine soja [wild soybean]
ref|XP_004149170.1|  PREDICTED: probable protein phosphatase 2C 80      208   6e-60   Cucumis sativus [cucumbers]
ref|XP_004291892.1|  PREDICTED: probable protein phosphatase 2C 55      207   2e-59   Fragaria vesca subsp. vesca
ref|XP_012066208.1|  PREDICTED: probable protein phosphatase 2C 55      203   7e-59   Jatropha curcas
ref|XP_003538844.1|  PREDICTED: probable protein phosphatase 2C 5...    204   1e-58   Glycine max [soybeans]
gb|KJB43552.1|  hypothetical protein B456_007G205500                    199   2e-58   Gossypium raimondii
ref|XP_007156027.1|  hypothetical protein PHAVU_003G252300g             202   2e-58   Phaseolus vulgaris [French bean]
ref|XP_010099838.1|  putative protein phosphatase 2C 80                 203   2e-58   Morus notabilis
ref|XP_003564015.1|  PREDICTED: probable protein phosphatase 2C 55      204   3e-58   Brachypodium distachyon [annual false brome]
gb|KJB43550.1|  hypothetical protein B456_007G205500                    199   3e-58   Gossypium raimondii
ref|XP_002463676.1|  hypothetical protein SORBIDRAFT_01g004030          204   5e-58   Sorghum bicolor [broomcorn]
ref|XP_007156026.1|  hypothetical protein PHAVU_003G252300g             201   5e-58   Phaseolus vulgaris [French bean]
gb|KDP42845.1|  hypothetical protein JCGZ_23787                         203   6e-58   Jatropha curcas
ref|NP_001130546.1|  uncharacterized protein LOC100191645               203   6e-58   Zea mays [maize]
gb|EMT01244.1|  Putative protein phosphatase 2C 55                      197   1e-57   
ref|XP_002310798.2|  hypothetical protein POPTR_0007s12510g             201   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_008644409.1|  PREDICTED: probable protein phosphatase 2C 80      201   3e-57   Zea mays [maize]
gb|KJB43548.1|  hypothetical protein B456_007G205500                    199   4e-57   Gossypium raimondii
ref|XP_010558162.1|  PREDICTED: probable protein phosphatase 2C 8...    199   7e-57   Tarenaya hassleriana [spider flower]
ref|XP_007046996.1|  Phosphatase 2C family protein                      200   8e-57   
ref|XP_010558153.1|  PREDICTED: probable protein phosphatase 2C 8...    199   9e-57   Tarenaya hassleriana [spider flower]
ref|XP_006383232.1|  hypothetical protein POPTR_0005s12720g             199   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010999959.1|  PREDICTED: probable protein phosphatase 2C 8...    199   1e-56   Populus euphratica
gb|EMS60700.1|  putative protein phosphatase 2C 55                      197   1e-56   Triticum urartu
gb|KJB43549.1|  hypothetical protein B456_007G205500                    199   1e-56   Gossypium raimondii
ref|XP_010999955.1|  PREDICTED: probable protein phosphatase 2C 8...    199   1e-56   Populus euphratica
gb|KJB43554.1|  hypothetical protein B456_007G205500                    199   2e-56   Gossypium raimondii
gb|KJB17810.1|  hypothetical protein B456_003G016400                    197   2e-56   Gossypium raimondii
ref|XP_010465009.1|  PREDICTED: probable protein phosphatase 2C 80      197   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010484599.1|  PREDICTED: probable protein phosphatase 2C 80      197   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004981332.1|  PREDICTED: uncharacterized protein LOC101762678    201   1e-55   
gb|KHG03504.1|  hypothetical protein F383_27679                         195   1e-55   Gossypium arboreum [tree cotton]
ref|XP_004512015.1|  PREDICTED: probable protein phosphatase 2C 5...    196   2e-55   Cicer arietinum [garbanzo]
ref|XP_002865051.1|  predicted protein                                  194   8e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010444748.1|  PREDICTED: probable protein phosphatase 2C 80      193   9e-55   Camelina sativa [gold-of-pleasure]
ref|NP_201473.1|  putative protein phosphatase 2C 80                    193   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_975004.1|  putative protein phosphatase 2C 80                    193   1e-54   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ91094.1|  predicted protein                                      194   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009600510.1|  PREDICTED: probable protein phosphatase 2C 55      191   3e-54   Nicotiana tomentosiformis
ref|XP_009610356.1|  PREDICTED: probable protein phosphatase 2C 55      190   8e-54   Nicotiana tomentosiformis
ref|NP_001051657.1|  Os03g0809300                                       192   9e-54   
gb|EAY92287.1|  hypothetical protein OsI_14009                          192   1e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_006280550.1|  hypothetical protein CARUB_v10026491mg             191   1e-53   Capsella rubella
ref|XP_010547493.1|  PREDICTED: probable protein phosphatase 2C 80      191   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_006393865.1|  hypothetical protein EUTSA_v10004287mg             191   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010680832.1|  PREDICTED: probable protein phosphatase 2C 80      191   2e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK28352.1|  putative protein phosphatase 2c 55-like                 189   3e-53   Arabis alpina [alpine rockcress]
ref|XP_001758147.1|  predicted protein                                  185   4e-53   
ref|XP_009760583.1|  PREDICTED: probable protein phosphatase 2C 55      186   3e-52   Nicotiana sylvestris
emb|CDP02816.1|  unnamed protein product                                187   8e-52   Coffea canephora [robusta coffee]
ref|XP_011099582.1|  PREDICTED: probable protein phosphatase 2C 55      184   1e-51   
emb|CDY53852.1|  BnaA07g37470D                                          184   3e-51   Brassica napus [oilseed rape]
emb|CDY30759.1|  BnaC07g16590D                                          184   3e-51   Brassica napus [oilseed rape]
ref|XP_009103494.1|  PREDICTED: probable protein phosphatase 2C 80      184   4e-51   Brassica rapa
ref|XP_009764148.1|  PREDICTED: probable protein phosphatase 2C 55      182   6e-51   Nicotiana sylvestris
gb|KHN36141.1|  Hypothetical protein glysoja_003264                     182   2e-50   Glycine soja [wild soybean]
ref|XP_004251474.1|  PREDICTED: probable protein phosphatase 2C 55      181   2e-50   Solanum lycopersicum
gb|AES94920.2|  protein phosphatase 2C family protein                   182   3e-50   Medicago truncatula
ref|XP_003611962.1|  Mitochondrial catalytic protein                    182   3e-50   
gb|EEE60152.1|  hypothetical protein OsJ_13054                          189   6e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006366049.1|  PREDICTED: probable protein phosphatase 2C 5...    176   3e-48   Solanum tuberosum [potatoes]
gb|EYU44672.1|  hypothetical protein MIMGU_mgv1a007071mg                176   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_002974846.1|  hypothetical protein SELMODRAFT_101879             169   5e-47   
ref|XP_010106023.1|  putative protein phosphatase 2C 55                 173   1e-46   
ref|XP_002963762.1|  hypothetical protein SELMODRAFT_79882              167   2e-46   
ref|XP_004244138.1|  PREDICTED: probable protein phosphatase 2C 55      170   3e-46   Solanum lycopersicum
gb|EPS61381.1|  hypothetical protein M569_13414                         166   1e-45   Genlisea aurea
ref|XP_006366044.1|  PREDICTED: probable protein phosphatase 2C 5...    168   2e-45   
ref|XP_010070043.1|  PREDICTED: probable protein phosphatase 2C 80      159   2e-41   Eucalyptus grandis [rose gum]
emb|CDX99127.1|  BnaA06g18180D                                          141   3e-36   
gb|KIY99217.1|  hypothetical protein MNEG_8745                          122   3e-28   Monoraphidium neglectum
emb|CAN67462.1|  hypothetical protein VITISV_028052                     113   3e-27   Vitis vinifera
ref|XP_011075613.1|  PREDICTED: probable protein phosphatase 2C 55      111   3e-25   Sesamum indicum [beniseed]
ref|XP_005846774.1|  hypothetical protein CHLNCDRAFT_24539              107   9e-24   Chlorella variabilis
emb|CDP14203.1|  unnamed protein product                                107   1e-23   Coffea canephora [robusta coffee]
gb|ETK87262.1|  hypothetical protein, variant 2                         105   3e-23   Phytophthora parasitica
ref|XP_001696623.1|  serine/threonine phosphatase, family 2C            106   5e-23   Chlamydomonas reinhardtii
ref|XP_007040568.1|  Phosphatase 2C family protein, putative            104   9e-23   
gb|ETL40689.1|  hypothetical protein, variant 3                         105   1e-22   Phytophthora parasitica
ref|XP_008905224.1|  hypothetical protein, variant 3                    105   1e-22   Phytophthora parasitica INRA-310
gb|ETL93829.1|  hypothetical protein, variant 3                         104   1e-22   Phytophthora parasitica
ref|XP_011397842.1|  putative protein phosphatase 2C 80                 105   1e-22   Auxenochlorella protothecoides
gb|ETL40688.1|  hypothetical protein, variant 2                         104   1e-22   Phytophthora parasitica
ref|XP_008905223.1|  hypothetical protein, variant 2                    104   1e-22   Phytophthora parasitica INRA-310
gb|ETL93828.1|  hypothetical protein, variant 2                         104   1e-22   Phytophthora parasitica
gb|EYU20627.1|  hypothetical protein MIMGU_mgv1a021452mg                103   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_002274456.3|  PREDICTED: probable protein phosphatase 2C 55      102   6e-22   
ref|XP_005647282.1|  protein serine/threonine phosphatase 2C            101   1e-21   Coccomyxa subellipsoidea C-169
ref|XP_011026862.1|  PREDICTED: probable protein phosphatase 2C 80      101   2e-21   Populus euphratica
gb|EIE76334.1|  hypothetical protein RO3G_01038                         100   2e-21   Rhizopus delemar RA 99-880
gb|KJB24190.1|  hypothetical protein B456_004G132100                    100   2e-21   Gossypium raimondii
ref|XP_002945739.1|  Serine/threonine phosphatase, family 2C            101   3e-21   Volvox carteri f. nagariensis
gb|ACJ83637.1|  unknown                                               95.1    3e-21   Medicago truncatula
ref|XP_006681892.1|  hypothetical protein BATDEDRAFT_20752              100   3e-21   Batrachochytrium dendrobatidis JAM81
gb|ADE77197.1|  unknown                                               99.8    3e-21   Picea sitchensis
ref|XP_008463804.1|  PREDICTED: probable protein phosphatase 2C 55      100   4e-21   Cucumis melo [Oriental melon]
emb|CDP04031.1|  unnamed protein product                                100   4e-21   Coffea canephora [robusta coffee]
ref|XP_002284713.1|  PREDICTED: probable protein phosphatase 2C 55      100   4e-21   Vitis vinifera
ref|XP_009797174.1|  PREDICTED: probable protein phosphatase 2C 55    99.4    6e-21   Nicotiana sylvestris
ref|XP_007042336.1|  Phosphatase 2C 55, putative                        100   6e-21   
ref|XP_010086629.1|  putative protein phosphatase 2C 55               99.0    8e-21   Morus notabilis
ref|XP_004146087.1|  PREDICTED: probable protein phosphatase 2C 55    99.0    9e-21   Cucumis sativus [cucumbers]
ref|XP_007212971.1|  hypothetical protein PRUPE_ppa021121mg           97.8    2e-20   
gb|KCW57011.1|  hypothetical protein EUGRSUZ_I02678                     100   3e-20   Eucalyptus grandis [rose gum]
ref|XP_010030054.1|  PREDICTED: probable protein phosphatase 2C B...    100   3e-20   Eucalyptus grandis [rose gum]
emb|CDS07785.1|  hypothetical protein LRAMOSA01734                    97.8    4e-20   Lichtheimia ramosa
gb|EYU18664.1|  hypothetical protein MIMGU_mgv1a024169mg              97.1    5e-20   Erythranthe guttata [common monkey flower]
emb|CCA25951.1|  hypothetical protein SELMODRAFT_101879               94.7    7e-20   Albugo laibachii Nc14
ref|XP_006412349.1|  hypothetical protein EUTSA_v10024559mg           95.5    1e-19   Eutrema salsugineum [saltwater cress]
gb|EIE88469.1|  hypothetical protein RO3G_13180                       95.9    2e-19   Rhizopus delemar RA 99-880
dbj|GAN09367.1|  Ser/Thr phosphatase, family 2C                       96.3    2e-19   Mucor ambiguus
emb|CDH48835.1|  protein phosphatase 2c 80                            95.9    2e-19   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010236832.1|  PREDICTED: putative protein phosphatase 2C 23    93.2    2e-19   
emb|CDH53433.1|  protein phosphatase 2c-related protein               95.9    2e-19   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH53434.1|  protein phosphatase 2c-related protein               95.9    3e-19   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS12243.1|  hypothetical protein LRAMOSA04438                    95.9    3e-19   Lichtheimia ramosa
ref|XP_007212931.1|  hypothetical protein PRUPE_ppa021890mg           94.4    3e-19   
ref|XP_004955098.1|  PREDICTED: putative protein phosphatase 2C 2...  94.7    4e-19   Setaria italica
ref|XP_009400624.1|  PREDICTED: probable protein phosphatase 2C 55    95.5    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008226580.1|  PREDICTED: probable protein phosphatase 2C 55    94.4    5e-19   Prunus mume [ume]
ref|NP_567923.1|  putative protein phosphatase 2C 62                  93.6    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226369.1|  PREDICTED: probable protein phosphatase 2C 55    94.4    6e-19   Prunus mume [ume]
ref|XP_008352815.1|  PREDICTED: probable protein phosphatase 2C B...  92.0    6e-19   
ref|XP_006412350.1|  hypothetical protein EUTSA_v10024559mg           93.6    6e-19   Eutrema salsugineum [saltwater cress]
gb|KIY99196.1|  hypothetical protein MNEG_8763                        95.1    6e-19   Monoraphidium neglectum
emb|CEI91203.1|  hypothetical protein RMCBS344292_05501               94.4    7e-19   Rhizopus microsporus
ref|XP_010261223.1|  PREDICTED: probable protein phosphatase 2C 6...  97.1    7e-19   Nelumbo nucifera [Indian lotus]
ref|XP_007043012.1|  Phosphatase 2c-like protein isoform 1            97.1    9e-19   
emb|CDW91186.1|  serine threonine family 2c                           93.6    9e-19   Stylonychia lemnae
ref|XP_010261225.1|  PREDICTED: probable protein phosphatase 2C 6...  96.7    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_007214047.1|  hypothetical protein PRUPE_ppa017442mg           93.6    1e-18   
ref|XP_010437755.1|  PREDICTED: probable protein phosphatase 2C 62    90.1    1e-18   
emb|CAB38808.1|  putative protein                                     92.8    1e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CCI47547.1|  unnamed protein product                              97.1    1e-18   Albugo candida
ref|XP_009335499.1|  PREDICTED: probable protein phosphatase 2C 55    93.6    1e-18   Pyrus x bretschneideri [bai li]
emb|CEI89085.1|  hypothetical protein RMCBS344292_03456               93.6    1e-18   Rhizopus microsporus
ref|XP_009595170.1|  PREDICTED: probable protein phosphatase 2C 55    94.0    1e-18   Nicotiana tomentosiformis
ref|XP_009798171.1|  PREDICTED: probable protein phosphatase 2C 55    92.4    1e-18   Nicotiana sylvestris
ref|XP_006283128.1|  hypothetical protein CARUB_v10004154mg           93.2    2e-18   Capsella rubella
ref|XP_001777173.1|  predicted protein                                94.7    2e-18   
ref|XP_001564352.1|  conserved hypothetical protein                   90.9    3e-18   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_012071374.1|  PREDICTED: probable protein phosphatase 2C 55    91.7    3e-18   
ref|XP_009362473.1|  PREDICTED: probable protein phosphatase 2C 6...  95.1    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_010323161.1|  PREDICTED: probable protein phosphatase 2C 55    92.0    4e-18   
ref|XP_009362477.1|  PREDICTED: probable protein phosphatase 2C B...  95.1    4e-18   
ref|XP_009362476.1|  PREDICTED: probable protein phosphatase 2C B...  95.1    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_009362475.1|  PREDICTED: probable protein phosphatase 2C 6...  95.1    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_009362474.1|  PREDICTED: probable protein phosphatase 2C 6...  94.7    4e-18   
emb|CEP15662.1|  hypothetical protein                                 93.2    4e-18   Parasitella parasitica
ref|XP_009362471.1|  PREDICTED: probable protein phosphatase 2C B...  94.7    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_009362468.1|  PREDICTED: probable protein phosphatase 2C 6...  94.7    4e-18   Pyrus x bretschneideri [bai li]
gb|EYU18665.1|  hypothetical protein MIMGU_mgv1a024209mg              90.9    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_009362478.1|  PREDICTED: probable protein phosphatase 2C B...  94.7    4e-18   
ref|XP_009362469.1|  PREDICTED: probable protein phosphatase 2C 6...  94.7    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_006826982.1|  PREDICTED: probable protein phosphatase 2C 71    94.0    5e-18   Amborella trichopoda
ref|XP_009362470.1|  PREDICTED: probable protein phosphatase 2C 6...  94.7    5e-18   Pyrus x bretschneideri [bai li]
gb|KFK29974.1|  hypothetical protein AALP_AA7G201400                  94.4    5e-18   Arabis alpina [alpine rockcress]
gb|KFK29975.1|  hypothetical protein AALP_AA7G201400                  94.4    5e-18   Arabis alpina [alpine rockcress]
ref|XP_012084614.1|  PREDICTED: probable protein phosphatase 2C 6...  94.4    6e-18   
ref|XP_012084612.1|  PREDICTED: probable protein phosphatase 2C 6...  94.4    6e-18   
ref|XP_012084617.1|  PREDICTED: probable protein phosphatase 2C 6...  94.0    6e-18   Jatropha curcas
ref|XP_012084615.1|  PREDICTED: probable protein phosphatase 2C 6...  94.0    6e-18   Jatropha curcas
emb|CEJ04126.1|  hypothetical protein RMCBS344292_18093               91.7    6e-18   
ref|XP_010103824.1|  hypothetical protein L484_024126                 89.4    7e-18   
gb|EYU18666.1|  hypothetical protein MIMGU_mgv1a011411mg              90.5    9e-18   
emb|CEG64449.1|  hypothetical protein RMATCC62417_01420               90.9    1e-17   
ref|XP_009542733.1|  hypothetical protein HETIRDRAFT_380107           90.9    1e-17   
ref|XP_007214007.1|  hypothetical protein PRUPE_ppa014726mg           90.9    1e-17   
emb|CEG81394.1|  hypothetical protein RMATCC62417_15604               90.9    1e-17   
emb|CEG67319.1|  hypothetical protein RMATCC62417_03767               90.9    1e-17   
gb|EEE57432.1|  hypothetical protein OsJ_07634                        89.4    1e-17   
gb|ESA03680.1|  hypothetical protein GLOINDRAFT_336645                91.3    1e-17   
ref|XP_010698275.1|  protein phosphatase 2C-like protein              89.0    1e-17   
ref|XP_002525008.1|  protein phosphatase 2c, putative                 89.7    1e-17   
gb|EPB82617.1|  hypothetical protein HMPREF1544_10650                 91.7    2e-17   
ref|XP_004249735.1|  PREDICTED: probable protein phosphatase 2C 55    90.1    2e-17   
ref|XP_010432553.1|  PREDICTED: probable protein phosphatase 2C 62    89.7    2e-17   
gb|EPB93077.1|  hypothetical protein HMPREF1544_00151                 90.5    2e-17   
ref|XP_010653772.1|  PREDICTED: probable protein phosphatase 2C 55    89.0    2e-17   
emb|CBI29829.3|  unnamed protein product                              88.6    2e-17   
ref|XP_010030055.1|  PREDICTED: probable protein phosphatase 2C B...  92.0    2e-17   
sp|Q6H7J3.1|P2C24_ORYSJ  RecName: Full=Putative protein phosphata...  89.7    2e-17   
ref|XP_002867174.1|  hypothetical protein ARALYDRAFT_328389           90.1    2e-17   
ref|XP_002533514.1|  protein phosphatase 2c, putative                 92.4    2e-17   
ref|XP_010530608.1|  PREDICTED: probable protein phosphatase 2C 6...  88.2    2e-17   
dbj|GAN09792.1|  conserved hypothetical protein                       90.9    2e-17   
ref|XP_010530610.1|  PREDICTED: probable protein phosphatase 2C 6...  88.2    3e-17   
ref|XP_001689639.1|  predicted protein                                89.7    3e-17   
gb|EAY86810.1|  hypothetical protein OsI_08187                        89.4    3e-17   
emb|CEP12144.1|  hypothetical protein                                 89.7    3e-17   
ref|XP_010068812.1|  PREDICTED: probable protein phosphatase 2C 80    89.0    3e-17   
ref|XP_010530607.1|  PREDICTED: probable protein phosphatase 2C 6...  87.8    3e-17   
gb|EPZ34279.1|  hypothetical protein O9G_002999                       88.6    4e-17   
ref|XP_010444987.1|  PREDICTED: probable protein phosphatase 2C 62    88.2    4e-17   
ref|XP_008463803.1|  PREDICTED: probable protein phosphatase 2C 55    88.2    4e-17   
emb|CDY72337.1|  BnaAnng40740D                                        89.0    4e-17   
ref|XP_008226583.1|  PREDICTED: probable protein phosphatase 2C 55    88.6    4e-17   
ref|XP_010086628.1|  putative protein phosphatase 2C 55               88.6    5e-17   
ref|XP_010447232.1|  PREDICTED: probable protein phosphatase 2C 6...  90.1    5e-17   
ref|XP_010447231.1|  PREDICTED: probable protein phosphatase 2C 6...  89.7    5e-17   
ref|XP_003880435.1|  protein phosphatase 2C, related                  90.5    5e-17   
gb|EYU18663.1|  hypothetical protein MIMGU_mgv1a026339mg              87.8    6e-17   
ref|XP_012081237.1|  PREDICTED: probable protein phosphatase 2C 55    87.8    7e-17   
ref|XP_005704756.1|  phosphatase isoform 1                            87.8    8e-17   
ref|XP_005704755.1|  phosphatase isoform 2                            87.8    8e-17   
gb|EMT28555.1|  Putative protein phosphatase 2C 23                    85.5    1e-16   
ref|XP_003572633.1|  PREDICTED: putative protein phosphatase 2C 24    87.0    1e-16   
ref|XP_007226263.1|  hypothetical protein PRUPE_ppa018548mg           86.7    1e-16   
ref|XP_005708105.1|  phosphatase                                      87.0    1e-16   
emb|CBI15146.3|  unnamed protein product                              86.3    1e-16   
ref|XP_002300447.2|  hypothetical protein POPTR_0001s39000g           86.7    2e-16   
ref|XP_011045605.1|  PREDICTED: probable protein phosphatase 2C 80    86.7    2e-16   
ref|XP_007210721.1|  hypothetical protein PRUPE_ppa022635mg           86.7    2e-16   
ref|XP_003392773.1|  conserved hypothetical protein                   85.5    2e-16   
ref|XP_003878660.1|  conserved hypothetical protein                   85.1    2e-16   
ref|XP_009121670.1|  PREDICTED: probable protein phosphatase 2C 6...  89.4    2e-16   
gb|EJY70655.1|  Protein phosphatase 2C-related protein                86.3    3e-16   
ref|XP_009622463.1|  PREDICTED: probable protein phosphatase 2C 55    85.9    3e-16   
ref|XP_001686165.1|  conserved hypothetical protein                   84.7    4e-16   
ref|XP_006351386.1|  PREDICTED: probable protein phosphatase 2C 5...  85.9    4e-16   
ref|XP_008680538.1|  PREDICTED: putative protein phosphatase 2C 24    87.8    5e-16   
gb|EPY35807.1|  protein phosphatase 2C                                84.3    5e-16   
ref|XP_006354601.1|  PREDICTED: probable protein phosphatase 2C 8...  85.9    5e-16   
ref|XP_008366514.1|  PREDICTED: probable protein phosphatase 2C 55    85.9    5e-16   
gb|AFW63096.1|  hypothetical protein ZEAMMB73_264183                  87.4    5e-16   
ref|XP_008359355.1|  PREDICTED: probable protein phosphatase 2C 55    85.9    6e-16   
emb|CCC90223.1|  putative protein phosphatase 2C                      85.1    6e-16   
gb|KJB32020.1|  hypothetical protein B456_005G218800                  85.5    8e-16   
ref|XP_006351800.1|  PREDICTED: probable protein phosphatase 2C 7...  84.7    8e-16   
gb|KJB32025.1|  hypothetical protein B456_005G218800                  85.1    9e-16   
ref|XP_008391500.1|  PREDICTED: probable protein phosphatase 2C 71    87.0    9e-16   
ref|XP_003285997.1|  hypothetical protein DICPUDRAFT_86952            85.1    1e-15   
ref|XP_009341188.1|  PREDICTED: probable protein phosphatase 2C 55    85.1    1e-15   
gb|KJB32010.1|  hypothetical protein B456_005G218800                  85.1    1e-15   
emb|CBI18942.3|  unnamed protein product                              84.3    1e-15   
ref|XP_001441589.1|  hypothetical protein                             84.0    1e-15   
gb|EPY30693.1|  protein phosphatase 2C                                84.3    1e-15   
gb|KJB32013.1|  hypothetical protein B456_005G218800                  85.1    1e-15   
gb|KJB32018.1|  hypothetical protein B456_005G218800                  85.1    1e-15   
ref|XP_008226582.1|  PREDICTED: probable protein phosphatase 2C 55    85.1    1e-15   
gb|KJB32022.1|  hypothetical protein B456_005G218800                  84.7    1e-15   
gb|EJY83737.1|  Serine/threonine phosphatase, family 2C               85.5    1e-15   
ref|XP_006372807.1|  hypothetical protein POPTR_0017s05230g           83.2    1e-15   
gb|KJB32014.1|  hypothetical protein B456_005G218800                  84.7    1e-15   
ref|XP_001433954.1|  hypothetical protein                             84.3    1e-15   
gb|KJB32015.1|  hypothetical protein B456_005G218800                  84.7    1e-15   
ref|XP_009121595.1|  PREDICTED: probable protein phosphatase 2C 6...  85.9    1e-15   
ref|XP_008885062.1|  protein phosphatase 2C, putative                 86.3    2e-15   
gb|EJY79197.1|  Serine/threonine protein phosphatase                  84.7    2e-15   
emb|CCC47676.1|  putative protein phosphatase 2C                      83.6    2e-15   
ref|XP_007148425.1|  hypothetical protein PHAVU_006G207400g           86.7    2e-15   
gb|KIY63616.1|  protein serine/threonine phosphatase 2C               84.3    2e-15   
emb|CBI30073.3|  unnamed protein product                              82.8    2e-15   
emb|CDX75361.1|  BnaA01g03410D                                        85.1    2e-15   
gb|EPR59078.1|  putative protein phosphatase 2C                       85.9    2e-15   
gb|ESS30386.1|  putative protein phosphatase 2C                       85.9    2e-15   
gb|EPT31720.1|  protein phosphatase 2C, putative                      85.9    2e-15   
gb|KFH15044.1|  putative protein phosphatase 2C                       85.9    2e-15   
gb|EJY73813.1|  Serine/threonine phosphatase, family 2C               84.7    2e-15   
ref|XP_008229691.1|  PREDICTED: probable protein phosphatase 2C 80    85.1    2e-15   
ref|XP_003572738.1|  PREDICTED: putative protein phosphatase 2C 23    83.6    3e-15   
ref|XP_007212980.1|  hypothetical protein PRUPE_ppa022479mg           82.8    3e-15   
emb|CDX68984.1|  BnaC01g04690D                                        85.9    3e-15   
gb|EKG04956.1|  hypothetical protein TCSYLVIO_003978                  82.8    3e-15   
dbj|GAN03550.1|  folylpolyglutamate synthase                          85.9    3e-15   
ref|XP_813384.1|  hypothetical protein                                82.8    3e-15   
gb|EJY77099.1|  Serine/threonine phosphatase, family 2C               84.3    4e-15   
ref|XP_003560641.1|  PREDICTED: putative protein phosphatase 2C 24    83.2    4e-15   
ref|XP_002369495.1|  protein phosphatase 2C, putative                 84.7    4e-15   
ref|XP_009379587.1|  PREDICTED: probable protein phosphatase 2C 71    85.1    4e-15   
gb|KIM33310.1|  hypothetical protein M408DRAFT_326073                 82.0    4e-15   
ref|XP_008678849.1|  PREDICTED: putative protein phosphatase 2C 24    82.4    4e-15   
gb|KFG46767.1|  putative protein phosphatase 2C                       85.1    4e-15   
ref|XP_009613267.1|  PREDICTED: probable protein phosphatase 2C 62    83.6    5e-15   
ref|XP_805055.1|  hypothetical protein                                82.4    5e-15   
gb|KHG12651.1|  hypothetical protein F383_02061                       82.8    5e-15   
ref|XP_003547076.1|  PREDICTED: probable protein phosphatase 2C 6...  85.1    5e-15   
gb|KHN33513.1|  Hypothetical protein glysoja_005555                   85.1    6e-15   
ref|XP_002284716.1|  PREDICTED: probable protein phosphatase 2C 55    81.6    6e-15   
ref|XP_004341592.1|  stage ii sporulation protein e (spoiie) doma...  83.6    6e-15   
ref|NP_001151986.1|  T-cell activation protein phosphatase 2C-lik...  82.4    7e-15   
gb|EPY30410.1|  hypothetical protein STCU_04080                       79.3    7e-15   
dbj|GAM16845.1|  hypothetical protein SAMD00019534_000200             84.3    7e-15   
ref|XP_002297969.2|  hypothetical protein POPTR_0001s10840g           81.6    8e-15   
gb|EKF33459.1|  hypothetical protein MOQ_002672                       82.0    8e-15   
ref|XP_004146091.1|  PREDICTED: probable protein phosphatase 2C 55    81.3    8e-15   
ref|XP_011087848.1|  PREDICTED: probable protein phosphatase 2C 6...  84.3    9e-15   
ref|XP_009309924.1|  protein phosphatase 2C                           81.6    9e-15   
gb|AFW63097.1|  hypothetical protein ZEAMMB73_588977                  82.4    9e-15   
ref|XP_008782121.1|  PREDICTED: probable protein phosphatase 2C 62    83.2    9e-15   
ref|NP_001151619.1|  LOC100285253                                     82.8    1e-14   
gb|EJY84822.1|  Serine/threonine phosphatase, family 2C               81.6    1e-14   
emb|CDO97469.1|  unnamed protein product                              83.6    1e-14   
ref|XP_009795764.1|  PREDICTED: probable protein phosphatase 2C 62    82.4    2e-14   
ref|XP_011462004.1|  PREDICTED: probable protein phosphatase 2C 55    80.9    2e-14   
gb|EPS57887.1|  hypothetical protein M569_16931                       80.1    2e-14   
ref|XP_004985380.1|  PREDICTED: probable protein phosphatase 2C B...  82.4    2e-14   
ref|XP_005823054.1|  hypothetical protein GUITHDRAFT_165821           82.4    2e-14   
ref|XP_008244493.1|  PREDICTED: probable protein phosphatase 2C 55    78.2    2e-14   
ref|XP_010926263.1|  PREDICTED: probable protein phosphatase 2C B...  81.6    2e-14   
ref|XP_001417158.1|  predicted protein                                80.5    3e-14   
ref|XP_004994085.1|  hypothetical protein PTSG_12210                  82.8    3e-14   
ref|XP_004983226.1|  PREDICTED: probable protein phosphatase 2C 7...  81.3    3e-14   
ref|XP_008218906.1|  PREDICTED: probable protein phosphatase 2C 6...  82.4    3e-14   
ref|XP_001307607.1|  expressed protein                                79.7    3e-14   
ref|XP_008218905.1|  PREDICTED: probable protein phosphatase 2C 6...  82.4    3e-14   
ref|XP_005849009.1|  hypothetical protein CHLNCDRAFT_144584           79.0    3e-14   
ref|XP_003571765.1|  PREDICTED: probable protein phosphatase 2C 7...  80.9    3e-14   
ref|XP_011395907.1|  putative protein phosphatase 2C 55               81.3    3e-14   
ref|XP_005832348.1|  hypothetical protein GUITHDRAFT_152698           80.9    4e-14   
gb|KIJ69408.1|  hypothetical protein HYDPIDRAFT_106015                80.9    4e-14   
gb|KJA27224.1|  hypothetical protein HYPSUDRAFT_35836                 79.3    5e-14   
ref|XP_008875750.1|  hypothetical protein H310_10999                  79.0    5e-14   
ref|XP_008226368.1|  PREDICTED: probable protein phosphatase 2C 55    80.1    5e-14   
gb|AFW88062.1|  hypothetical protein ZEAMMB73_602553                  80.1    5e-14   
ref|XP_844518.1|  protein phosphatase 2C                              79.3    5e-14   
ref|XP_004244352.1|  PREDICTED: probable protein phosphatase 2C 55    79.0    5e-14   
ref|XP_008660033.1|  PREDICTED: putative protein phosphatase 2C 24    80.1    5e-14   
ref|XP_006662299.1|  PREDICTED: probable protein phosphatase 2C 7...  80.5    5e-14   
gb|EAZ23911.1|  hypothetical protein OsJ_07633                        79.7    6e-14   
gb|KJB14506.1|  hypothetical protein B456_002G129300                  62.0    6e-14   
emb|CDW72503.1|  serine threonine family 2c                           79.7    6e-14   
sp|Q6H7J4.1|P2C23_ORYSJ  RecName: Full=Putative protein phosphata...  79.7    6e-14   
gb|EUT75679.1|  hypothetical protein PFAG_05995                       79.0    6e-14   
gb|KDP40767.1|  hypothetical protein JCGZ_24766                       78.6    6e-14   
ref|XP_010262929.1|  PREDICTED: probable protein phosphatase 2C 55    79.3    7e-14   
dbj|BAJ87820.1|  predicted protein                                    77.8    7e-14   
emb|CAN64454.1|  hypothetical protein VITISV_009531                   76.3    7e-14   
ref|XP_004029753.1|  protein phosphatase, putative                    79.7    7e-14   
gb|KII88511.1|  hypothetical protein PLICRDRAFT_30007                 79.3    9e-14   
ref|XP_003325878.1|  hypothetical protein PGTG_07080                  80.9    9e-14   
ref|XP_004032304.1|  t-cell activation protein phosphatase 2c, pu...  78.6    1e-13   
gb|EMS50480.1|  putative protein phosphatase 2C 71                    79.3    1e-13   
emb|CDJ35950.1|  T-cell activation protein phosphatase 2C, putative   80.5    1e-13   
ref|XP_012069252.1|  PREDICTED: probable protein phosphatase 2C 55    78.6    1e-13   
ref|XP_002043228.1|  GM17470                                          79.3    1e-13   
gb|ETW36431.1|  hypothetical protein PFTANZ_02831                     79.0    1e-13   
ref|XP_002011996.1|  GI16719                                          77.0    1e-13   
emb|CDO64527.1|  protein phosphatase, putative                        80.1    1e-13   
ref|XP_010666864.1|  PREDICTED: probable protein phosphatase 2C 6...  79.7    1e-13   
gb|KFM82782.1|  Protein phosphatase PTC7-like protein                 79.0    1e-13   
gb|ETW49281.1|  hypothetical protein PFMALIP_02783                    79.0    1e-13   
ref|XP_009829190.1|  hypothetical protein H257_05879                  78.2    1e-13   
ref|XP_010666863.1|  PREDICTED: probable protein phosphatase 2C 6...  79.7    1e-13   
gb|EUR71827.1|  hypothetical protein PFBG_02853                       79.0    1e-13   
ref|XP_004302000.1|  PREDICTED: probable protein phosphatase 2C 6...  80.5    2e-13   
gb|EFA76898.1|  protein phosphatase 2C-related protein                80.5    2e-13   
emb|CEG64649.1|  hypothetical protein RMATCC62417_01586               79.0    2e-13   
ref|XP_002499745.1|  predicted protein                                80.1    2e-13   
gb|EMT17535.1|  Putative protein phosphatase 2C 71                    79.0    2e-13   
gb|EAY86809.1|  hypothetical protein OsI_08186                        78.6    2e-13   
ref|XP_001347378.2|  protein phosphatase, putative                    78.6    2e-13   
emb|CCA73840.1|  related to PTC7-2C protein phosphatase               77.4    2e-13   
ref|XP_641223.1|  protein phosphatase 2C-related protein              79.7    2e-13   
ref|XP_004035251.1|  hypothetical protein IMG5_102650                 79.0    2e-13   
ref|XP_004366562.1|  protein phosphatase 2C-related protein           77.8    2e-13   
ref|XP_010234711.1|  PREDICTED: probable protein phosphatase 2C 7...  77.8    2e-13   
emb|CDW74148.1|  serine threonine family 2c                           78.6    2e-13   
dbj|BAJ91225.1|  predicted protein                                    78.2    2e-13   
gb|AAM08826.1|AC113335_6  Putative protein phosphatase 2C             78.2    3e-13   
dbj|BAK06252.1|  predicted protein                                    78.2    3e-13   
emb|CDI75966.1|  T-cell activation protein phosphatase 2C, putative   79.3    3e-13   
ref|XP_010663278.1|  PREDICTED: uncharacterized protein LOC100260...  79.3    3e-13   
ref|XP_004230532.1|  PREDICTED: probable protein phosphatase 2C 62    77.8    3e-13   
ref|XP_010663279.1|  PREDICTED: uncharacterized protein LOC100260...  79.3    3e-13   
ref|XP_002953999.1|  hypothetical protein VOLCADRAFT_64171            78.2    3e-13   
ref|XP_010685894.1|  PREDICTED: probable protein phosphatase 2C 26    77.8    3e-13   
gb|KIY99478.1|  hypothetical protein MNEG_8483                        79.0    3e-13   
ref|XP_010663282.1|  PREDICTED: uncharacterized protein LOC100260...  79.3    3e-13   
ref|XP_003560608.1|  PREDICTED: putative protein phosphatase 2C 24    77.4    3e-13   
ref|NP_001064455.1|  Os10g0370000                                     77.8    3e-13   
gb|AES63426.2|  SpoIIE-like protein phosphatase domain protein        79.7    3e-13   
ref|XP_003593175.1|  Protein phosphatase                              79.7    3e-13   
ref|XP_010521990.1|  PREDICTED: probable protein phosphatase 2C 26    77.4    4e-13   
gb|ETW56511.1|  hypothetical protein PFUGPA_01301                     79.0    4e-13   
ref|XP_003058086.1|  predicted protein                                76.6    4e-13   
gb|ETW30772.1|  hypothetical protein PFFCH_01812                      78.6    4e-13   
gb|EUR72073.1|  hypothetical protein PFBG_02852                       78.6    4e-13   
gb|ETW42660.1|  hypothetical protein PFNF135_02932                    78.6    4e-13   
gb|ETW18260.1|  hypothetical protein PFFVO_02776                      78.6    4e-13   
gb|EWC76449.1|  hypothetical protein C923_02870                       78.6    4e-13   
gb|EWC88473.1|  hypothetical protein PFNF54_02792                     78.6    4e-13   
ref|XP_001874852.1|  predicted protein                                78.2    5e-13   



>emb|CDP07546.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNAGDLPSSGQ+F +PVA GDVI+AGTDGLFDNLYN+DITAV
Sbjct  379  FRSPVQQHDFNFTYQLESGNAGDLPSSGQLFTIPVAPGDVIVAGTDGLFDNLYNNDITAV  438

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDKNRQTPFS+AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  439  VVHAVRAGLGPQVTAQKIAALARQRAQDKNRQTPFSSAAQDAGFRYYGGKLDDITVVVSY  498

Query  389  ITSENNENSSASHRS  345
            ITS+NNE +SA   S
Sbjct  499  ITSDNNEKTSACGSS  513



>ref|XP_004252785.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010314634.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=519

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNAGDLPSSG+VFK+PVA+GDVIIAGTDGLFDNLYN+DI A+
Sbjct  386  FRSPVQQHDFNFTYQLESGNAGDLPSSGEVFKIPVAQGDVIIAGTDGLFDNLYNNDINAI  445

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFS+AAQEAGFRYYGGKLDDITVVVSY
Sbjct  446  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGFRYYGGKLDDITVVVSY  505

Query  389  ITSENNENSSA  357
            I+S+ NE S++
Sbjct  506  ISSDRNERSNS  516



>ref|XP_011083714.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
 ref|XP_011083715.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
 ref|XP_011083716.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
Length=517

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNAGDLPSSG+VF +PVA+GDVIIAGTDGLFDNLYNSDITAV
Sbjct  383  FRSPVQQHDFNFTYQLEGGNAGDLPSSGEVFTIPVAQGDVIIAGTDGLFDNLYNSDITAV  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG  PQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  443  VVHAVRAGFAPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  502

Query  389  ITSENNENSSA  357
            I S++NEN SA
Sbjct  503  IASDHNENLSA  513



>ref|XP_011083717.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Sesamum 
indicum]
Length=516

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNAGDLPSSG+VF +PVA+GDVIIAGTDGLFDNLYNSDITAV
Sbjct  382  FRSPVQQHDFNFTYQLEGGNAGDLPSSGEVFTIPVAQGDVIIAGTDGLFDNLYNSDITAV  441

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG  PQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  442  VVHAVRAGFAPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  501

Query  389  ITSENNENSSA  357
            I S++NEN SA
Sbjct  502  IASDHNENLSA  512



>ref|XP_006342592.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342593.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Solanum tuberosum]
 ref|XP_006342594.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X3 
[Solanum tuberosum]
 ref|XP_006342595.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X4 
[Solanum tuberosum]
Length=519

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNAGDLPSSG+VFK+PVA+GDVII GTDGLFDNLYN+DI A+
Sbjct  386  FRSPVQQHDFNFTYQLESGNAGDLPSSGEVFKIPVAQGDVIITGTDGLFDNLYNNDINAI  445

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFS+AAQEAGFRYYGGKLDDITVVVSY
Sbjct  446  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGFRYYGGKLDDITVVVSY  505

Query  389  ITSENNENSSA  357
            I+S+ NE S++
Sbjct  506  ISSDRNERSNS  516



>ref|XP_011074517.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=518

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNAGDLPSSGQVF +PVA GDV+IAGTDGLFDNLYN+DITAV
Sbjct  384  FRSPVQQHDFNFTYQLESGNAGDLPSSGQVFTIPVAPGDVVIAGTDGLFDNLYNNDITAV  443

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQ TAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  444  VVHAVRAGLGPQATAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  503

Query  389  ITSENNE--NSSASH  351
            ITS++NE  +S +SH
Sbjct  504  ITSDHNESLSSKSSH  518



>ref|XP_009614756.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=518

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN+GDLPSSG+VFK+PVA GDVIIAGTDGLFDNLYN+DITA+
Sbjct  385  FRSPVQQHDFNFTYQLESGNSGDLPSSGEVFKIPVAPGDVIIAGTDGLFDNLYNNDITAI  444

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFS AAQEAGFRYYGGKLDDITVVVSY
Sbjct  445  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSAAAQEAGFRYYGGKLDDITVVVSY  504

Query  389  ITSENNENS  363
            I+S+ NE S
Sbjct  505  ISSDRNERS  513



>ref|XP_009805012.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009805013.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=517

 Score =   241 bits (615),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFT+QLE G+AGDLPSSG+V+K+PVA GDVIIAGTDGLFDNLYNSDITA+
Sbjct  383  FRSPVQQHDFNFTFQLESGSAGDLPSSGEVYKIPVAPGDVIIAGTDGLFDNLYNSDITAI  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGL PQVTAQKIAALARQRAQDKNRQTPFS AAQEAGFRYYGGKLDDITVVVSY
Sbjct  443  VVHATRAGLAPQVTAQKIAALARQRAQDKNRQTPFSAAAQEAGFRYYGGKLDDITVVVSY  502

Query  389  ITSENNENS  363
            ITS+ NE+S
Sbjct  503  ITSDKNESS  511



>gb|EYU32793.1| hypothetical protein MIMGU_mgv1a004775mg [Erythranthe guttata]
Length=511

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNAGDLPSSGQVF +PVA GDV+IAGTDGLFDNLYN+D+T+V
Sbjct  378  FRSPIQQHDFNFTYQLESGNAGDLPSSGQVFTIPVAPGDVVIAGTDGLFDNLYNNDVTSV  437

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDKNRQTPFS AAQEAGFRYYGGKLDDITVVVSY
Sbjct  438  VVHAMRAGLGPQVTAQKIAALARQRAQDKNRQTPFSAAAQEAGFRYYGGKLDDITVVVSY  497

Query  389  ITSENNENSSA  357
            IT+++NE  SA
Sbjct  498  ITNDHNEGLSA  508



>ref|XP_009761616.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009761618.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=518

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN+GDLPSSG+VFK+PVA GDVIIAGTDGLFDNLYN+DITA+
Sbjct  385  FRSPVQQHDFNFTYQLESGNSGDLPSSGEVFKIPVAPGDVIIAGTDGLFDNLYNNDITAI  444

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQ+TAQKIAALARQRAQDKNRQTPFS AAQEAGFRYYGGKLDDITVVVSY
Sbjct  445  VVHAARAGLGPQMTAQKIAALARQRAQDKNRQTPFSAAAQEAGFRYYGGKLDDITVVVSY  504

Query  389  ITSENNENS  363
            I+S+ NE S
Sbjct  505  ISSDRNERS  513



>ref|XP_009612193.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
 ref|XP_009612194.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=517

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFT+QLE G+AGDLPSSG+V+K+PVA GDVIIAGTDGLFDNLYNSDITA+
Sbjct  383  FRSPVQQHDFNFTFQLESGSAGDLPSSGEVYKIPVAPGDVIIAGTDGLFDNLYNSDITAI  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGL PQVTAQKIAALARQRA DKNRQTPFS AAQEAGFRYYGGKLDDITVVVSY
Sbjct  443  VVHATRAGLAPQVTAQKIAALARQRALDKNRQTPFSAAAQEAGFRYYGGKLDDITVVVSY  502

Query  389  ITSENNENSSA  357
            ITS+ NE+S++
Sbjct  503  ITSDKNESSNS  513



>ref|XP_010028040.1| PREDICTED: probable protein phosphatase 2C 55 [Eucalyptus grandis]
 ref|XP_010028118.1| PREDICTED: probable protein phosphatase 2C 55 [Eucalyptus grandis]
 gb|KCW88093.1| hypothetical protein EUGRSUZ_A00501 [Eucalyptus grandis]
Length=515

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFN TYQLECGN+GDLPSSGQVF +PVA GDV+IAGTDGLFDNLYN++ITAV
Sbjct  384  FRSPVQQHDFNLTYQLECGNSGDLPSSGQVFTIPVAPGDVVIAGTDGLFDNLYNNEITAV  443

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  444  VVHATRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  503

Query  389  ITSENNENSSAS  354
            IT   +E  S++
Sbjct  504  ITGSRDEKQSSA  515



>emb|CBI19663.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSGQVF +PVA GDV+IAGTDGLFDNLYN+++ AV
Sbjct  151  FRSPVQQHDFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVVIAGTDGLFDNLYNNEVIAV  210

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRA LGPQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AG RYYGGKLDDITVVVSY
Sbjct  211  VVHATRASLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGIRYYGGKLDDITVVVSY  270

Query  389  ITSENN  372
            ITS +N
Sbjct  271  ITSYSN  276



>gb|KJB14505.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14507.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14508.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=511

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVIIAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  441  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  500

Query  389  ITSENNENSS  360
            ITS   EN S
Sbjct  501  ITSSEEENKS  510



>ref|XP_007017484.1| Phosphatase 2c, putative isoform 6 [Theobroma cacao]
 gb|EOY14709.1| Phosphatase 2c, putative isoform 6 [Theobroma cacao]
Length=513

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDV+IAGTDGLFDNLYN++ITAV
Sbjct  383  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAGTDGLFDNLYNNEITAV  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  443  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  502

Query  389  ITSENNENSSA  357
            ITS   EN S+
Sbjct  503  ITSSEEENKSS  513



>gb|EPS68754.1| hypothetical protein M569_06015, partial [Genlisea aurea]
Length=415

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP+QQHDFNFTYQLE GN+GDLPSSGQVF VPVA GDV+IAGTDGLFDNLYNSDITAV
Sbjct  290  FRSPAQQHDFNFTYQLESGNSGDLPSSGQVFTVPVAPGDVVIAGTDGLFDNLYNSDITAV  349

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG GPQ+ AQKI ALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  350  VVHAQRAGFGPQIAAQKIVALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  409

Query  389  ITSENN  372
            I S+ +
Sbjct  410  IASDED  415



>gb|KDP38477.1| hypothetical protein JCGZ_04402 [Jatropha curcas]
Length=464

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF + VA GDVI+AGTDGLFDNLYNS+I AV
Sbjct  333  FRSPVQQHDFNFTYQLESGDNGDLPSSGQVFTIAVAPGDVIVAGTDGLFDNLYNSEINAV  392

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  393  VVHATRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  452

Query  389  ITSENNENSSAS  354
            ITS ++E+  +S
Sbjct  453  ITSSDDEHRPSS  464



>ref|XP_008377320.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
 ref|XP_008377321.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=507

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTVPVAPGDVIIAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  441  VVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  500

Query  389  ITSENN  372
            +TS N+
Sbjct  501  VTSSND  506



>emb|CAN83089.1| hypothetical protein VITISV_042874 [Vitis vinifera]
Length=375

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSGQVF +PVA GDV+IAGTDGLFDNLYN+++ AV
Sbjct  216  FRSPVQQHDFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVVIAGTDGLFDNLYNNEVIAV  275

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRA LGPQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AG RYYGGKLDDITVVVSY
Sbjct  276  VVHATRASLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGIRYYGGKLDDITVVVSY  335

Query  389  ITSENN  372
            ITS +N
Sbjct  336  ITSYSN  341



>ref|XP_012071802.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Jatropha 
curcas]
Length=516

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF + VA GDVI+AGTDGLFDNLYNS+I AV
Sbjct  385  FRSPVQQHDFNFTYQLESGDNGDLPSSGQVFTIAVAPGDVIVAGTDGLFDNLYNSEINAV  444

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  445  VVHATRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  504

Query  389  ITSENNENSSAS  354
            ITS ++E+  +S
Sbjct  505  ITSSDDEHRPSS  516



>ref|XP_002510354.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF52541.1| protein phosphatase 2c, putative [Ricinus communis]
Length=512

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  386  FRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEITAV  445

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  446  VVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  505

Query  389  ITSENN  372
            ITS ++
Sbjct  506  ITSTHD  511



>ref|XP_008466602.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Cucumis 
melo]
Length=503

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFT+QLE GN GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  377  FRSPVQQHDFNFTFQLESGNNGDLPSSGQVFSVPVAPGDVIIAGTDGLFDNLYNNEITAV  436

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLG QVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  437  VVHAMRAGLGAQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  496

Query  389  ITSENNE  369
            +TS N++
Sbjct  497  VTSSNDK  503



>ref|XP_008466601.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Cucumis 
melo]
Length=507

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFT+QLE GN GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTFQLESGNNGDLPSSGQVFSVPVAPGDVIIAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLG QVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  441  VVHAMRAGLGAQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  500

Query  389  ITSENNE  369
            +TS N++
Sbjct  501  VTSSNDK  507



>ref|XP_011652405.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Cucumis 
sativus]
 gb|KGN59939.1| hypothetical protein Csa_3G855330 [Cucumis sativus]
Length=503

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFT+QLE GN GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  377  FRSPVQQHDFNFTFQLESGNNGDLPSSGQVFSVPVAPGDVIIAGTDGLFDNLYNNEITAV  436

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLG QVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  437  VVHAMRAGLGAQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  496

Query  389  ITSENNE  369
            +TS N++
Sbjct  497  VTSSNDK  503



>ref|XP_011652404.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Cucumis 
sativus]
Length=507

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFT+QLE GN GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTFQLESGNNGDLPSSGQVFSVPVAPGDVIIAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLG QVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  441  VVHAMRAGLGAQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  500

Query  389  ITSENNE  369
            +TS N++
Sbjct  501  VTSSNDK  507



>gb|KDO84475.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
 gb|KDO84476.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=507

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  376  FRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEITAV  435

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  436  VVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  495

Query  389  ITSENNENSSAS  354
            IT+  +EN  +S
Sbjct  496  ITNCEDENKPSS  507



>ref|XP_006434953.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
 gb|ESR48193.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
Length=507

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  376  FRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEITAV  435

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  436  VVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  495

Query  389  ITSENNENSSAS  354
            IT+  +EN  +S
Sbjct  496  ITNCEDENKPSS  507



>ref|XP_006473471.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Citrus sinensis]
Length=507

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  376  FRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEITAV  435

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  436  VVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  495

Query  389  ITSENNENSSAS  354
            IT+  +EN  +S
Sbjct  496  ITNCEDENKPSS  507



>ref|XP_009365583.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=516

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN+GDLPSSGQVF VPVA  DVI+AGTDGLFDNLYN++ITAV
Sbjct  390  FRSPVQQHDFNFTYQLESGNSGDLPSSGQVFTVPVAPRDVIVAGTDGLFDNLYNNEITAV  449

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  450  VVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  509

Query  389  ITSENN  372
            +TS N+
Sbjct  510  VTSSND  515



>ref|XP_010664663.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664664.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664665.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664666.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=519

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSGQVF +PVA GDV+IAGTDGLFDNLYN+++ AV
Sbjct  384  FRSPVQQHDFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVVIAGTDGLFDNLYNNEVIAV  443

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRA LGPQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AG RYYGGKLDDITVVVSY
Sbjct  444  VVHATRASLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGIRYYGGKLDDITVVVSY  503

Query  389  ITSENN  372
            ITS +N
Sbjct  504  ITSYSN  509



>gb|KJB14503.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14504.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=514

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVIIAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  441  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  500

Query  389  ITS  381
            ITS
Sbjct  501  ITS  503



>emb|CBI17553.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G AGDLPSSGQVF +PVA GDVI+AGTDGLFDNLYNS++TAV
Sbjct  206  FQSPVQQHGFNFTYQLESGRAGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNSEVTAV  265

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD+ RQTPFSTAAQ+AGFRYYGGKLDDITVVVS+
Sbjct  266  VVHAVRAGLGPQVTAQKIAALARQRAQDRMRQTPFSTAAQDAGFRYYGGKLDDITVVVSF  325

Query  389  ITSENN  372
            ITS +N
Sbjct  326  ITSTSN  331



>ref|XP_007017480.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 ref|XP_007017481.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 gb|EOY14705.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 gb|EOY14706.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
Length=514

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDV+IAGTDGLFDNLYN++ITAV
Sbjct  383  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAGTDGLFDNLYNNEITAV  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  443  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  502

Query  389  ITS  381
            ITS
Sbjct  503  ITS  505



>ref|XP_009364699.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
 ref|XP_009364704.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=507

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTVPVAPGDVIIAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFS AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  441  VVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSPAAQDAGFRYYGGKLDDITVVVSY  500

Query  389  ITSENN  372
            +T  N+
Sbjct  501  VTGSND  506



>ref|XP_010244316.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Nelumbo 
nucifera]
Length=512

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLECGN GDLPSSGQVF +PVA GDVIIAGTDGLFDNLYN+++TAV
Sbjct  386  FQSPVQQHSFNFTYQLECGNGGDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEVTAV  445

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG  PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  446  VVHAARAGFEPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  505

Query  389  ITSENNE  369
            IT  + E
Sbjct  506  ITCSSKE  512



>ref|XP_007017479.1| Phosphatase 2c, putative isoform 1 [Theobroma cacao]
 gb|EOY14704.1| Phosphatase 2c, putative isoform 1 [Theobroma cacao]
Length=552

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDV+IAGTDGLFDNLYN++ITAV
Sbjct  383  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAGTDGLFDNLYNNEITAV  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  443  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  502

Query  389  ITSENNENSS  360
            ITS   +  S
Sbjct  503  ITSSEEKAPS  512



>gb|KHG04398.1| hypothetical protein F383_28830 [Gossypium arboreum]
Length=533

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVIIAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  441  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  500

Query  389  ITS  381
            ITS
Sbjct  501  ITS  503



>ref|XP_012071803.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Jatropha 
curcas]
Length=511

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF + VA GDVI+AGTDGLFDNLYNS+I AV
Sbjct  385  FRSPVQQHDFNFTYQLESGDNGDLPSSGQVFTIAVAPGDVIVAGTDGLFDNLYNSEINAV  444

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  445  VVHATRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  504

Query  389  ITSENN  372
            ITS ++
Sbjct  505  ITSSDD  510



>ref|XP_010244315.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Nelumbo 
nucifera]
Length=532

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLECGN GDLPSSGQVF +PVA GDVIIAGTDGLFDNLYN+++TAV
Sbjct  406  FQSPVQQHSFNFTYQLECGNGGDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEVTAV  465

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG  PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  466  VVHAARAGFEPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  525

Query  389  ITSENNE  369
            IT  + E
Sbjct  526  ITCSSKE  532



>ref|XP_007017482.1| Phosphatase 2c, putative isoform 4 [Theobroma cacao]
 gb|EOY14707.1| Phosphatase 2c, putative isoform 4 [Theobroma cacao]
Length=522

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDV+IAGTDGLFDNLYN++ITAV
Sbjct  383  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAGTDGLFDNLYNNEITAV  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  443  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  502

Query  389  ITS  381
            ITS
Sbjct  503  ITS  505



>ref|XP_007017483.1| Phosphatase 2c, putative isoform 5, partial [Theobroma cacao]
 gb|EOY14708.1| Phosphatase 2c, putative isoform 5, partial [Theobroma cacao]
Length=520

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDV+IAGTDGLFDNLYN++ITAV
Sbjct  383  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFAVPVAPGDVVIAGTDGLFDNLYNNEITAV  442

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  443  VVHAVRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  502

Query  389  ITS  381
            ITS
Sbjct  503  ITS  505



>ref|XP_009386157.1| PREDICTED: probable protein phosphatase 2C 55 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=383

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNA DLPS+ QVF  PV  GDVI+AGTDGLFDNLYNSDITAV
Sbjct  258  FRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVESGDVIVAGTDGLFDNLYNSDITAV  317

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  RAGLGPQV AQKIAALARQRAQDKNRQTPFST+AQEAG+RYYGGKLDDITVVVSY
Sbjct  318  VVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSTSAQEAGYRYYGGKLDDITVVVSY  377

Query  389  ITSENN  372
            IT+  N
Sbjct  378  ITAFGN  383



>gb|EMS48221.1| putative protein phosphatase 2C 55 [Triticum urartu]
Length=257

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -3

Query  767  EGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYN  588
            +G   C RSP QQHDFNF+YQL+ GN+ DLP++ QVFKVPVA GDVI+AGTDGLFDNLYN
Sbjct  126  DGCTLC-RSPVQQHDFNFSYQLQSGNSSDLPNAAQVFKVPVASGDVIVAGTDGLFDNLYN  184

Query  587  SDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDI  408
            +DITAVVVHATRAGL PQVTAQKIAALARQRAQDKNR TPFSTAAQ+AG+RYYGGKLDDI
Sbjct  185  NDITAVVVHATRAGLDPQVTAQKIAALARQRAQDKNRPTPFSTAAQDAGYRYYGGKLDDI  244

Query  407  TVVVSYITSENN  372
            TVVVSY+T+  N
Sbjct  245  TVVVSYVTAFGN  256



>ref|XP_009386156.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNA DLPS+ QVF  PV  GDVI+AGTDGLFDNLYNSDITAV
Sbjct  317  FRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVESGDVIVAGTDGLFDNLYNSDITAV  376

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  RAGLGPQV AQKIAALARQRAQDKNRQTPFST+AQEAG+RYYGGKLDDITVVVSY
Sbjct  377  VVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSTSAQEAGYRYYGGKLDDITVVVSY  436

Query  389  ITSENN  372
            IT+  N
Sbjct  437  ITAFGN  442



>ref|XP_009416847.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=470

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN  DLPS+ QVF  PV+ GDVIIAGTDGLFDNLYN++ITAV
Sbjct  345  FRSPVQQHDFNFTYQLESGNGSDLPSAAQVFTFPVSSGDVIIAGTDGLFDNLYNNEITAV  404

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRAQD+NRQTPFSTAAQ+AG+RYYGGKLDDITVVVSY
Sbjct  405  VVHATRAGLGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGYRYYGGKLDDITVVVSY  464

Query  389  ITSEN  375
            IT+ +
Sbjct  465  ITASD  469



>ref|XP_003544423.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
 gb|KHN20995.1| Hypothetical protein glysoja_009303 [Glycine soja]
Length=506

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECG+ GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  380  FRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEITAV  439

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  440  VVHAMRAGLSPQVTAQKIAALARQRAMDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  499

Query  389  IT  384
            IT
Sbjct  500  IT  501



>gb|EMT00499.1| Putative protein phosphatase 2C 55 [Aegilops tauschii]
Length=277

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -3

Query  767  EGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYN  588
            +G   C RSP QQHDFNF+YQL+ GN+ DLP++ QVFKVPVA GDVI+AGTDGLFDNLYN
Sbjct  146  DGCTLC-RSPVQQHDFNFSYQLQSGNSSDLPNAAQVFKVPVASGDVIVAGTDGLFDNLYN  204

Query  587  SDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDI  408
            +DITAVVVHATRAGL PQVTAQKIAALARQRAQDKNR TPFSTAAQ+AG+RYYGGKLDDI
Sbjct  205  NDITAVVVHATRAGLEPQVTAQKIAALARQRAQDKNRPTPFSTAAQDAGYRYYGGKLDDI  264

Query  407  TVVVSYITSENN  372
            TVVVSY+T+  N
Sbjct  265  TVVVSYVTAFGN  276



>ref|XP_009386155.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=472

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNA DLPS+ QVF  PV  GDVI+AGTDGLFDNLYNSDITAV
Sbjct  347  FRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVESGDVIVAGTDGLFDNLYNSDITAV  406

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  RAGLGPQV AQKIAALARQRAQDKNRQTPFST+AQEAG+RYYGGKLDDITVVVSY
Sbjct  407  VVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSTSAQEAGYRYYGGKLDDITVVVSY  466

Query  389  ITSENN  372
            IT+  N
Sbjct  467  ITAFGN  472



>ref|XP_002268376.2| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Vitis 
vinifera]
Length=500

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G AGDLPSSGQVF +PVA GDVI+AGTDGLFDNLYNS++TAV
Sbjct  374  FQSPVQQHGFNFTYQLESGRAGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNSEVTAV  433

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD+ RQTPFSTAAQ+AGFRYYGGKLDDITVVVS+
Sbjct  434  VVHAVRAGLGPQVTAQKIAALARQRAQDRMRQTPFSTAAQDAGFRYYGGKLDDITVVVSF  493

Query  389  ITSENN  372
            ITS +N
Sbjct  494  ITSTSN  499



>ref|XP_006595942.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=496

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECG+ GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  370  FRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEITAV  429

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  430  VVHAMRAGLSPQVTAQKIAALARQRAMDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  489

Query  389  IT  384
            IT
Sbjct  490  IT  491



>ref|XP_010649173.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649174.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649176.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
Length=501

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G AGDLPSSGQVF +PVA GDVI+AGTDGLFDNLYNS++TAV
Sbjct  375  FQSPVQQHGFNFTYQLESGRAGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNSEVTAV  434

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD+ RQTPFSTAAQ+AGFRYYGGKLDDITVVVS+
Sbjct  435  VVHAVRAGLGPQVTAQKIAALARQRAQDRMRQTPFSTAAQDAGFRYYGGKLDDITVVVSF  494

Query  389  ITSENN  372
            ITS +N
Sbjct  495  ITSTSN  500



>dbj|BAC42578.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63356.1| At4g16580 [Arabidopsis thaliana]
Length=300

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  171  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  230

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  231  VVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  290

Query  389  ITSENNE  369
            + +   E
Sbjct  291  VAASKEE  297



>dbj|BAJ98946.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -3

Query  767  EGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYN  588
            +G   C RSP QQHDFNF+YQLE GN+ DLP++ QVFKVPVA GDVI+AGTDGLFDNLYN
Sbjct  255  DGCTLC-RSPVQQHDFNFSYQLESGNSNDLPNAAQVFKVPVASGDVIVAGTDGLFDNLYN  313

Query  587  SDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDI  408
            +DITAVVVHATRAGL PQV AQKIAALARQRAQDKNRQ+PFSTAAQ+AGFRYYGGKLDDI
Sbjct  314  NDITAVVVHATRAGLEPQVAAQKIAALARQRAQDKNRQSPFSTAAQDAGFRYYGGKLDDI  373

Query  407  TVVVSYITSENN  372
            TVVVSY+T+  N
Sbjct  374  TVVVSYVTAFGN  385



>gb|KJB58309.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
 gb|KJB58310.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
 gb|KJB58312.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
Length=505

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN  DLPSSGQ+F VP+A GDVIIAGTDGLFDNLYN++ITAV
Sbjct  374  FRSPVQQHDFNFTYQLESGNNADLPSSGQIFAVPIAPGDVIIAGTDGLFDNLYNNEITAV  433

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG GP+VTAQKIAALAR+RAQ K+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  434  VVHALRAGFGPEVTAQKIAALARERAQAKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  493

Query  389  ITSENNENSSAS  354
            +TS +  +S  S
Sbjct  494  VTSSDEASSKKS  505



>ref|XP_006434954.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
 gb|ESR48194.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
Length=511

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  376  FRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEITAV  435

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  436  VVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  495

Query  389  ITS  381
            IT+
Sbjct  496  ITN  498



>gb|KDO84477.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=511

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  376  FRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEITAV  435

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  436  VVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  495

Query  389  ITS  381
            IT+
Sbjct  496  ITN  498



>ref|XP_006473470.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Citrus sinensis]
Length=511

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  376  FRSPVQQHDFNFTYQLEYGSNSDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEITAV  435

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  436  VVHAMRAGLGPQVTAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  495

Query  389  ITS  381
            IT+
Sbjct  496  ITN  498



>emb|CAB46038.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78700.1| hypothetical protein [Arabidopsis thaliana]
Length=335

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  206  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  265

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  266  VVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  325

Query  389  ITSENNE  369
            + +   E
Sbjct  326  VAASKEE  332



>ref|XP_003574421.1| PREDICTED: probable protein phosphatase 2C 55 [Brachypodium distachyon]
Length=380

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN+ DLPS+ QVF VP A GDV++AGTDGLFDNLYN++ITAV
Sbjct  250  FRSPIQQHDFNFTYQLESGNSSDLPSAAQVFMVPAASGDVLVAGTDGLFDNLYNNEITAV  309

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGL PQVTAQKIAALARQRAQDK RQTPFS+AAQEAG+RYYGGKLDDITVVVSY
Sbjct  310  VVHATRAGLEPQVTAQKIAALARQRAQDKGRQTPFSSAAQEAGYRYYGGKLDDITVVVSY  369

Query  389  ITS  381
            IT+
Sbjct  370  ITA  372



>gb|EYU45128.1| hypothetical protein MIMGU_mgv1a005010mg [Erythranthe guttata]
Length=501

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECGN+GD+PSSGQVF +PVA GDVIIAGT GLF NLYN DITAV
Sbjct  373  FRSPVQQHDFNFTYQLECGNSGDMPSSGQVFTIPVAPGDVIIAGTAGLFANLYNRDITAV  432

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIA  ARQRA DKNRQTPF TAAQEAGFRY GGKLDDI VVVSY
Sbjct  433  VVHAVRAGLGPQVTAQKIAVFARQRALDKNRQTPFFTAAQEAGFRYSGGKLDDIPVVVSY  492

Query  389  ITSENNEN  366
            I S+ N N
Sbjct  493  IASDPNAN  500



>gb|KHN12726.1| Hypothetical protein glysoja_008689 [Glycine soja]
Length=506

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECG+ GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  380  FRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEITAV  439

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GL PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  440  VVHAMRTGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  499

Query  389  ITSENN  372
            I+  ++
Sbjct  500  ISGSDD  505



>ref|XP_006425719.1| hypothetical protein CICLE_v10025600mg [Citrus clementina]
 ref|XP_006466757.1| PREDICTED: probable protein phosphatase 2C 80-like [Citrus sinensis]
 gb|ESR38959.1| hypothetical protein CICLE_v10025600mg [Citrus clementina]
 gb|KDO79493.1| hypothetical protein CISIN_1g013301mg [Citrus sinensis]
Length=446

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN GDLPSSGQVF +P A GDVI+AGTDGLFDNLYN+++TAV
Sbjct  320  FQSPVQQHGFNFTYQLESGNTGDLPSSGQVFTIPAAPGDVIVAGTDGLFDNLYNNEVTAV  379

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD+NRQTPFSTAAQ+AGFRYYGGKLDDITV+VSY
Sbjct  380  VVHALRAGLGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGFRYYGGKLDDITVIVSY  439

Query  389  IT  384
            I+
Sbjct  440  IS  441



>ref|XP_003550371.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
Length=506

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECG+ GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  380  FRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEITAV  439

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GL PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  440  VVHAMRTGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  499

Query  389  ITSENN  372
            I+  ++
Sbjct  500  ISGSDD  505



>ref|XP_006601312.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=496

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECG+ GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  370  FRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEITAV  429

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GL PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  430  VVHAMRTGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  489

Query  389  ITSENN  372
            I+  ++
Sbjct  490  ISGSDD  495



>ref|XP_008798754.1| PREDICTED: probable protein phosphatase 2C 55 [Phoenix dactylifera]
 ref|XP_008798755.1| PREDICTED: probable protein phosphatase 2C 55 [Phoenix dactylifera]
 ref|XP_008798756.1| PREDICTED: probable protein phosphatase 2C 55 [Phoenix dactylifera]
Length=486

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNA DLPS+ QVF  PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  361  FRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVAAGDVIVAGTDGLFDNLYNNEITAV  420

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRAQDKNRQTPFS+AAQEAG+RYYGGKLDDITVVVSY
Sbjct  421  VVHAIRAGLEPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGYRYYGGKLDDITVVVSY  480

Query  389  ITS  381
            +T+
Sbjct  481  VTA  483



>ref|XP_007160777.1| hypothetical protein PHAVU_001G015900g [Phaseolus vulgaris]
 gb|ESW32771.1| hypothetical protein PHAVU_001G015900g [Phaseolus vulgaris]
Length=507

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECG+ GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  381  FRSPVQQHDFNFTYQLECGSNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEITAV  440

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  441  VVHAMRAGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  500

Query  389  I  387
            I
Sbjct  501  I  501



>ref|XP_009414756.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE  NA DLPS+ QVF  PV  GDVI+AGTDGLFDNLYNS+ITAV
Sbjct  348  FRSPVQQHDFNFTYQLESNNASDLPSAAQVFSFPVESGDVIVAGTDGLFDNLYNSEITAV  407

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  RAGLGPQV AQKIAALARQRAQDKNRQTPFS AAQEAG+RYYGGKLDDITVVVSY
Sbjct  408  VVHGIRAGLGPQVMAQKIAALARQRAQDKNRQTPFSAAAQEAGYRYYGGKLDDITVVVSY  467

Query  389  ITSENNENSSA  357
            IT+  N+  S 
Sbjct  468  ITAFGNQAPSC  478



>ref|XP_011025730.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
 ref|XP_011025731.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
 ref|XP_011025732.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
Length=417

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVF +PVA GDVIIAGTDGLFDNLYN+++TAV
Sbjct  291  FESPVQQHGFNFTYQLETGNGGDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEVTAV  350

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GLGP+ TAQKIAALARQRA D NRQTPFSTAAQ+AG+RYYGGKLDDITVVVSY
Sbjct  351  VVHAIRTGLGPEATAQKIAALARQRALDTNRQTPFSTAAQDAGYRYYGGKLDDITVVVSY  410

Query  389  ITSENN  372
            +TS  N
Sbjct  411  VTSSAN  416



>ref|XP_006375083.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 ref|XP_006375085.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52880.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52882.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
Length=510

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++I AV
Sbjct  384  FRSPVQQHGFNFTYQLENGNNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEINAV  443

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQ TAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  444  VVHAMRAGLEPQATAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  503

Query  389  ITSENN  372
            ITS ++
Sbjct  504  ITSSDD  509



>ref|XP_008241643.1| PREDICTED: probable protein phosphatase 2C 80 [Prunus mume]
Length=438

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G+  DLPSSGQVF +PV  GDVIIAGTDGLFDNLYN+++TAV
Sbjct  312  FQSPVQQHGFNFTYQLESGSGADLPSSGQVFLIPVVPGDVIIAGTDGLFDNLYNNEVTAV  371

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRA DKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  372  VVHAVRAGLEPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  431

Query  389  ITSENN  372
            IT  +N
Sbjct  432  ITGSSN  437



>gb|KJB58311.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
Length=506

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQV-FKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            FRSP QQHDFNFTYQLE GN  DLPSSGQV F VP+A GDVIIAGTDGLFDNLYN++ITA
Sbjct  374  FRSPVQQHDFNFTYQLESGNNADLPSSGQVIFAVPIAPGDVIIAGTDGLFDNLYNNEITA  433

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVVHA RAG GP+VTAQKIAALAR+RAQ K+RQTPFSTAAQ+AGFRYYGGKLDDITVVVS
Sbjct  434  VVVHALRAGFGPEVTAQKIAALARERAQAKDRQTPFSTAAQDAGFRYYGGKLDDITVVVS  493

Query  392  YITSENNENSSAS  354
            Y+TS +  +S  S
Sbjct  494  YVTSSDEASSKKS  506



>ref|XP_006414328.1| hypothetical protein EUTSA_v10025106mg [Eutrema salsugineum]
 gb|ESQ55781.1| hypothetical protein EUTSA_v10025106mg [Eutrema salsugineum]
Length=470

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  341  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  400

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R G+ PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  401  VVHAVRGGIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  460

Query  389  ITSENNE  369
            + +   E
Sbjct  461  VAASKEE  467



>ref|XP_010434801.1| PREDICTED: probable protein phosphatase 2C 55 [Camelina sativa]
Length=472

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  343  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  402

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  403  VVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  462

Query  389  ITSENNE  369
            + +   E
Sbjct  463  VAASKEE  469



>ref|XP_010440128.1| PREDICTED: probable protein phosphatase 2C 55 [Camelina sativa]
Length=472

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  343  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  402

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  403  VVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  462

Query  389  ITSENNE  369
            + +   E
Sbjct  463  VAASKEE  469



>ref|XP_006283668.1| hypothetical protein CARUB_v10004725mg [Capsella rubella]
 gb|EOA16566.1| hypothetical protein CARUB_v10004725mg [Capsella rubella]
Length=475

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  346  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  405

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  406  VVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  465

Query  389  ITSENNE  369
            + +   E
Sbjct  466  VAASKEE  472



>ref|XP_002525110.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF37237.1| protein phosphatase 2c, putative [Ricinus communis]
Length=416

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G  GDLPSSGQVF  PV+ GDVIIAGTDGLFDNLYN+++TAV
Sbjct  290  FQSPVQQHGFNFTYQLESGGRGDLPSSGQVFTFPVSPGDVIIAGTDGLFDNLYNNEVTAV  349

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQVTAQKIAALARQRAQD+NRQTPFS AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  350  VVHAVRAGLGPQVTAQKIAALARQRAQDRNRQTPFSAAAQDAGFRYYGGKLDDITVVVSY  409

Query  389  IT  384
            IT
Sbjct  410  IT  411



>ref|XP_010905077.1| PREDICTED: probable protein phosphatase 2C 55 [Elaeis guineensis]
Length=486

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GNA DLPS+ QVF  PVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  361  FRSPVQQHDFNFTYQLESGNASDLPSAAQVFTFPVAAGDVIVAGTDGLFDNLYNNEITAV  420

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRAQDKNRQTPFS+AAQEAG+RYYGGKLDDITVVVSY
Sbjct  421  VVHAIRAGLEPQVTAQKIAALARQRAQDKNRQTPFSSAAQEAGYRYYGGKLDDITVVVSY  480

Query  389  ITS  381
            + +
Sbjct  481  VAA  483



>ref|NP_193391.3| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|Q9SUK9.2|P2C55_ARATH RecName: Full=Probable protein phosphatase 2C 55; Short=AtPP2C55 
[Arabidopsis thaliana]
 gb|AEE83773.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=467

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  338  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  397

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  398  VVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  457

Query  389  ITSENNE  369
            + +   E
Sbjct  458  VAASKEE  464



>ref|XP_006375084.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52881.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
Length=521

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++I AV
Sbjct  384  FRSPVQQHGFNFTYQLENGNNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEINAV  443

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQ TAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  444  VVHAMRAGLEPQATAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  503

Query  389  IT  384
            IT
Sbjct  504  IT  505



>ref|XP_011031594.1| PREDICTED: probable protein phosphatase 2C 55 [Populus euphratica]
Length=521

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSGQVF +PVA GDVI+AGTDGLFDNLYN++I AV
Sbjct  384  FRSPVQQHGFNFTYQLENGNNGDLPSSGQVFTIPVAPGDVIVAGTDGLFDNLYNNEINAV  443

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQ TAQKIAALARQRAQDK+RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  444  VVHAMRAGLEPQATAQKIAALARQRAQDKDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  503

Query  389  IT  384
            IT
Sbjct  504  IT  505



>ref|XP_008338675.1| PREDICTED: probable protein phosphatase 2C 80 [Malus domestica]
Length=434

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  308  FQSPVQQHGFNFTYQLESGSGADLPSSGQVFLIPVASGDVIIAGTDGLFDNLYNNEITAV  367

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRA DKNRQTPFSTAAQEAGFRYYGGKLDD+TVVVSY
Sbjct  368  VVHAVRAGLAPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGFRYYGGKLDDLTVVVSY  427

Query  389  IT  384
            +T
Sbjct  428  VT  429



>ref|XP_004499136.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Cicer arietinum]
 ref|XP_004499137.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Cicer arietinum]
Length=505

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLECG  GDLPSSGQVF V VA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  379  FRSPVQQHDFNFTYQLECGRNGDLPSSGQVFTVAVAPGDVIVAGTDGLFDNLYNNEITAV  438

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  RAGL PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  439  VVHGVRAGLSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  498

Query  389  IT  384
            IT
Sbjct  499  IT  500



>ref|XP_007202065.1| hypothetical protein PRUPE_ppa005911mg [Prunus persica]
 gb|EMJ03264.1| hypothetical protein PRUPE_ppa005911mg [Prunus persica]
Length=438

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G+  DLPSSGQVF +PV  GDVIIAGTDGLFDNLYN+++TAV
Sbjct  312  FQSPVQQHGFNFTYQLESGSGADLPSSGQVFFIPVVPGDVIIAGTDGLFDNLYNNEVTAV  371

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +VHA RAGL PQVTAQKIAALARQRA DKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  372  LVHAVRAGLEPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  431

Query  389  ITSENN  372
            IT  +N
Sbjct  432  ITGSSN  437



>ref|XP_006856074.1| PREDICTED: probable protein phosphatase 2C 55 [Amborella trichopoda]
 gb|ERN17541.1| hypothetical protein AMTR_s00059p00109810 [Amborella trichopoda]
Length=527

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH+FNFTYQLE GN  DLPSS Q+F +PVA GDV+IAGTDGLFDNLYNS++TAV
Sbjct  402  FRSPVQQHNFNFTYQLESGNGSDLPSSAQIFSIPVAPGDVMIAGTDGLFDNLYNSEVTAV  461

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  462  VVHAVRAGLSPQVTAQKIAALARQRAQDQHRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  521

Query  389  IT  384
            IT
Sbjct  522  IT  523



>ref|XP_010449755.1| PREDICTED: probable protein phosphatase 2C 55 [Camelina sativa]
Length=472

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF   VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  343  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTFAVAPGDVIIAGTDGLFDNLYNNEITAI  402

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  403  VVHAVRANIDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  462

Query  389  ITSENNE  369
            + +   E
Sbjct  463  VAASKEE  469



>ref|XP_009356669.1| PREDICTED: probable protein phosphatase 2C 80 [Pyrus x bretschneideri]
Length=434

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G+  DLPSSGQVF +PVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  308  FQSPVQQHGFNFTYQLESGSGADLPSSGQVFLIPVASGDVIIAGTDGLFDNLYNNEITAV  367

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG  PQVTAQKIAALARQRA DKNRQTPFSTAAQEAGFRYYGGKLDD+TVVVSY
Sbjct  368  VVHAVRAGFAPQVTAQKIAALARQRALDKNRQTPFSTAAQEAGFRYYGGKLDDLTVVVSY  427

Query  389  IT  384
            +T
Sbjct  428  VT  429



>gb|KFK26524.1| hypothetical protein AALP_AA8G260300 [Arabis alpina]
Length=473

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  344  FRSPVQQHDFNFTYQLESGCNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAV  403

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R  + PQ+TAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  404  VVHAVRGSIDPQITAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  463

Query  389  ITSENNE  369
            + +   E
Sbjct  464  VAASKEE  470



>gb|KHG28173.1| hypothetical protein F383_08076 [Gossypium arboreum]
Length=524

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN  DLPSSGQ+F VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  373  FRSPVQQHDFNFTYQLESGNNADLPSSGQIFAVPVAPGDVIIAGTDGLFDNLYNNEITAV  432

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG GP+VTAQKIAALA++RAQ ++RQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  433  VVHALRAGFGPEVTAQKIAALAQERAQARDRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  492

Query  389  ITSEN  375
            +TS +
Sbjct  493  VTSSD  497



>ref|XP_006599388.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X4 
[Glycine max]
 ref|XP_006599389.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X5 
[Glycine max]
Length=378

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDV++AGTDGLFDNLYN ++T V
Sbjct  231  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAGTDGLFDNLYNDEVTEV  290

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+ RAGL PQVTAQKIA LARQRA D+NR TPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  291  VLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGFRYYGGKLDDITVVVSY  350

Query  389  ITSENNENSS  360
            IT    ++ S
Sbjct  351  ITGSTCDDWS  360



>gb|KHN44501.1| Hypothetical protein glysoja_035733 [Glycine soja]
Length=362

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDV++AGTDGLFDNLYN ++T V
Sbjct  231  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAGTDGLFDNLYNDEVTEV  290

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+ RAGL PQVTAQKIA LARQRA D+NR TPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  291  VLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGFRYYGGKLDDITVVVSY  350

Query  389  IT  384
            IT
Sbjct  351  IT  352



>ref|XP_002868114.1| hypothetical protein ARALYDRAFT_493218 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44373.1| hypothetical protein ARALYDRAFT_493218 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G  GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  338  FRSPVQQHDFNFTYQLESGRNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  397

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA + PQVTAQKIAALARQRA DKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  398  VVHAVRANIDPQVTAQKIAALARQRALDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  457

Query  389  ITSENNE  369
            + +   E
Sbjct  458  VAASKEE  464



>emb|CDY40532.1| BnaC01g19800D [Brassica napus]
Length=469

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQ+F V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  338  FRSPVQQHDFNFTYQLESGSNGDLPSSGQMFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  397

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A RAG  PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  398  VVQAVRAGTDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  457

Query  389  ITSENNE  369
            + +   E
Sbjct  458  VAASKEE  464



>ref|XP_010556299.1| PREDICTED: probable protein phosphatase 2C 55 [Tarenaya hassleriana]
Length=514

 Score =   217 bits (553),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSGQVF V VA GD+II+GTDGLFDNLYN++ITAV
Sbjct  385  FRSPVQQHDFNFTYQLESGNNGDLPSSGQVFTVQVAPGDIIISGTDGLFDNLYNNEITAV  444

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R GLGP+VTAQKIAALARQRA+D++RQTPFS AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  445  VVQAVRGGLGPKVTAQKIAALARQRAEDRDRQTPFSKAAQDAGFRYYGGKLDDITVVVSY  504

Query  389  ITSENNENSS  360
            +T  + E  S
Sbjct  505  VTGSDKETRS  514



>ref|XP_009145699.1| PREDICTED: probable protein phosphatase 2C 55 [Brassica rapa]
Length=467

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  336  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  395

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A RAG  PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  396  VVQAVRAGTDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  455

Query  389  ITS  381
            + +
Sbjct  456  VAA  458



>ref|XP_008786118.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Phoenix 
dactylifera]
Length=498

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN  DLPSS QVF  PVA GDVIIAGTDGLFDNLYN+++TAV
Sbjct  373  FRSPVQQHDFNFTYQLESGNGSDLPSSAQVFTFPVAPGDVIIAGTDGLFDNLYNNEVTAV  432

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA LGPQVTAQKIAALARQRAQD+NRQTPFS+AAQ+AG+R+YGGKLDDITVVVSY
Sbjct  433  VVHAVRARLGPQVTAQKIAALARQRAQDRNRQTPFSSAAQDAGYRFYGGKLDDITVVVSY  492

Query  389  ITSENN  372
            I++ ++
Sbjct  493  ISASSS  498



>emb|CDY60192.1| BnaA01g35420D [Brassica napus]
Length=467

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF V VA GDVIIAGTDGLFDNLYN++ITA+
Sbjct  336  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVAVAPGDVIIAGTDGLFDNLYNNEITAI  395

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A RAG  PQVTAQKIAALARQRAQDKNRQTPFSTAAQ+AGFRYYGGKLDDITVVVSY
Sbjct  396  VVQAVRAGTDPQVTAQKIAALARQRAQDKNRQTPFSTAAQDAGFRYYGGKLDDITVVVSY  455

Query  389  ITS  381
            + +
Sbjct  456  VAA  458



>ref|XP_003547993.2| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
Length=360

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDV++AGTDGLFDNLYN ++T V
Sbjct  231  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAGTDGLFDNLYNDEVTEV  290

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+ RAGL PQVTAQKIA LARQRA D+NR TPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  291  VLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGFRYYGGKLDDITVVVSY  350

Query  389  IT  384
            IT
Sbjct  351  IT  352



>ref|XP_006599390.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X6 
[Glycine max]
Length=373

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDV++AGTDGLFDNLYN ++T V
Sbjct  231  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAGTDGLFDNLYNDEVTEV  290

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+ RAGL PQVTAQKIA LARQRA D+NR TPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  291  VLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGFRYYGGKLDDITVVVSY  350

Query  389  IT  384
            IT
Sbjct  351  IT  352



>ref|XP_008377406.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=506

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH+FNF+YQL  GN GDLPSSGQVF VPVA  DVIIAGTDGLFDNLYN++ITAV
Sbjct  380  FRSPVQQHNFNFSYQLGTGNNGDLPSSGQVFTVPVAPRDVIIAGTDGLFDNLYNNEITAV  439

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG GPQVTAQKIAALARQRAQD+NRQTPFSTAAQ+AG  +YGGKLDDITVVVSY
Sbjct  440  VVHAMRAGXGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGVLHYGGKLDDITVVVSY  499

Query  389  ITSENN  372
            +TS N+
Sbjct  500  VTSSND  505



>ref|XP_010923448.1| PREDICTED: probable protein phosphatase 2C 55 [Elaeis guineensis]
Length=497

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN  DLPS+ QVF  PVA GDVIIAGTDGLFDNLY++++TAV
Sbjct  372  FRSPVQQHDFNFTYQLESGNGSDLPSAAQVFNFPVAPGDVIIAGTDGLFDNLYSNEVTAV  431

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RA LGPQVTAQKIAALARQRAQDKNRQTPFS AAQ+AG+RYYGGKLDDITVVVSY
Sbjct  432  VVHAVRARLGPQVTAQKIAALARQRAQDKNRQTPFSAAAQDAGYRYYGGKLDDITVVVSY  491

Query  389  ITSENN  372
            I++ ++
Sbjct  492  ISASSS  497



>ref|XP_009407379.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=472

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSP QQHDFNFTYQLE GN  DLPS+ QVF   VA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  347  IRSPVQQHDFNFTYQLESGNGSDLPSAAQVFTFLVASGDVIIAGTDGLFDNLYNNEITAV  406

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHATRAGLGPQVTAQKIAALARQRA DKNRQTPFSTAAQ+AG+RYYGGKLDDITVVVS+
Sbjct  407  VVHATRAGLGPQVTAQKIAALARQRALDKNRQTPFSTAAQDAGYRYYGGKLDDITVVVSH  466

Query  389  ITSEN  375
            +T+ +
Sbjct  467  VTASD  471



>ref|XP_006599391.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X7 
[Glycine max]
 ref|XP_006599392.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X8 
[Glycine max]
Length=364

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDV++AGTDGLFDNLYN ++T V
Sbjct  231  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAGTDGLFDNLYNDEVTEV  290

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+ RAGL PQVTAQKIA LARQRA D+NR TPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  291  VLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGFRYYGGKLDDITVVVSY  350

Query  389  IT  384
            IT
Sbjct  351  IT  352



>ref|XP_006599386.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=396

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDV++AGTDGLFDNLYN ++T V
Sbjct  231  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAGTDGLFDNLYNDEVTEV  290

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+ RAGL PQVTAQKIA LARQRA D+NR TPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  291  VLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGFRYYGGKLDDITVVVSY  350

Query  389  IT  384
            IT
Sbjct  351  IT  352



>ref|XP_007156917.1| hypothetical protein PHAVU_002G028000g [Phaseolus vulgaris]
 gb|ESW28911.1| hypothetical protein PHAVU_002G028000g [Phaseolus vulgaris]
Length=446

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQHDFNFTYQLE GN  DLPSSG+VF +PV  GDV+IAGTDGLFDNLYNS+ITAV
Sbjct  320  FQSPVQQHDFNFTYQLESGNGADLPSSGEVFTIPVTSGDVVIAGTDGLFDNLYNSEITAV  379

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGL PQVTAQKIAALARQRA D++R TPFSTAAQEAG RYYGGKLDDITVVVSY
Sbjct  380  VVHAIRAGLEPQVTAQKIAALARQRALDQSRPTPFSTAAQEAGLRYYGGKLDDITVVVSY  439

Query  389  ITSENNE  369
            I+   +E
Sbjct  440  ISGSLSE  446



>ref|XP_006599387.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X3 
[Glycine max]
Length=383

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDV++AGTDGLFDNLYN ++T V
Sbjct  231  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVAGTDGLFDNLYNDEVTEV  290

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+ RAGL PQVTAQKIA LARQRA D+NR TPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  291  VLHSVRAGLEPQVTAQKIAVLARQRALDRNRPTPFSTAAQEAGFRYYGGKLDDITVVVSY  350

Query  389  IT  384
            IT
Sbjct  351  IT  352



>ref|XP_004300615.1| PREDICTED: probable protein phosphatase 2C 80 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE G+  DLPSSG+VF +PVA GDVIIAGTDGLFDNLYN+++TA+
Sbjct  313  FRSPVQQHGFNFTYQLESGSGADLPSSGEVFLIPVAAGDVIIAGTDGLFDNLYNTEVTAI  372

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GL PQ TA+KIAALAR RA DKNRQTPFSTAAQ+AGFRYYGGKLDD+TVVVSY
Sbjct  373  VVHAVRTGLEPQATAKKIAALARTRALDKNRQTPFSTAAQDAGFRYYGGKLDDVTVVVSY  432

Query  389  ITS  381
            ITS
Sbjct  433  ITS  435



>ref|XP_007223264.1| hypothetical protein PRUPE_ppa004472mg [Prunus persica]
 gb|EMJ24463.1| hypothetical protein PRUPE_ppa004472mg [Prunus persica]
Length=508

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  382  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVPVAPGDVIIAGTDGLFDNLYNNEITAV  441

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDI  408
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDI
Sbjct  442  VVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDI  495



>ref|XP_008220774.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
 ref|XP_008220775.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
Length=508

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+ GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN++ITAV
Sbjct  382  FRSPVQQHDFNFTYQLESGSNGDLPSSGQVFTVPVAPGDVIIAGTDGLFDNLYNNEITAV  441

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDI  408
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDI
Sbjct  442  VVHAIRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDI  495



>gb|KDP31794.1| hypothetical protein JCGZ_12255 [Jatropha curcas]
Length=375

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN GD PSS QVF  PV+ GDVI+AGTDGLFDNLYN+++TA 
Sbjct  249  FQSPVQQHGFNFTYQLESGNHGDQPSSSQVFIFPVSPGDVIVAGTDGLFDNLYNNEVTAA  308

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQ TAQKIA LARQRA D+NRQTPFS AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  309  VVHAARAGLGPQATAQKIADLARQRALDRNRQTPFSAAAQDAGFRYYGGKLDDITVVVSY  368

Query  389  ITSENN  372
            + S NN
Sbjct  369  VMSSNN  374



>ref|XP_010936931.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Elaeis 
guineensis]
Length=497

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G+  DLPS  QVF  PV+ GDVIIAGTDGLFDNLYN+++TAV
Sbjct  372  FRSPVQQHDFNFTYQLESGSGSDLPSVAQVFTFPVSPGDVIIAGTDGLFDNLYNTEVTAV  431

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R GLGPQVTAQKIAALARQRAQDKNRQTPFS AAQ+AG+RYYGGKLDDITVVVSY
Sbjct  432  VVQAVRTGLGPQVTAQKIAALARQRAQDKNRQTPFSIAAQDAGYRYYGGKLDDITVVVSY  491

Query  389  IT  384
            IT
Sbjct  492  IT  493



>gb|KEH40106.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=508

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQHDFNFTYQLEC +  DLPSSGQVF V VA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  382  FQSPVQQHDFNFTYQLECSSHSDLPSSGQVFTVAVAPGDVIVAGTDGLFDNLYNNEITAV  441

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  RAG  PQVTAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSY
Sbjct  442  VVHGVRAGFSPQVTAQKIAALARQRALDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSY  501

Query  389  IT  384
            IT
Sbjct  502  IT  503



>ref|XP_006341911.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Solanum tuberosum]
 ref|XP_006341912.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Solanum tuberosum]
Length=393

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECG-NAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
             +SP QQHDFNFTYQLE G   GD P+SG+VFK+PVA GDVIIAGTDGLFDNLY SDITA
Sbjct  262  LKSPVQQHDFNFTYQLESGGTGGDSPTSGEVFKIPVAPGDVIIAGTDGLFDNLYTSDITA  321

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVVHA RA L PQV AQKIAALAR+RA DKNRQ+PFSTAAQ+AG R+YGGKLDD+TVVVS
Sbjct  322  VVVHARRAHLPPQVVAQKIAALARERALDKNRQSPFSTAAQDAGIRFYGGKLDDVTVVVS  381

Query  392  YITSENNEN  366
            YITS+ NE 
Sbjct  382  YITSDKNEK  390



>ref|XP_012079067.1| PREDICTED: probable protein phosphatase 2C 80 [Jatropha curcas]
 ref|XP_012079068.1| PREDICTED: probable protein phosphatase 2C 80 [Jatropha curcas]
Length=417

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN GD PSS QVF  PV+ GDVI+AGTDGLFDNLYN+++TA 
Sbjct  291  FQSPVQQHGFNFTYQLESGNHGDQPSSSQVFIFPVSPGDVIVAGTDGLFDNLYNNEVTAA  350

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAGLGPQ TAQKIA LARQRA D+NRQTPFS AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  351  VVHAARAGLGPQATAQKIADLARQRALDRNRQTPFSAAAQDAGFRYYGGKLDDITVVVSY  410

Query  389  ITSENN  372
            + S NN
Sbjct  411  VMSSNN  416



>gb|ACU19890.1| unknown [Glycine max]
Length=247

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SPSQQHDFNF YQLE GN  DLPSSG+VF +PVA GDV+I+GTDGLFDNLYNS+IT V
Sbjct  121  FESPSQQHDFNFPYQLESGNGADLPSSGEVFTIPVASGDVVISGTDGLFDNLYNSEITGV  180

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V HA RAGL PQVTAQKIAALARQRA  K+ +TPFSTAA++AGF YYGGKLDDITVVVSY
Sbjct  181  VEHAIRAGLEPQVTAQKIAALARQRALSKSSRTPFSTAAEKAGFCYYGGKLDDITVVVSY  240

Query  389  ITSENNE  369
            I+   +E
Sbjct  241  ISGSVSE  247



>ref|XP_006574705.1| PREDICTED: probable protein phosphatase 2C 55-like [Glycine max]
Length=364

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSG+VF +PVA GDV++ GTDGLFDNLYN ++  +
Sbjct  233  FRSPVQQHDFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVVGTDGLFDNLYNEEVAEI  292

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+ A RAGL P VTAQ+IA LARQRA D+NRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  293  VLDAVRAGLEPLVTAQRIAVLARQRALDRNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  352

Query  389  IT  384
            IT
Sbjct  353  IT  354



>ref|XP_004238238.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010320377.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010320378.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=393

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECG-NAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
             +SP QQHDFNFTYQLE G   GD P+SG+VFK+PVA GDVIIAGTDGLFDNLY SDITA
Sbjct  262  LKSPVQQHDFNFTYQLESGGTGGDSPTSGEVFKIPVAPGDVIIAGTDGLFDNLYTSDITA  321

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVVHA RA L PQV AQKIAALAR+RA DKNRQ+PFS AAQ+AG R+YGGKLDD+TVVVS
Sbjct  322  VVVHARRAHLPPQVVAQKIAALARERALDKNRQSPFSAAAQDAGIRFYGGKLDDVTVVVS  381

Query  392  YITSENNEN  366
            YITS+ NE 
Sbjct  382  YITSDKNEK  390



>ref|XP_008453722.1| PREDICTED: probable protein phosphatase 2C 80 [Cucumis melo]
 ref|XP_008453723.1| PREDICTED: probable protein phosphatase 2C 80 [Cucumis melo]
Length=452

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG+VF +PVA GDVI+AGTDGLFDNLY+++I+AV
Sbjct  326  FRSPVQQHGFNFTYQLESGNGGDLPSSGEVFMIPVALGDVIVAGTDGLFDNLYSNEISAV  385

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV+A R+GL P+ TAQ IAALARQRA D+NRQTPFS AAQEAG+RYYGGKLDDITVVVSY
Sbjct  386  VVNAVRSGLEPEATAQNIAALARQRALDRNRQTPFSAAAQEAGYRYYGGKLDDITVVVSY  445

Query  389  ITS  381
            IT+
Sbjct  446  ITN  448



>gb|KHN00560.1| Hypothetical protein glysoja_000228 [Glycine soja]
Length=430

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE GN GDLPSSG+VF +PVA GDV++ GTDGLFDNLYN ++  +
Sbjct  233  FRSPVQQHDFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVVVVGTDGLFDNLYNDEVAEI  292

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+ A RAGL P VTAQ+IA LARQRA D+NRQTPFSTAAQEAGFRYYGGKLDDITVVVSY
Sbjct  293  VLDAVRAGLEPLVTAQRIAVLARQRALDRNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  352

Query  389  IT  384
            IT
Sbjct  353  IT  354



>ref|XP_004149170.1| PREDICTED: probable protein phosphatase 2C 80 [Cucumis sativus]
 ref|XP_011653142.1| PREDICTED: probable protein phosphatase 2C 80 [Cucumis sativus]
 ref|XP_011653143.1| PREDICTED: probable protein phosphatase 2C 80 [Cucumis sativus]
 gb|KGN53266.1| hypothetical protein Csa_4G038830 [Cucumis sativus]
Length=450

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSG++F +PVA GDVI+AGTDGLFDNLY+++I+AV
Sbjct  324  FRSPVQQHGFNFTYQLESGNGGDLPSSGEIFMIPVALGDVIVAGTDGLFDNLYSNEISAV  383

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV+A R+GL P+ TAQ IAALARQRA D+NRQTPFS AAQEAG+RYYGGKLDDITVVVSY
Sbjct  384  VVNAVRSGLEPEATAQNIAALARQRALDRNRQTPFSAAAQEAGYRYYGGKLDDITVVVSY  443

Query  389  IT  384
            IT
Sbjct  444  IT  445



>ref|XP_004291892.1| PREDICTED: probable protein phosphatase 2C 55 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459565.1| PREDICTED: probable protein phosphatase 2C 55 [Fragaria vesca 
subsp. vesca]
Length=497

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQHDFNFTYQLE G   DLPSSGQVF VPVA GDVI+AGTDGLFDNLYN++ITAV
Sbjct  371  FRSPVQQHDFNFTYQLENGVNSDLPSSGQVFTVPVAPGDVIVAGTDGLFDNLYNNEITAV  430

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDI  408
            VVHA RAGLGPQVTAQKIAALARQRAQD++RQTPFSTAAQ+AGFRYYGGKLDDI
Sbjct  431  VVHAMRAGLGPQVTAQKIAALARQRAQDRDRQTPFSTAAQDAGFRYYGGKLDDI  484



>ref|XP_012066208.1| PREDICTED: probable protein phosphatase 2C 55 [Jatropha curcas]
 gb|KDP42844.1| hypothetical protein JCGZ_23786 [Jatropha curcas]
Length=375

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+QQH FNF YQLE GN G LPSSGQVF+ PV+ GDVI+AGTDGLFDNLYN+++T  
Sbjct  249  FQSPAQQHCFNFPYQLESGNEGRLPSSGQVFRFPVSPGDVIVAGTDGLFDNLYNNEVTTA  308

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A RAGL PQ+TAQKIAAL  QRA D+NRQTPFSTAAQ AGF YYGGKLDDITVVVSY
Sbjct  309  VVDALRAGLRPQITAQKIAALTSQRALDENRQTPFSTAAQRAGFSYYGGKLDDITVVVSY  368

Query  389  ITSENN  372
            +TS NN
Sbjct  369  VTSSNN  374



>ref|XP_003538844.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Glycine 
max]
 ref|XP_006590679.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Glycine 
max]
 ref|XP_006590680.1| PREDICTED: probable protein phosphatase 2C 55 isoform X3 [Glycine 
max]
 gb|KHN42000.1| Hypothetical protein glysoja_003740 [Glycine soja]
Length=423

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SPSQQHDFNF YQLE GN  DLPSSG+VF +PVA GDV+I+GTDGLFDNLYNS+IT V
Sbjct  297  FESPSQQHDFNFPYQLESGNGADLPSSGEVFTIPVASGDVVISGTDGLFDNLYNSEITGV  356

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V HA RAGL PQVTAQKIAALARQRA  K+ +TPFSTAA++AGF YYGGKLDDITVVVSY
Sbjct  357  VEHAIRAGLEPQVTAQKIAALARQRALSKSSRTPFSTAAEKAGFCYYGGKLDDITVVVSY  416

Query  389  ITSENNE  369
            I+   +E
Sbjct  417  ISGSVSE  423



>gb|KJB43552.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=274

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE G+ GDLPSS QVFK+PV  GDVIIAGTDGLFDNLYN++ITA 
Sbjct  148  FHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGTDGLFDNLYNNEITAA  207

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  R G  PQ+ A++IA LAR+RA DKNRQTPF+ AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  208  VVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFRYYGGKLDDITVVVSY  267

Query  389  ITSENN  372
            I   +N
Sbjct  268  IAGSSN  273



>ref|XP_007156027.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
 gb|ESW28021.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
Length=365

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQHDFNFTYQLE G+  DLPSSG+VF + VA GDV++AGTDGLFDNLYN ++  V
Sbjct  234  FKSPVQQHDFNFTYQLESGDGCDLPSSGEVFTISVAPGDVVVAGTDGLFDNLYNDEVAEV  293

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V++A RAGL PQVTAQKIAALARQRA D+NRQ+PFS AAQEAGF YYGGKLDDITVVVSY
Sbjct  294  VLNAVRAGLEPQVTAQKIAALARQRALDRNRQSPFSAAAQEAGFNYYGGKLDDITVVVSY  353

Query  389  IT  384
            IT
Sbjct  354  IT  355



>ref|XP_010099838.1| putative protein phosphatase 2C 80 [Morus notabilis]
 gb|EXB80598.1| putative protein phosphatase 2C 80 [Morus notabilis]
Length=426

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+QQ  FNFTYQLE G+  DLPS+GQVF +PV+ GDVI+AGTDGLFDNLYN+++TAV
Sbjct  300  FQSPAQQRGFNFTYQLESGSGADLPSAGQVFTIPVSPGDVIVAGTDGLFDNLYNNEVTAV  359

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+HA RAGL PQ TAQKIAALARQRA D+ RQTPF+TAAQEAG+RYYGGKLDDITVVVSY
Sbjct  360  VLHAVRAGLEPQATAQKIAALARQRALDRTRQTPFATAAQEAGYRYYGGKLDDITVVVSY  419

Query  389  ITSENN  372
            + +  N
Sbjct  420  VANSTN  425



>ref|XP_003564015.1| PREDICTED: probable protein phosphatase 2C 55 [Brachypodium distachyon]
Length=474

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSPSQQHDFNFTYQLE G   DLPSS +VF+ PVA GDVIIAGTDGLFDNLY ++IT +
Sbjct  348  LRSPSQQHDFNFTYQLESGGGSDLPSSAEVFRYPVATGDVIIAGTDGLFDNLYTNEITTI  407

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A RAGLG Q TAQKIAALAR+RA DKNRQ+PF+ AAQEAG+R+YGGKLDDITVVVSY
Sbjct  408  VVEAARAGLGAQATAQKIAALARERALDKNRQSPFAAAAQEAGYRFYGGKLDDITVVVSY  467

Query  389  ITS  381
            +TS
Sbjct  468  VTS  470



>gb|KJB43550.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=271

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE G+ GDLPSS QVFK+PV  GDVIIAGTDGLFDNLYN++ITA 
Sbjct  145  FHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGTDGLFDNLYNNEITAA  204

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  R G  PQ+ A++IA LAR+RA DKNRQTPF+ AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  205  VVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFRYYGGKLDDITVVVSY  264

Query  389  ITSENN  372
            I   +N
Sbjct  265  IAGSSN  270



>ref|XP_002463676.1| hypothetical protein SORBIDRAFT_01g004030 [Sorghum bicolor]
 gb|EER90674.1| hypothetical protein SORBIDRAFT_01g004030 [Sorghum bicolor]
Length=466

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSPSQQHDFNFTYQLE G   DLPSS QVF  PVA GDVI+AGTDGLFDNLYN++I+ V
Sbjct  343  LRSPSQQHDFNFTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAGTDGLFDNLYNNEISGV  402

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +V A R GL PQ+ AQKIAALARQRA DKNRQ+PF++AAQEAG+RYYGGKLDDITVVVSY
Sbjct  403  IVEALRVGLEPQIAAQKIAALARQRATDKNRQSPFASAAQEAGYRYYGGKLDDITVVVSY  462

Query  389  ITS  381
            + S
Sbjct  463  VKS  465



>ref|XP_007156026.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
 gb|ESW28020.1| hypothetical protein PHAVU_003G252300g [Phaseolus vulgaris]
Length=359

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQHDFNFTYQLE G+  DLPSSG+VF + VA GDV++AGTDGLFDNLYN ++  V
Sbjct  234  FKSPVQQHDFNFTYQLESGDGCDLPSSGEVFTISVAPGDVVVAGTDGLFDNLYNDEVAEV  293

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V++A RAGL PQVTAQKIAALARQRA D+NRQ+PFS AAQEAGF YYGGKLDDITVVVSY
Sbjct  294  VLNAVRAGLEPQVTAQKIAALARQRALDRNRQSPFSAAAQEAGFNYYGGKLDDITVVVSY  353

Query  389  IT  384
            IT
Sbjct  354  IT  355



>gb|KDP42845.1| hypothetical protein JCGZ_23787 [Jatropha curcas]
Length=462

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+QQH FNF YQLE GN GDLPSSGQVF  PV+ GDVI+AGTDGLFDNLYN+++T  
Sbjct  336  FQSPAQQHCFNFPYQLESGNEGDLPSSGQVFIFPVSPGDVIVAGTDGLFDNLYNNEVTTA  395

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A RAGLGPQVTAQKIAA+  QRA D+NRQTPFSTAAQ AGF Y+GGKLDDITVVVSY
Sbjct  396  VVDALRAGLGPQVTAQKIAAMTSQRALDENRQTPFSTAAQLAGFSYHGGKLDDITVVVSY  455

Query  389  ITSEN  375
            +TS N
Sbjct  456  VTSSN  460



>ref|NP_001130546.1| uncharacterized protein LOC100191645 [Zea mays]
 ref|XP_008669529.1| PREDICTED: uncharacterized protein LOC100191645 isoform X1 [Zea 
mays]
 gb|ACF78805.1| unknown [Zea mays]
 gb|ACN25431.1| unknown [Zea mays]
 gb|ACN27581.1| unknown [Zea mays]
 gb|ACN34217.1| unknown [Zea mays]
 tpg|DAA52105.1| TPA: hypothetical protein ZEAMMB73_937237 [Zea mays]
 tpg|DAA52106.1| TPA: hypothetical protein ZEAMMB73_937237 [Zea mays]
 tpg|DAA52107.1| TPA: hypothetical protein ZEAMMB73_937237 [Zea mays]
Length=466

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSPSQQHDFNFTYQLE G   DLPSS QVF  PVA GDVI+AGTDGLFDNLYN++I+ V
Sbjct  340  LRSPSQQHDFNFTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAGTDGLFDNLYNNEISGV  399

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +V A R GL PQ+ AQKIAALARQRA DKNRQ+PF++AAQEAG+RYYGGKLDDITVVVSY
Sbjct  400  IVEALRVGLEPQIAAQKIAALARQRATDKNRQSPFASAAQEAGYRYYGGKLDDITVVVSY  459

Query  389  ITS  381
            + S
Sbjct  460  VKS  462



>gb|EMT01244.1| Putative protein phosphatase 2C 55 [Aegilops tauschii]
Length=281

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             +SPSQQHDFNFTYQLE G   DLPSS  VF   VA GDVIIAGTDGLFDNLY+++ITAV
Sbjct  155  LKSPSQQHDFNFTYQLESGGGSDLPSSADVFHYSVAPGDVIIAGTDGLFDNLYDNEITAV  214

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R+GLG Q TAQKIAALAR+RA+DK+RQ+PF+ AAQEAG+RYYGGKLDDITVVVSY
Sbjct  215  VVEALRSGLGAQGTAQKIAALARERAEDKHRQSPFAAAAQEAGYRYYGGKLDDITVVVSY  274

Query  389  ITS  381
            +TS
Sbjct  275  VTS  277



>ref|XP_002310798.2| hypothetical protein POPTR_0007s12510g [Populus trichocarpa]
 gb|EEE91248.2| hypothetical protein POPTR_0007s12510g [Populus trichocarpa]
Length=417

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVF +PVA GDVIIAGTDGLFDNLYN+++TAV
Sbjct  291  FESPVQQHGFNFTYQLETGNGGDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEVTAV  350

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDD  411
            VVHA R GLGP+ TAQKIAALARQRA D NRQTPFSTAAQ+AG+RYYGGKLDD
Sbjct  351  VVHAIRTGLGPEATAQKIAALARQRALDTNRQTPFSTAAQDAGYRYYGGKLDD  403



>ref|XP_008644409.1| PREDICTED: probable protein phosphatase 2C 80 [Zea mays]
 gb|AFW67259.1| hypothetical protein ZEAMMB73_004391 [Zea mays]
Length=468

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSPSQQHDFN TYQLE G   DLPSS QVF  PVA GDVI+AGTDGLFDNLYN++I+ V
Sbjct  345  LRSPSQQHDFNLTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAGTDGLFDNLYNNEISGV  404

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +V A R GL PQV AQKIAALARQRA DKNRQ+PF++AAQEAG+RYYGGKLDDITVVVSY
Sbjct  405  IVEALRVGLEPQVAAQKIAALARQRATDKNRQSPFASAAQEAGYRYYGGKLDDITVVVSY  464

Query  389  ITS  381
            + S
Sbjct  465  VKS  467



>gb|KJB43548.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
 gb|KJB43551.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
 gb|KJB43553.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
 gb|KJB43555.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=377

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE G+ GDLPSS QVFK+PV  GDVIIAGTDGLFDNLYN++ITA 
Sbjct  251  FHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGTDGLFDNLYNNEITAA  310

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  R G  PQ+ A++IA LAR+RA DKNRQTPF+ AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  311  VVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFRYYGGKLDDITVVVSY  370

Query  389  ITSENN  372
            I   +N
Sbjct  371  IAGSSN  376



>ref|XP_010558162.1| PREDICTED: probable protein phosphatase 2C 80 isoform X2 [Tarenaya 
hassleriana]
Length=426

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G+ GD+PSSGQVF +PV  GDVI+AGTDGLFDNLYN++I  V
Sbjct  304  FQSPVQQHGFNFTYQLESGDGGDIPSSGQVFTIPVESGDVIVAGTDGLFDNLYNNEIAGV  363

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TA+K+AALARQRA D+NRQTPFS +AQEAG+RYYGGKLDDITVV+SY
Sbjct  364  VVSSVRAGLDPKSTAEKMAALARQRAVDRNRQTPFSASAQEAGYRYYGGKLDDITVVISY  423

Query  389  ITS  381
            IT+
Sbjct  424  ITA  426



>ref|XP_007046996.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOX91153.1| Phosphatase 2C family protein [Theobroma cacao]
Length=452

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVF++PV  GDVI+AGTDGLFDNLYN+++TA 
Sbjct  326  FHSPVQQHGFNFTYQLESGNDGDLPSSGQVFRIPVLPGDVIVAGTDGLFDNLYNNEVTAA  385

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R+G  P+VTA++IAALAR+RA DK++QTPF+ AA +AGFRYYGGKLDDITVVVSY
Sbjct  386  VVHALRSGFSPEVTAKQIAALARERAVDKHQQTPFAKAALDAGFRYYGGKLDDITVVVSY  445

Query  389  ITSENN  372
            +TS  +
Sbjct  446  VTSSTH  451



>ref|XP_010558153.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Tarenaya 
hassleriana]
Length=441

 Score =   199 bits (507),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE G+ GD+PSSGQVF +PV  GDVI+AGTDGLFDNLYN++I  V
Sbjct  319  FQSPVQQHGFNFTYQLESGDGGDIPSSGQVFTIPVESGDVIVAGTDGLFDNLYNNEIAGV  378

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TA+K+AALARQRA D+NRQTPFS +AQEAG+RYYGGKLDDITVV+SY
Sbjct  379  VVSSVRAGLDPKSTAEKMAALARQRAVDRNRQTPFSASAQEAGYRYYGGKLDDITVVISY  438

Query  389  ITS  381
            IT+
Sbjct  439  ITA  441



>ref|XP_006383232.1| hypothetical protein POPTR_0005s12720g [Populus trichocarpa]
 gb|ERP61029.1| hypothetical protein POPTR_0005s12720g [Populus trichocarpa]
Length=423

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE GN GDLPSSGQVF VPVA GDVIIAGTDGLFDNLYN+++ AV
Sbjct  297  FRSPVQQHGFNFTYQLESGNGGDLPSSGQVFTVPVAPGDVIIAGTDGLFDNLYNNEVAAV  356

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GLGP+  AQKIAALARQRA D+N+QTPFSTAAQ+AG+RYYGGKLDDITVVVSY
Sbjct  357  VVHAIRTGLGPEAAAQKIAALARQRAVDRNQQTPFSTAAQDAGYRYYGGKLDDITVVVSY  416

Query  389  ITSENN  372
            IT+  N
Sbjct  417  ITNSAN  422



>ref|XP_010999959.1| PREDICTED: probable protein phosphatase 2C 80 isoform X2 [Populus 
euphratica]
Length=417

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVF +PVA GDVIIAGTDGLFDNLYN+++TAV
Sbjct  291  FESPVQQHGFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEVTAV  350

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GLGP   AQKIAALARQRA D+NRQTPFSTAAQ+AG+RYYGGKLDDITVVVSY
Sbjct  351  VVHAIRTGLGPGAAAQKIAALARQRAVDRNRQTPFSTAAQDAGYRYYGGKLDDITVVVSY  410

Query  389  ITSENN  372
            IT+  N
Sbjct  411  ITNSAN  416



>gb|EMS60700.1| putative protein phosphatase 2C 55 [Triticum urartu]
Length=356

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             +SPSQQHDFNFTYQLE G   DLPSS  VF   VA GDVIIAGTDGLFDNLY+++ITAV
Sbjct  230  LKSPSQQHDFNFTYQLESGGGSDLPSSADVFHYSVASGDVIIAGTDGLFDNLYDNEITAV  289

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R+GLG Q TAQKIAALAR+RA+DK+RQ+PF+ AAQEAG+RYYGGKLDDITVVVSY
Sbjct  290  VVEALRSGLGAQGTAQKIAALARERAEDKHRQSPFAAAAQEAGYRYYGGKLDDITVVVSY  349

Query  389  ITS  381
            + S
Sbjct  350  VMS  352



>gb|KJB43549.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=435

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE G+ GDLPSS QVFK+PV  GDVIIAGTDGLFDNLYN++ITA 
Sbjct  309  FHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGTDGLFDNLYNNEITAA  368

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  R G  PQ+ A++IA LAR+RA DKNRQTPF+ AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  369  VVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFRYYGGKLDDITVVVSY  428

Query  389  ITSENN  372
            I   +N
Sbjct  429  IAGSSN  434



>ref|XP_010999955.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Populus 
euphratica]
 ref|XP_010999956.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Populus 
euphratica]
 ref|XP_010999958.1| PREDICTED: probable protein phosphatase 2C 80 isoform X1 [Populus 
euphratica]
Length=423

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVF +PVA GDVIIAGTDGLFDNLYN+++TAV
Sbjct  297  FESPVQQHGFNFTYQLESGNGGDLPSSGQVFTIPVAPGDVIIAGTDGLFDNLYNNEVTAV  356

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R GLGP   AQKIAALARQRA D+NRQTPFSTAAQ+AG+RYYGGKLDDITVVVSY
Sbjct  357  VVHAIRTGLGPGAAAQKIAALARQRAVDRNRQTPFSTAAQDAGYRYYGGKLDDITVVVSY  416

Query  389  ITSENN  372
            IT+  N
Sbjct  417  ITNSAN  422



>gb|KJB43554.1| hypothetical protein B456_007G205500 [Gossypium raimondii]
Length=452

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE G+ GDLPSS QVFK+PV  GDVIIAGTDGLFDNLYN++ITA 
Sbjct  326  FHSPVQQHGFNFTYQLESGDGGDLPSSVQVFKIPVLSGDVIIAGTDGLFDNLYNNEITAA  385

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH  R G  PQ+ A++IA LAR+RA DKNRQTPF+ AAQ+AGFRYYGGKLDDITVVVSY
Sbjct  386  VVHGLRVGFNPQLMAKQIATLARERAVDKNRQTPFAKAAQDAGFRYYGGKLDDITVVVSY  445

Query  389  ITSENN  372
            I   +N
Sbjct  446  IAGSSN  451



>gb|KJB17810.1| hypothetical protein B456_003G016400 [Gossypium raimondii]
 gb|KJB17811.1| hypothetical protein B456_003G016400 [Gossypium raimondii]
 gb|KJB17812.1| hypothetical protein B456_003G016400 [Gossypium raimondii]
Length=375

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVF++P+  GDVI+AGTDGLFDNLYN+++ AV
Sbjct  249  FHSPVQQHGFNFTYQLESGNNGDLPSSGQVFRIPILPGDVIVAGTDGLFDNLYNNEVAAV  308

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG  P+ TA++I ALAR+RA DKN+QTPF+ AAQ+AG+RY GGKLDDITVVVS+
Sbjct  309  VVHALRAGFSPESTAKEIVALARERAVDKNKQTPFAKAAQDAGYRYNGGKLDDITVVVSF  368

Query  389  ITS  381
            ITS
Sbjct  369  ITS  371



>ref|XP_010465009.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
 ref|XP_010465014.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
Length=412

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN+ D+PSSGQVF + V  GDVI+AGTDG++DNLYN +IT V
Sbjct  289  FQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVAGTDGMYDNLYNEEITGV  348

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TAQKIA LARQRA DK RQ+PF+TAAQEAG+RYYGGKLDDITVVVSY
Sbjct  349  VVSSVRAGLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAGYRYYGGKLDDITVVVSY  408

Query  389  ITS  381
            ITS
Sbjct  409  ITS  411



>ref|XP_010484599.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
Length=419

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN+ D+PSSGQVF + V  GDVI+AGTDG++DNLYN +IT V
Sbjct  296  FQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVAGTDGMYDNLYNEEITGV  355

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TAQKIA LARQRA DK RQ+PF+TAAQEAG+RYYGGKLDDITVVVSY
Sbjct  356  VVSSVRAGLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAGYRYYGGKLDDITVVVSY  415

Query  389  ITS  381
            ITS
Sbjct  416  ITS  418



>ref|XP_004981332.1| PREDICTED: uncharacterized protein LOC101762678 [Setaria italica]
Length=716

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSPSQQHDFNFTYQLE G   DLPSS QVF  PVA GDVI+AGTDGLFDNLYN++I+ V
Sbjct  342  LRSPSQQHDFNFTYQLESGGGSDLPSSAQVFHFPVAPGDVIVAGTDGLFDNLYNNEISGV  401

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +V A R GL PQ+ AQKIAALARQRA DKNRQ+PF++AAQEAG+RYYGGKLDDITVVVS+
Sbjct  402  IVEALRVGLEPQIAAQKIAALARQRATDKNRQSPFASAAQEAGYRYYGGKLDDITVVVSH  461

Query  389  ITS  381
            + S
Sbjct  462  LVS  464



>gb|KHG03504.1| hypothetical protein F383_27679 [Gossypium arboreum]
Length=375

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVF++P+  GDVI+AGTDGLFDNLYN+++ AV
Sbjct  249  FHSPVQQHGFNFTYQLESGNNGDLPSSGQVFRIPILPGDVIVAGTDGLFDNLYNNEVAAV  308

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA RAG  P+ TA++I ALAR+RA DKN+QTPF+ AAQ+AG+RY GGKLDDITVVVS+
Sbjct  309  VVHALRAGFSPESTAKEIVALARERAVDKNKQTPFAKAAQDAGYRYNGGKLDDITVVVSF  368

Query  389  IT  384
            IT
Sbjct  369  IT  370



>ref|XP_004512015.1| PREDICTED: probable protein phosphatase 2C 55-like [Cicer arietinum]
Length=437

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -3

Query  764  GWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNS  585
            G    F+SP QQHDFNFTYQLE GN GDLPSSG+VF +PVA GDVI+AGTDGLFDNLYN+
Sbjct  306  GGSIIFKSPVQQHDFNFTYQLESGNGGDLPSSGEVFTIPVAPGDVIVAGTDGLFDNLYNN  365

Query  584  DITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDIT  405
            DITAVVV+ATRA L PQ TAQKIAALARQRA DK R +PFS AA EAG+RYYGGKLDDIT
Sbjct  366  DITAVVVNATRARLEPQTTAQKIAALARQRALDKKRPSPFSAAALEAGYRYYGGKLDDIT  425



>ref|XP_002865051.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41310.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN+ D+PSSGQVF + V  GDVI+AGTDG++DNLYN +IT V
Sbjct  290  FQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVAGTDGVYDNLYNEEITGV  349

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TAQKIA LARQRA DK RQ+PF+TAAQEAG+RYYGGKLDDITVVVSY
Sbjct  350  VVSSVRAGLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAGYRYYGGKLDDITVVVSY  409

Query  389  ITS  381
            + S
Sbjct  410  VNS  412



>ref|XP_010444748.1| PREDICTED: probable protein phosphatase 2C 80 [Camelina sativa]
Length=410

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN+ D+PSSGQVF + V  GDVI+AGTDG++DNLYN +IT V
Sbjct  287  FQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVAGTDGMYDNLYNEEITGV  346

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RA L P+ TAQKIA LARQRA DK RQ+PF+TAAQEAG+RYYGGKLDDITVVVSY
Sbjct  347  VVSSVRARLDPKATAQKIADLARQRAVDKKRQSPFATAAQEAGYRYYGGKLDDITVVVSY  406

Query  389  ITS  381
            ITS
Sbjct  407  ITS  409



>ref|NP_201473.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
 sp|Q9LVQ8.1|P2C80_ARATH RecName: Full=Probable protein phosphatase 2C 80; Short=AtPP2C80 
[Arabidopsis thaliana]
 dbj|BAA97278.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM97071.1| putative protein [Arabidopsis thaliana]
 gb|AAN15547.1| putative protein [Arabidopsis thaliana]
 dbj|BAC41805.1| unknown protein [Arabidopsis thaliana]
 gb|AED98255.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
Length=414

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN+ D+PSSGQVF + V  GDVI+AGTDG++DNLYN +IT V
Sbjct  291  FQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVQSGDVIVAGTDGVYDNLYNEEITGV  350

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TAQKIA LARQRA DK RQ+PF+TAAQEAG+RYYGGKLDDIT VVSY
Sbjct  351  VVSSVRAGLDPKGTAQKIAELARQRAVDKKRQSPFATAAQEAGYRYYGGKLDDITAVVSY  410

Query  389  ITS  381
            +TS
Sbjct  411  VTS  413



>ref|NP_975004.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
 gb|AED98256.1| putative protein phosphatase 2C 80 [Arabidopsis thaliana]
Length=411

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN+ D+PSSGQVF + V  GDVI+AGTDG++DNLYN +IT V
Sbjct  288  FQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVQSGDVIVAGTDGVYDNLYNEEITGV  347

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TAQKIA LARQRA DK RQ+PF+TAAQEAG+RYYGGKLDDIT VVSY
Sbjct  348  VVSSVRAGLDPKGTAQKIAELARQRAVDKKRQSPFATAAQEAGYRYYGGKLDDITAVVSY  407

Query  389  ITS  381
            +TS
Sbjct  408  VTS  410



>dbj|BAJ91094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             +SPSQQHDFNFTYQLE G   DLPSS  VF   VA GDVIIAGTDGLFDNLY+++ITAV
Sbjct  353  LKSPSQQHDFNFTYQLESGGGSDLPSSADVFHYSVAPGDVIIAGTDGLFDNLYDNEITAV  412

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R+GLG Q TAQKIAALAR+RA DK+RQ+PF+ AAQEAG+RYYGGKLDDITVVVSY
Sbjct  413  VVEALRSGLGAQGTAQKIAALARERALDKHRQSPFAAAAQEAGYRYYGGKLDDITVVVSY  472

Query  389  IT  384
            +T
Sbjct  473  VT  474



>ref|XP_009600510.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
 ref|XP_009600511.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=377

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 105/129 (81%), Gaps = 2/129 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+QQH FNF YQL+C NAGD PSS  VFK+ VA GDV+IAGTDGLFDNLY+ DI  V
Sbjct  251  FKSPAQQHGFNFPYQLDCNNAGDSPSSAMVFKIAVAPGDVLIAGTDGLFDNLYDEDIKVV  310

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+ +  AGLGPQ+TAQ+IA LA+QRA D N+ +PFS  AQEAGF Y+GGKLDDITVVVSY
Sbjct  311  VLQSVEAGLGPQMTAQRIAELAQQRAMDTNKSSPFSDGAQEAGFEYHGGKLDDITVVVSY  370

Query  389  ITSENNENS  363
            I   NNENS
Sbjct  371  IM--NNENS  377



>ref|XP_009610356.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
 ref|XP_009610357.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=377

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 105/129 (81%), Gaps = 2/129 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+QQH FNF YQL+C NAGD PSS  VFK+ VA GDV+IAGTDGLFDNLY+ DI  V
Sbjct  251  FKSPAQQHGFNFPYQLDCNNAGDSPSSAMVFKIAVAPGDVLIAGTDGLFDNLYDEDIKGV  310

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+ +  AGLGPQ+TAQ+IA LA+QRA D  + +PFS  AQEAGF Y+GGKLDDITVVVSY
Sbjct  311  VLQSVEAGLGPQMTAQRIAELAQQRAMDPKKSSPFSDGAQEAGFEYHGGKLDDITVVVSY  370

Query  389  ITSENNENS  363
            +T  NNENS
Sbjct  371  VT--NNENS  377



>ref|NP_001051657.1| Os03g0809300 [Oryza sativa Japonica Group]
 gb|AAT77924.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99474.1| 5-azacytidine resistance protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13571.1| Os03g0809300 [Oryza sativa Japonica Group]
Length=479

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSP QQHDFNFTYQLE G   DLPSS Q F  PVA GDVIIAGTDGLFDNLY+++I+A+
Sbjct  353  LRSPVQQHDFNFTYQLESGGGSDLPSSAQTFHFPVAPGDVIIAGTDGLFDNLYSNEISAI  412

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R GL P+ TA+KIAALA+Q+A D+NRQ+PF+ AAQEAG+RY+GGKLDDITV+VSY
Sbjct  413  VVEALRTGLEPEATAKKIAALAQQKAMDRNRQSPFAAAAQEAGYRYFGGKLDDITVIVSY  472

Query  389  ITS  381
            +TS
Sbjct  473  VTS  475



>gb|EAY92287.1| hypothetical protein OsI_14009 [Oryza sativa Indica Group]
Length=481

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
             RSP QQHDFNFTYQLE G   DLPSS Q F  PVA GDVIIAGTDGLFDNLY+++I+A+
Sbjct  355  LRSPVQQHDFNFTYQLESGGGSDLPSSAQTFHFPVAPGDVIIAGTDGLFDNLYSNEISAI  414

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R GL P+ TA+KIAALA+Q+A D+NRQ+PF+ AAQEAG+RY+GGKLDDITV+VSY
Sbjct  415  VVEALRTGLEPEATAKKIAALAQQKAMDRNRQSPFAAAAQEAGYRYFGGKLDDITVIVSY  474

Query  389  ITS  381
            +TS
Sbjct  475  VTS  477



>ref|XP_006280550.1| hypothetical protein CARUB_v10026491mg [Capsella rubella]
 gb|EOA13448.1| hypothetical protein CARUB_v10026491mg [Capsella rubella]
Length=413

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN+ D+PSSGQVF + V  GDVI+AG+DG++DNLYN +IT V
Sbjct  290  FQSPVQQHGFNFTYQLESGNSADVPSSGQVFTIDVESGDVIVAGSDGMYDNLYNEEITGV  349

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TAQKIA LAR RA DK RQ+PF+ AAQEAG+RYYGGKLDDITVVVSY
Sbjct  350  VVSSVRAGLDPKATAQKIADLARLRAVDKKRQSPFAAAAQEAGYRYYGGKLDDITVVVSY  409

Query  389  ITS  381
            ITS
Sbjct  410  ITS  412



>ref|XP_010547493.1| PREDICTED: probable protein phosphatase 2C 80 [Tarenaya hassleriana]
 ref|XP_010547494.1| PREDICTED: probable protein phosphatase 2C 80 [Tarenaya hassleriana]
 ref|XP_010547495.1| PREDICTED: probable protein phosphatase 2C 80 [Tarenaya hassleriana]
Length=433

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN GD+PSSGQVF + V  GD I+AGTDGLFDNLYN +I  V
Sbjct  312  FQSPVQQHGFNFTYQLESGNRGDMPSSGQVFTIEVKEGDAIVAGTDGLFDNLYNDEIVGV  371

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV++ RAGL P+ TA+KIA LARQ A D+NRQTPFS AAQEAG+RYYGGKLDDITVVVSY
Sbjct  372  VVNSVRAGLDPKGTAEKIAELARQIAVDRNRQTPFSAAAQEAGYRYYGGKLDDITVVVSY  431

Query  389  I  387
            I
Sbjct  432  I  432



>ref|XP_006393865.1| hypothetical protein EUTSA_v10004287mg [Eutrema salsugineum]
 gb|ESQ31151.1| hypothetical protein EUTSA_v10004287mg [Eutrema salsugineum]
Length=422

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN GD+P+SGQVF + V  GDVI+AGTDG++DNLYN +IT V
Sbjct  299  FQSPVQQHGFNFTYQLESGNGGDMPNSGQVFMIDVVSGDVIVAGTDGVYDNLYNEEITGV  358

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TAQKIA LAR RA D+ RQ+PFS AAQEAGFRYYGGKLDDIT VVSY
Sbjct  359  VVSSVRAGLDPKATAQKIADLARARAVDRKRQSPFSAAAQEAGFRYYGGKLDDITAVVSY  418

Query  389  IT  384
            +T
Sbjct  419  VT  420



>ref|XP_010680832.1| PREDICTED: probable protein phosphatase 2C 80 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680833.1| PREDICTED: probable protein phosphatase 2C 80 [Beta vulgaris 
subsp. vulgaris]
Length=455

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQ+ FNF YQL  G  GDLPSSGQVF  PVA GDV++AGTDGLFDNLY+++ITA+
Sbjct  329  FRSPVQQYGFNFPYQLASGTGGDLPSSGQVFTFPVASGDVVVAGTDGLFDNLYDNEITAL  388

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV A R+GL PQ TA+ IA+LA+QRAQD++RQ+PF+ AA +AGFRY GGKLDDITVVVSY
Sbjct  389  VVQAKRSGLEPQATARNIASLAQQRAQDRHRQSPFAAAAHDAGFRYIGGKLDDITVVVSY  448

Query  389  ITSENNE  369
            IT E+N+
Sbjct  449  ITGEDNQ  455



>gb|KFK28352.1| putative protein phosphatase 2c 55-like [Arabis alpina]
Length=411

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNFTYQLE GN GD+P+SGQVF + V  GDVI+AG+DG++DNLYN DIT V
Sbjct  288  FQSPVQQHGFNFTYQLESGNGGDMPNSGQVFMIDVESGDVIVAGSDGVYDNLYNEDITGV  347

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VV + RAGL P+ TA+KIA LAR+RA D+ RQ+PF+TAA EAGFRYYGGKLDDIT VVSY
Sbjct  348  VVSSVRAGLDPKATAKKIADLARERALDRQRQSPFATAAHEAGFRYYGGKLDDITAVVSY  407

Query  389  IT  384
            +T
Sbjct  408  VT  409



>ref|XP_001758147.1| predicted protein [Physcomitrella patens]
 gb|EDQ76969.1| predicted protein, partial [Physcomitrella patens]
Length=256

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 110/128 (86%), Gaps = 3/128 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FN  +QLE G + D PS+ +VF + VA GDV++AGTDGLFDNLY++++  V
Sbjct  123  FKSPVQQHQFNIPFQLESGGS-DPPSAAEVFSLQVAAGDVLVAGTDGLFDNLYDNELVGV  181

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+H+TRAGL PQVTA+KI ALAR+RA+D+NRQTPFSTAAQEAGFR+YGGK+DDITVVVSY
Sbjct  182  VIHSTRAGLDPQVTAEKIVALARERAEDRNRQTPFSTAAQEAGFRFYGGKMDDITVVVSY  241

Query  389  ITSENNEN  366
            IT  NN++
Sbjct  242  IT--NNKS  247



>ref|XP_009760583.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009760585.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=377

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+QQH FNF YQL+C NAGD PSS  VFK+ VA GDV+IAGTDGLFDNLY+ DI  V
Sbjct  251  FKSPAQQHGFNFPYQLDCNNAGDSPSSAMVFKIAVAPGDVLIAGTDGLFDNLYDEDIKGV  310

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+ +  AGLGPQ+TA++IA LA+QRA D  + +PFS  AQEAGF Y+GGKLDDITVVVSY
Sbjct  311  VLQSVEAGLGPQMTARRIAELAQQRAMDPIKSSPFSDGAQEAGFEYHGGKLDDITVVVSY  370

Query  389  ITSENNENS  363
            I   NNENS
Sbjct  371  IM--NNENS  377



>emb|CDP02816.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNF YQLE GN GDLPSSGQVFK+ V  GDVI+AGTDGLFDNLY  +IT +
Sbjct  338  FESPVQQHGFNFPYQLERGNKGDLPSSGQVFKISVLPGDVIVAGTDGLFDNLYKREITTI  397

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V  A  +G  P++TAQK+AALAR RAQD+ RQTPFSTAAQE GF YYGGKLDDITVVVSY
Sbjct  398  VGAAVTSGFTPELTAQKVAALARHRAQDRERQTPFSTAAQEIGFSYYGGKLDDITVVVSY  457

Query  389  IT  384
            ++
Sbjct  458  VS  459



>ref|XP_011099582.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=382

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFTYQLE GN GDLPSSGQVFK+ V  GDV++AG+DGLFDNLY+ ++ A+
Sbjct  256  FESPVQQHGFNFTYQLERGNRGDLPSSGQVFKISVVPGDVVVAGSDGLFDNLYSKEVAAI  315

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V  A R GL P  TA+KIAA AR RA D+  +TPFSTAAQEAGF YYGGKLDD+TVVVSY
Sbjct  316  VADALREGLSPDATAEKIAAFARLRAVDRKHRTPFSTAAQEAGFSYYGGKLDDLTVVVSY  375

Query  389  ITSENN  372
            +++  N
Sbjct  376  VSASAN  381



>emb|CDY53852.1| BnaA07g37470D [Brassica napus]
Length=409

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAG-DLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F+SP QQH FNFTYQL CG++G D+P SGQVF + V  GDVI+AGTDG++DNLYN DIT 
Sbjct  285  FQSPVQQHGFNFTYQLGCGDSGGDMPRSGQVFMIDVEAGDVIVAGTDGVYDNLYNEDITG  344

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVV + RAGL P+ TAQKIA LAR RA DK RQ+PF+TAAQEAG+RYYGGKLDDIT +VS
Sbjct  345  VVVSSVRAGLDPKGTAQKIADLARARALDKKRQSPFATAAQEAGYRYYGGKLDDITALVS  404

Query  392  YIT  384
            Y+T
Sbjct  405  YVT  407



>emb|CDY30759.1| BnaC07g16590D [Brassica napus]
Length=410

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAG-DLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F+SP QQH FNFTYQL CG++G D+P SGQVF + V  GDVI+AGTDG++DNLYN DIT 
Sbjct  286  FQSPVQQHGFNFTYQLGCGDSGGDMPHSGQVFMIDVEAGDVIVAGTDGVYDNLYNEDITG  345

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVV + RAGL P+ TAQKIA LAR RA DK RQ+PF+TAAQEAG+RYYGGKLDDIT +VS
Sbjct  346  VVVSSVRAGLDPKGTAQKIADLARARAVDKKRQSPFATAAQEAGYRYYGGKLDDITALVS  405

Query  392  YIT  384
            Y+T
Sbjct  406  YVT  408



>ref|XP_009103494.1| PREDICTED: probable protein phosphatase 2C 80 [Brassica rapa]
 ref|XP_009103495.1| PREDICTED: probable protein phosphatase 2C 80 [Brassica rapa]
Length=409

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAG-DLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F+SP QQH FNFTYQL CG++G D+P SGQVF + V  GDVI+AGTDG++DNLYN DIT 
Sbjct  285  FQSPVQQHGFNFTYQLGCGDSGGDMPRSGQVFMIDVEAGDVIVAGTDGVYDNLYNEDITG  344

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVV + RAGL P+ TAQKIA LAR RA DK RQ+PF+TAAQEAG+RYYGGKLDDIT +VS
Sbjct  345  VVVSSVRAGLDPKGTAQKIADLARARAVDKKRQSPFATAAQEAGYRYYGGKLDDITALVS  404

Query  392  YIT  384
            Y+T
Sbjct  405  YVT  407



>ref|XP_009764148.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009764149.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009764150.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=378

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+Q H FNF YQLE  +AGDLPS  +VFK+ VA GDV+IAGTDGLFDNLY++DIT V
Sbjct  252  FKSPAQLHSFNFPYQLEGSSAGDLPSLAEVFKIAVAPGDVVIAGTDGLFDNLYDTDITGV  311

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA  +GL P+ TAQKIAALA+QRA D  + +PFS AA+EAGF Y+GGKLDDITVVVSY
Sbjct  312  VVHAVESGLEPETTAQKIAALAQQRAMDPTKPSPFSDAAKEAGFEYHGGKLDDITVVVSY  371

Query  389  ITSENN  372
            + ++++
Sbjct  372  VNNDSD  377



>gb|KHN36141.1| Hypothetical protein glysoja_003264 [Glycine soja]
Length=415

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 100/127 (79%), Gaps = 8/127 (6%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F  P QQHDFNF YQLE GN  DLPSSG+VF +PVA GD +IAGTDGLFDNLYNS+IT V
Sbjct  297  FEFPVQQHDFNFPYQLESGNGADLPSSGEVFTIPVASGDAVIAGTDGLFDNLYNSEITGV  356

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVHA R        AQKIAALARQRA  K+ +TPFSTAAQ+AGF YYGGKLDDITVVVSY
Sbjct  357  VVHAIR--------AQKIAALARQRALSKSSRTPFSTAAQKAGFCYYGGKLDDITVVVSY  408

Query  389  ITSENNE  369
            I+   +E
Sbjct  409  ISGSVSE  415



>ref|XP_004251474.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=377

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FNF YQLE   AGD PS  Q FK+ VA GDV++ GTDGLFDNLY++DIT V
Sbjct  248  FKSPVQQHGFNFPYQLEGSTAGDSPSLAQAFKITVAPGDVLVVGTDGLFDNLYDADITEV  307

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V+HA  AG GPQ+TA+KIAALA+QRA D  + +PFS AA+EAGF Y GGKLDDITVVVSY
Sbjct  308  VIHAVEAGFGPQMTAKKIAALAQQRAMDTTKPSPFSDAAKEAGFEYQGGKLDDITVVVSY  367

Query  389  ITSENNEN  366
            +T  NN N
Sbjct  368  VT--NNAN  373



>gb|AES94920.2| protein phosphatase 2C family protein [Medicago truncatula]
Length=450

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQL-ECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F+SP QQ  FNF YQL   G  GDLPSSG+VF VPVA GD+I+AGTDGLFDN+YN+DI  
Sbjct  323  FKSPVQQRGFNFPYQLARSGTEGDLPSSGEVFTVPVAPGDIIVAGTDGLFDNMYNNDIVG  382

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVV ATRA LGPQ TAQKIAALARQRA D  RQ+PFS AA E G+R+ GGKLDD+TVVVS
Sbjct  383  VVVGATRARLGPQATAQKIAALARQRALDTKRQSPFSAAALEYGYRFDGGKLDDLTVVVS  442

Query  392  YITSENNE  369
            YI++  NE
Sbjct  443  YISNSVNE  450



>ref|XP_003611962.1| Mitochondrial catalytic protein [Medicago truncatula]
 ref|XP_003636283.1| Mitochondrial catalytic protein [Medicago truncatula]
Length=452

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQL-ECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F+SP QQ  FNF YQL   G  GDLPSSG+VF VPVA GD+I+AGTDGLFDN+YN+DI  
Sbjct  325  FKSPVQQRGFNFPYQLARSGTEGDLPSSGEVFTVPVAPGDIIVAGTDGLFDNMYNNDIVG  384

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            VVV ATRA LGPQ TAQKIAALARQRA D  RQ+PFS AA E G+R+ GGKLDD+TVVVS
Sbjct  385  VVVGATRARLGPQATAQKIAALARQRALDTKRQSPFSAAALEYGYRFDGGKLDDLTVVVS  444

Query  392  YITSENNE  369
            YI++  NE
Sbjct  445  YISNSVNE  452



>gb|EEE60152.1| hypothetical protein OsJ_13054 [Oryza sativa Japonica Group]
Length=1379

 Score =   189 bits (479),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  749   FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
              RSP QQHDFNFTYQLE G   DLPSS Q F  PVA GDVIIAGTDGLFDNLY+++I+A+
Sbjct  1253  LRSPVQQHDFNFTYQLESGGGSDLPSSAQTFHFPVAPGDVIIAGTDGLFDNLYSNEISAI  1312

Query  569   VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
             VV A R GL P+ TA+KIAALA+Q+A D+NRQ+PF+ AAQEAG+RY+GGKLDDITV+VSY
Sbjct  1313  VVEALRTGLEPEATAKKIAALAQQKAMDRNRQSPFAAAAQEAGYRYFGGKLDDITVIVSY  1372

Query  389   ITS  381
             +TS
Sbjct  1373  VTS  1375



>ref|XP_006366049.1| PREDICTED: probable protein phosphatase 2C 55-like [Solanum tuberosum]
Length=373

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SPSQQH FNF YQL+C NAGD PSS  VF + V  GDV+I GTDGLFDNLY+ DI+ V
Sbjct  251  FKSPSQQHGFNFPYQLDCNNAGDSPSSAMVFNITVVPGDVLIVGTDGLFDNLYDEDISGV  310

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V  A  AGLGPQ+TAQ+IA LA+ RA D  + +PFS  A+E+GF Y+GGKLDDITVVVSY
Sbjct  311  VFQAMEAGLGPQMTAQRIAELAQLRAMDHTKSSPFSDGARESGFDYHGGKLDDITVVVSY  370

Query  389  IT  384
            IT
Sbjct  371  IT  372



>gb|EYU44672.1| hypothetical protein MIMGU_mgv1a007071mg [Erythranthe guttata]
Length=420

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNFT+QLE GN GD+PSSGQVFK+PV  GDVI+AG+DGLFDNLYN +I A+
Sbjct  298  FESPVQQHGFNFTFQLERGNTGDMPSSGQVFKIPVVAGDVIVAGSDGLFDNLYNKEIAAI  357

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V  + R  +GP  TA+KIA +AR RA D+  +TPFSTAAQEAG+ YYGGKLDD+TV+VS+
Sbjct  358  VGDSVRDCVGPDETAKKIADVARARALDRKHRTPFSTAAQEAGYAYYGGKLDDLTVLVSF  417

Query  389  ITS  381
            +++
Sbjct  418  VSA  420



>ref|XP_002974846.1| hypothetical protein SELMODRAFT_101879, partial [Selaginella 
moellendorffii]
 gb|EFJ24366.1| hypothetical protein SELMODRAFT_101879, partial [Selaginella 
moellendorffii]
Length=249

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FN  YQLE G + D P+  QVF V VA GDVI+ GTDGLFDN+Y++++ +V
Sbjct  126  FKSPVQQHLFNIPYQLEHGGS-DPPTCAQVFSVQVAAGDVIVVGTDGLFDNVYDTEVASV  184

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH+TR+G GPQ+TA+K+A LAR  A D+NRQTPF+ AAQ+AG+R++GGK+DDITVVVSY
Sbjct  185  VVHSTRSGFGPQLTAEKLATLARSSALDRNRQTPFAAAAQDAGYRFHGGKMDDITVVVSY  244

Query  389  ITS  381
            I S
Sbjct  245  IAS  247



>ref|XP_010106023.1| putative protein phosphatase 2C 55 [Morus notabilis]
 gb|EXC07293.1| putative protein phosphatase 2C 55 [Morus notabilis]
Length=460

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = -3

Query  665  QVFKVPVARGDVIIAGTDGLFDNLYNSDITAVVVHATRAGLGPQVTAQKIAALARQRAQD  486
             VF VPVA GDVIIAGTDGLFDNLYN++ITAVVVHA RAGLGPQVTAQKIAALARQRAQD
Sbjct  362  HVFTVPVAPGDVIIAGTDGLFDNLYNNEITAVVVHAVRAGLGPQVTAQKIAALARQRAQD  421

Query  485  KNRQTPFSTAAQEAGFRYYGGKLDDITVVVSYITSENNE  369
            K+RQTPFSTAAQ+AG RYYGGKLDDITV+VSY++  +++
Sbjct  422  KDRQTPFSTAAQDAGIRYYGGKLDDITVIVSYVSGSSDK  460



>ref|XP_002963762.1| hypothetical protein SELMODRAFT_79882, partial [Selaginella moellendorffii]
 gb|EFJ35633.1| hypothetical protein SELMODRAFT_79882, partial [Selaginella moellendorffii]
Length=249

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP QQH FN  YQLE G + D P+  QVF V VA GDVI+ GTDGLFDN+Y++++ +V
Sbjct  126  FKSPVQQHLFNIPYQLEHGGS-DPPTCAQVFSVQVAAGDVIVVGTDGLFDNVYDTEVASV  184

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            VVH+TR+G GPQ+TA+K+A LA+  A D+NRQTPF+ AAQ+AG+R++GGK+DDITVVVSY
Sbjct  185  VVHSTRSGFGPQLTAEKLATLAKASALDRNRQTPFAAAAQDAGYRFHGGKMDDITVVVSY  244

Query  389  ITS  381
            I S
Sbjct  245  IAS  247



>ref|XP_004244138.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=373

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SPSQQH FNF YQL+C NAGD PSS  VFK+    GDV+I GTDGLFDNLY+ DI+ V
Sbjct  251  FKSPSQQHGFNFPYQLDCNNAGDSPSSAMVFKITALPGDVLIVGTDGLFDNLYDEDISGV  310

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V  A   GL PQ+TAQ+IA LA+ RA D  + +PFS  A+EAGF Y+GGKLDDITVVVSY
Sbjct  311  VFQAMEDGLAPQMTAQRIAELAQLRAMDHIKSSPFSDGAREAGFDYHGGKLDDITVVVSY  370

Query  389  IT  384
            IT
Sbjct  371  IT  372



>gb|EPS61381.1| hypothetical protein M569_13414, partial [Genlisea aurea]
Length=274

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F SP QQH FNF YQLE    GDLPSS QVFK+PV  GDVI+AG+DGLFDNLY+ +I A+
Sbjct  148  FESPVQQHGFNFPYQLERSKMGDLPSSAQVFKIPVEAGDVIVAGSDGLFDNLYSREIAAI  207

Query  569  VVHAT---RAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVV  399
            +V        GL P+ TA+KIA  AR+RA D   +TPFS AAQ+AGF YYGGKLDD+TV+
Sbjct  208  IVGEAAKGEEGLSPEATAEKIAWFARERALDTKSETPFSVAAQQAGFTYYGGKLDDLTVI  267

Query  398  VSYITS  381
            VS+++S
Sbjct  268  VSFVSS  273



>ref|XP_006366044.1| PREDICTED: probable protein phosphatase 2C 55-like [Solanum tuberosum]
Length=373

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SPSQQH FNF YQL+C N GD PSS  VFK+    GDV+I  TDGLFDNLY+  I+ V
Sbjct  251  FKSPSQQHGFNFPYQLDCSNTGDSPSSTMVFKITALPGDVLIVSTDGLFDNLYDEYISGV  310

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V  A  AGLGPQ+TAQ+IA LA+ RA D  + +PFS  A+EAGF Y+GGKLDDITVVVSY
Sbjct  311  VFQAMEAGLGPQMTAQRIAELAQLRAMDHTKSSPFSDGAREAGFDYHGGKLDDITVVVSY  370

Query  389  IT  384
            IT
Sbjct  371  IT  372



>ref|XP_010070043.1| PREDICTED: probable protein phosphatase 2C 80 [Eucalyptus grandis]
 gb|KCW58599.1| hypothetical protein EUGRSUZ_H01259 [Eucalyptus grandis]
Length=437

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            FRSP QQH FNFTYQLE G  GDLPSSGQVF++PV+ GD I+AGTDGLFDNLY+ +++A+
Sbjct  311  FRSPVQQHGFNFTYQLENGRNGDLPSSGQVFRIPVSDGDGIVAGTDGLFDNLYDDEVSAL  370

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V  A ++GL PQ  A+KIAA ARQRA D+ RQTPF+ +AQEAG+RY+GGKLDDITVVVS+
Sbjct  371  VAEAVKSGLDPQAMARKIAAAARQRALDRYRQTPFADSAQEAGYRYHGGKLDDITVVVSF  430

Query  389  IT  384
            IT
Sbjct  431  IT  432



>emb|CDX99127.1| BnaA06g18180D [Brassica napus]
Length=267

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 84/118 (71%), Gaps = 6/118 (5%)
 Frame = -3

Query  746  RSPSQQHDFNFTYQ--LECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            +SPS     N  Y+   +      + S+ QVF V VA GDVIIAGTDGL DNLYN++ITA
Sbjct  143  QSPSVDRVTNIVYKEIFKDAQTTQVRSTRQVFTVAVAPGDVIIAGTDGLLDNLYNNEITA  202

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVV  399
             VV A RAG  PQVTAQKIAALARQRA DKNRQTPFST    AGFRYYGGKLDDI  V
Sbjct  203  TVVQAVRAGTDPQVTAQKIAALARQRAHDKNRQTPFST----AGFRYYGGKLDDIVYV  256



>gb|KIY99217.1| hypothetical protein MNEG_8745 [Monoraphidium neglectum]
Length=430

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 80/124 (65%), Gaps = 2/124 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLEC--GNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            F+SP QQH+FNF YQ+    G A D P+S   F++ V  GDV++ GTDGL+DN++  +  
Sbjct  301  FQSPQQQHNFNFPYQIGSADGGASDHPASAMRFELGVQPGDVVVCGTDGLWDNVFAEEAA  360

Query  575  AVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
             +V      G GP+  A  +   AR RA D   Q+PFS +A +AG+ Y GGKLDDITV+V
Sbjct  361  TIVARCKAQGDGPEAAANTLCRYARMRATDPKYQSPFSYSALQAGYMYVGGKLDDITVLV  420

Query  395  SYIT  384
            SY+T
Sbjct  421  SYVT  424



>emb|CAN67462.1| hypothetical protein VITISV_028052 [Vitis vinifera]
Length=110

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +VHATR+ L PQV AQKIA LARQRAQDKN QT FSTAAQ+AGFRYYGGKL+DIT VVSY
Sbjct  35   MVHATRSSLRPQVIAQKIAVLARQRAQDKNWQTLFSTAAQDAGFRYYGGKLNDITTVVSY  94

Query  389  ITSENN  372
            ITS NN
Sbjct  95   ITSHNN  100



>ref|XP_011075613.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=259

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 80/130 (62%), Gaps = 1/130 (1%)
 Frame = -3

Query  764  GWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNS  585
            G    ++SP+QQH FN+ YQ+   +A DLP   +   + V RGD++IA TDGLFDNL+  
Sbjct  127  GGKTVYKSPAQQHGFNYPYQMGSKSA-DLPDEAEEMVMAVERGDIVIAATDGLFDNLFPE  185

Query  584  DITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDIT  405
            DI   V    +    P+V A  +A  AR+++ ++   +PF  AA EAG  ++GGK DDIT
Sbjct  186  DIEETVELCLKKESLPEVVACTLARAAREKSLEERTASPFEVAAYEAGVEHFGGKYDDIT  245

Query  404  VVVSYITSEN  375
            VV +Y+  ++
Sbjct  246  VVAAYVVPDS  255



>ref|XP_005846774.1| hypothetical protein CHLNCDRAFT_24539 [Chlorella variabilis]
 gb|EFN54672.1| hypothetical protein CHLNCDRAFT_24539 [Chlorella variabilis]
Length=267

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 73/117 (62%), Gaps = 1/117 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNA-GDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F SP QQH+FNF YQ+   ++  D P   + F V V +GD+++A TDGLFDN+Y  +  +
Sbjct  138  FMSPQQQHEFNFPYQIGSADSMSDTPQVARRFSVEVRQGDIVVAATDGLFDNVYPDEAAS  197

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITV  402
            +V  +   G   Q  A  +A  AR RA D    +PF+  AQ+ G+RY+GGK+DDIT+
Sbjct  198  LVSASKERGENAQAVAVTLAQFARMRAADPTHLSPFAYGAQQLGYRYFGGKMDDITI  254



>emb|CDP14203.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 5/125 (4%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F+SP+ Q  FN  YQL  GN  D P S Q FKV V   DV++ GTDGLFDNL+   I ++
Sbjct  156  FQSPAMQKRFNCPYQL--GNERDTPDSAQEFKVDVEHDDVLVVGTDGLFDNLFPHQIGSI  213

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGF---RYYGGKLDDITVV  399
            V +     L P++ A  IA LA   +  K+R TP++ +A E G     Y GGK DD+TVV
Sbjct  214  VHNCVEGKLSPKMMASLIAELAWYHSLQKDRSTPYTKSAMEVGLVQENYLGGKYDDVTVV  273

Query  398  VSYIT  384
            V+ I 
Sbjct  274  VAKIV  278



>gb|ETK87262.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=235

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 79/139 (57%), Gaps = 9/139 (6%)
 Frame = -3

Query  773  GGEGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNL  594
            G   W     +P+Q H FN  YQL  G  GD P  G+V+ +    GDVI+ GTDGLFDNL
Sbjct  97   GALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDLETQEGDVIVLGTDGLFDNL  156

Query  593  YNSDITAVVVHATRAGLGPQV-------TAQKIAALARQRAQDKNRQTPFSTAAQEAGFR  435
            +   I +++   T     P++        A  IA  A + A+    +TPF+ AAQ+AG+ 
Sbjct  157  FPKQIASLL--DTVLPSTPELDHHSMEKVASCIAHTAHKAAKGTKSKTPFAVAAQQAGYE  214

Query  434  YYGGKLDDITVVVSYITSE  378
            Y GGK+DDITVV S +TS+
Sbjct  215  YLGGKMDDITVVTSLVTSD  233



>ref|XP_001696623.1| serine/threonine phosphatase, family 2C [Chlamydomonas reinhardtii]
 gb|EDP08600.1| serine/threonine phosphatase, family 2C [Chlamydomonas reinhardtii]
Length=373

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNA-GDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F +P QQH FNF YQ+   ++  D PSS Q F+V V  GD+++ GTDGL+DN ++ ++ +
Sbjct  246  FHTPQQQHGFNFPYQIGSADSMSDSPSSAQRFEVAVQPGDLLVLGTDGLWDNCFDEEVAS  305

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            V+ +     +     AQ +A  AR RA D    +PF+ AA +AG+ Y GGK+DDITVV+ 
Sbjct  306  VLKYCGEQKMEVAKMAQVLAHYARHRASDSKFASPFAYAAFQAGYAYMGGKMDDITVVIC  365

Query  392  YI  387
             +
Sbjct  366  QV  367



>ref|XP_007040568.1| Phosphatase 2C family protein, putative [Theobroma cacao]
 gb|EOY25069.1| Phosphatase 2C family protein, putative [Theobroma cacao]
Length=258

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = -3

Query  752  CFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
             ++SP QQH FN+ YQL      D P   QV K+ V  GDVIIAGTDGLFDNL  S I  
Sbjct  134  VYKSPIQQHSFNYPYQLGNSANSDKPWQAQVIKLAVEPGDVIIAGTDGLFDNLSESLILE  193

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
                    GL P+  A  +A  A   + D+   TP+  A+  AG R+ GGK DDITV+VS
Sbjct  194  AAAAGIELGLDPEEVAWPVAQQAYNISLDREAVTPYVQASMMAGQRHTGGKKDDITVIVS  253

Query  392  YI  387
             I
Sbjct  254  RI  255



>gb|ETL40689.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETO76031.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP17119.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
 gb|ETP45158.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=292

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = -3

Query  761  WMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSD  582
            W     +P+Q H FN  YQL  G  GD P  G+V+ +    GDVI+ GTDGLFDNL+   
Sbjct  158  WQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDLETQEGDVIVLGTDGLFDNLFPKQ  217

Query  581  ITAVV--VHATRAGL---GPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKL  417
            I +++  V  +   L     +  A  IA  A + A+    +TPF+ AAQ+AG+ Y GGK+
Sbjct  218  IASLLDTVLPSTPELDHHSMEKVASCIAHTAHKAAKGTKSKTPFAVAAQQAGYEYLGGKM  277

Query  416  DDITVVVSYITSE  378
            DDITVV S +TS+
Sbjct  278  DDITVVTSLVTSD  290



>ref|XP_008905224.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETI47280.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETK87261.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM47058.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETN09391.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=292

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = -3

Query  761  WMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSD  582
            W     +P+Q H FN  YQL  G  GD P  G+V+ +    GDVI+ GTDGLFDNL+   
Sbjct  158  WQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDLETQEGDVIVLGTDGLFDNLFPKQ  217

Query  581  ITAVV--VHATRAGL---GPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKL  417
            I +++  V  +   L     +  A  IA  A + A+    +TPF+ AAQ+AG+ Y GGK+
Sbjct  218  IASLLDTVLPSTPELDHHSMEKVASCIAHTAHKAAKGTKSKTPFAVAAQQAGYEYLGGKM  277

Query  416  DDITVVVSYITSE  378
            DDITVV S +TS+
Sbjct  278  DDITVVTSLVTSD  290



>gb|ETL93829.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=292

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = -3

Query  761  WMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSD  582
            W     +P+Q H FN  YQL  G  GD P  G+V+ +    GDVI+ GTDGLFDNL+   
Sbjct  158  WQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDLETQEGDVIVLGTDGLFDNLFPKQ  217

Query  581  ITAVV--VHATRAGL---GPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKL  417
            I +++  V  +   L     +  A  IA  A + A+    +TPF+ AAQ+AG+ Y GGK+
Sbjct  218  IASLLDTVLPSTPELDHHSMEKVASCIAHTAHKAAKGTKSKTPFAVAAQQAGYEYLGGKM  277

Query  416  DDITVVVSYITSE  378
            DDITVV S +TS+
Sbjct  278  DDITVVTSLVTSD  290



>ref|XP_011397842.1| putative protein phosphatase 2C 80 [Auxenochlorella protothecoides]
 gb|KFM24954.1| putative protein phosphatase 2C 80 [Auxenochlorella protothecoides]
Length=344

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 1/123 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNA-GDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F SP QQHDFNF +Q+   ++  D PS+ Q F +    GDV++  TDG+FDN+Y  +  +
Sbjct  201  FMSPQQQHDFNFPFQIGSPDSMSDFPSAAQRFSLKTYEGDVLVLATDGVFDNVYPDEAVS  260

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            +V    + G  P   A  +A  ARQRA D+   +PF+  AQ+ G+R++GGK+DDIT +V+
Sbjct  261  LVAAQRKRGATPGEAAAALAQFARQRAGDQTHLSPFAYGAQQRGYRFFGGKMDDITALVA  320

Query  392  YIT  384
            Y+ 
Sbjct  321  YVC  323



>gb|ETL40688.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETP17118.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=312

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 5/137 (4%)
 Frame = -3

Query  773  GGEGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNL  594
            G   W     +P+Q H FN  YQL  G  GD P  G+V+ +    GDVI+ GTDGLFDNL
Sbjct  174  GALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDLETQEGDVIVLGTDGLFDNL  233

Query  593  YNSDITAVV--VHATRAGL---GPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYY  429
            +   I +++  V  +   L     +  A  IA  A + A+    +TPF+ AAQ+AG+ Y 
Sbjct  234  FPKQIASLLDTVLPSTPELDHHSMEKVASCIAHTAHKAAKGTKSKTPFAVAAQQAGYEYL  293

Query  428  GGKLDDITVVVSYITSE  378
            GGK+DDITVV S +TS+
Sbjct  294  GGKMDDITVVTSLVTSD  310



>ref|XP_008905223.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETI47279.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETM47057.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETN09390.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
Length=312

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 5/137 (4%)
 Frame = -3

Query  773  GGEGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNL  594
            G   W     +P+Q H FN  YQL  G  GD P  G+V+ +    GDVI+ GTDGLFDNL
Sbjct  174  GALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDLETQEGDVIVLGTDGLFDNL  233

Query  593  YNSDITAVV--VHATRAGL---GPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYY  429
            +   I +++  V  +   L     +  A  IA  A + A+    +TPF+ AAQ+AG+ Y 
Sbjct  234  FPKQIASLLDTVLPSTPELDHHSMEKVASCIAHTAHKAAKGTKSKTPFAVAAQQAGYEYL  293

Query  428  GGKLDDITVVVSYITSE  378
            GGK+DDITVV S +TS+
Sbjct  294  GGKMDDITVVTSLVTSD  310



>gb|ETL93828.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=312

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 5/137 (4%)
 Frame = -3

Query  773  GGEGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNL  594
            G   W     +P+Q H FN  YQL  G  GD P  G+V+ +    GDVI+ GTDGLFDNL
Sbjct  174  GALRWQVVHETPNQCHYFNCPYQLGFGANGDKPEMGEVYDLETQEGDVIVLGTDGLFDNL  233

Query  593  YNSDITAVV--VHATRAGL---GPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYY  429
            +   I +++  V  +   L     +  A  IA  A + A+    +TPF+ AAQ+AG+ Y 
Sbjct  234  FPKQIASLLDTVLPSTPELDHHSMEKVASCIAHTAHKAAKGTKSKTPFAVAAQQAGYEYL  293

Query  428  GGKLDDITVVVSYITSE  378
            GGK+DDITVV S +TS+
Sbjct  294  GGKMDDITVVTSLVTSD  310



>gb|EYU20627.1| hypothetical protein MIMGU_mgv1a021452mg, partial [Erythranthe 
guttata]
Length=266

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 74/128 (58%), Gaps = 2/128 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            +RSP QQH FNF YQLE  +            V V  GDV++AGTDGLFDNL+  DI  +
Sbjct  128  YRSPVQQHSFNFPYQLEYSSEKHSHRQAAELAVEVESGDVVVAGTDGLFDNLFAGDIERI  187

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V       +     ++ +A  A  R+++    +PF  AA EAG RY GGKLDDITVVV+Y
Sbjct  188  VGDYCMDSMFS--LSETLARAAHGRSRETTTVSPFQVAANEAGIRYVGGKLDDITVVVAY  245

Query  389  ITSENNEN  366
            +  + + +
Sbjct  246  VVPDTSSS  253



>ref|XP_002274456.3| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=246

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 76/122 (62%), Gaps = 1/122 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            ++SP QQ  FN  YQL      D PSS +  KV V   D+++ GTDGLFDN++ S++  +
Sbjct  123  YKSPIQQRGFNCPYQLGRSKGSDRPSSAEELKVAVKERDILVVGTDGLFDNMFVSEMKEI  182

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGF-RYYGGKLDDITVVVS  393
            + +  + GL P+  A  +A LA   + DK+  TPF+ A + AG  +  GGK+DDITV+V+
Sbjct  183  IGNVEKEGLTPKELAWTLAELASYNSLDKDGDTPFAQAKRFAGCGQDKGGKVDDITVIVA  242

Query  392  YI  387
            YI
Sbjct  243  YI  244



>ref|XP_005647282.1| protein serine/threonine phosphatase 2C [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22738.1| protein serine/threonine phosphatase 2C [Coccomyxa subellipsoidea 
C-169]
Length=249

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 2/124 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAG--DLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            F+S +QQH FNF YQL  G  G  D P +  +  V V  GD+++A TDG++DN+Y+ DI 
Sbjct  121  FKSRTQQHSFNFPYQLGRGGNGVFDPPIAADLSSVQVKSGDILVAATDGVWDNMYSPDIA  180

Query  575  AVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
            ++V  A+  G  P   A+ +A  A  RA D    +PF+  A+  G    GGK+DDI VV+
Sbjct  181  SLVTTASTQGQSPAQVAENLARFAHMRAADPTYVSPFALGARALGHMDIGGKMDDICVVI  240

Query  395  SYIT  384
            +Y+ 
Sbjct  241  AYVV  244



>ref|XP_011026862.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
Length=290

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 71/124 (57%), Gaps = 0/124 (0%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            ++S  QQ+ FN+ YQL+  +    PS  QV  +PV  GDVI+AGTDGLFDNLY   I  +
Sbjct  165  YKSAIQQYSFNYPYQLQDNDRSRTPSGAQVTTLPVEAGDVIVAGTDGLFDNLYPRQIEEL  224

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V      G  PQ  A  +A  A   + D+   TPF+  + EAG    GGK DDITV+VS 
Sbjct  225  VRTMIEGGSDPQDVAWAVAGQAYCASMDREAFTPFTEGSLEAGKSSVGGKEDDITVIVSC  284

Query  389  ITSE  378
            I  +
Sbjct  285  IVDD  288



>gb|EIE76334.1| hypothetical protein RO3G_01038 [Rhizopus delemar RA 99-880]
Length=277

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 15/137 (11%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            Y FRS  QQH FNF YQL   ++ D P   Q+F + V +GD+II  TDGL+DNL++ DI 
Sbjct  131  YIFRSEEQQHAFNFPYQLGI-SSKDKPQDAQLFSIKVEKGDIIIMATDGLYDNLFDYDIL  189

Query  575  AVV--------VHATR------AGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGF  438
             +V        + AT       + L PQ+ A  +A  A++ ++  N  TPF   A E G 
Sbjct  190  ELVKKHIQTITIPATEDRPARVSNLQPQILADTLANKAKEVSEMNNVDTPFQKRAMEEGL  249

Query  437  RYYGGKLDDITVVVSYI  387
               GGK DDI+V+V+ +
Sbjct  250  LLEGGKADDISVIVAVV  266



>gb|KJB24190.1| hypothetical protein B456_004G132100 [Gossypium raimondii]
Length=253

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDL--PSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            ++SP Q H FNF YQL  GN+ +   P   QV KV V  GDVIIAGTDGLFDNL+   I 
Sbjct  130  YKSPIQLHSFNFPYQL--GNSANCAKPRQAQVIKVRVEAGDVIIAGTDGLFDNLFELQIL  187

Query  575  AVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
            A         LG +    + A LA Q ++DK   TPF  A++  G    GGK DDITV+V
Sbjct  188  ATASKGIEQDLGAEEMVWETAQLAYQTSRDKAAVTPFMEASKRGGRFRDGGKGDDITVIV  247

Query  395  SYI  387
            S I
Sbjct  248  SRI  250



>ref|XP_002945739.1| Serine/threonine phosphatase, family 2C [Volvox carteri f. nagariensis]
 gb|EFJ52734.1| Serine/threonine phosphatase, family 2C [Volvox carteri f. nagariensis]
Length=370

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNA-GDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
            F +P QQH FNF YQ+   ++  D P S Q F++ V  GD+I+ GTDGL+DN ++ ++  
Sbjct  243  FHTPQQQHGFNFPYQIGSPDSMSDPPQSAQRFEIRVQPGDLILLGTDGLWDNCFDEELAC  302

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            V+ +     +     A+ +A  AR RA D    +PF+ +A +AGF Y GGK+DDITV++ 
Sbjct  303  VLRYCRDQSMDAPKMAEVVAHYARHRASDSKFASPFAYSAFQAGFAYMGGKMDDITVLIC  362

Query  392  YI  387
             +
Sbjct  363  LV  364



>gb|ACJ83637.1| unknown [Medicago truncatula]
Length=58

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -3

Query  539  PQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSYI  387
            PQ+TAQKIAALARQRA DK+RQTPFSTAAQ+AGFRYYGGKLDD TVVVSYI
Sbjct  2    PQLTAQKIAALARQRALDKDRQTPFSTAAQDAGFRYYGGKLDDTTVVVSYI  52



>ref|XP_006681892.1| hypothetical protein BATDEDRAFT_20752 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77421.1| hypothetical protein BATDEDRAFT_20752 [Batrachochytrium dendrobatidis 
JAM81]
Length=249

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 82/133 (62%), Gaps = 7/133 (5%)
 Frame = -3

Query  752  CFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITA  573
             FR+  QQH FNF YQL   +  D P   QVF +PV  GD+++ G+DG+FDN+++ +I  
Sbjct  114  IFRNEEQQHSFNFPYQLGTVSK-DGPGDAQVFSIPVQEGDIVVIGSDGIFDNVFDDEIVE  172

Query  572  VV---VHATRAGLG-PQVTAQKIAALARQRAQD-KNRQTPFSTAAQEAGFRYYGGKLDDI  408
            ++    HA+R  L  PQ     I   AR+ A++ +   +PF T A + GF Y GGK+DD+
Sbjct  173  ILGGHTHASRPELSDPQRMTDAILYRAREVAENTRFGSSPFQTRAIQEGFYYQGGKMDDM  232

Query  407  TVVVSYI-TSENN  372
            TVVV  + TSE++
Sbjct  233  TVVVGIVRTSEDS  245



>gb|ADE77197.1| unknown [Picea sitchensis]
Length=238

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (59%), Gaps = 6/138 (4%)
 Frame = -3

Query  779  IHGGEGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFD  600
            I GG       +S    H FNF YQ+E G+   L    + + + +  GDVI+  TDGLFD
Sbjct  106  IRGGS---VIVKSSPMTHGFNFPYQIERGDDPSLLL--ESYDITLNDGDVIVTATDGLFD  160

Query  599  NLYNSDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGG  423
            NLY+ +I +++ ++ ++GLGP+  A  +A  A +R +  +  +PFS AA+  G+  Y GG
Sbjct  161  NLYDHEIASIIQNSLQSGLGPKEMATLLAEKAHERGKSTSGSSPFSDAARAVGYNTYIGG  220

Query  422  KLDDITVVVSYITSENNE  369
            KLDD+TV+VS +     E
Sbjct  221  KLDDVTVIVSLVKVNTKE  238



>ref|XP_008463804.1| PREDICTED: probable protein phosphatase 2C 55 [Cucumis melo]
Length=272

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F S SQQH FN  +QL  G   +LP      +V V  GD+++AGTDGL DN++ S+I  V
Sbjct  144  FVSVSQQHRFNCPFQLMDGYFLELPVQPWECRVEVWPGDIVVAGTDGLLDNVFASEIEKV  203

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +    R  + P   A ++A LA + + DK R TPFS AA+ AG    GGK+DDITV+V +
Sbjct  204  LKEEER--VDPGKLAWRLAELALRNSVDKRRTTPFSAAARRAGLWCEGGKIDDITVIVGH  261

Query  389  I  387
            +
Sbjct  262  V  262



>emb|CDP04031.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            ++SP QQH FN  YQL  GN+ D PS  Q  ++ V +GD+++AGTDG+FDNL+  +I  V
Sbjct  251  YQSPVQQHHFNCPYQL--GNSKDDPSLAQELQIEVQKGDIVVAGTDGVFDNLHGFEIEEV  308

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDK-NRQTPFSTAAQEAGFRYY-GGKLDDITVVV  396
            +  ++  G  P   A  IA LA   + D+    TPF+  ++EAG  ++ GGK+DDITV+V
Sbjct  309  IKSSSNKGDKPDYMACTIANLALYNSFDRYAADTPFARKSREAGHSHHKGGKVDDITVIV  368

Query  395  SYI  387
            ++I
Sbjct  369  AWI  371



>ref|XP_002284713.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=279

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 77/124 (62%), Gaps = 4/124 (3%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            ++SP+QQH FN  YQL  G   D  S  +   + V  GDV++AGTDGLFDN++ S+I  V
Sbjct  150  YKSPAQQHRFNSPYQL--GKRSDDLSVAEELTIEVKAGDVMVAGTDGLFDNVFASEIEDV  207

Query  569  --VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
              VV    + L PQV A+  A LA + ++ K+  +P+S AA   G+   GGK DDITVVV
Sbjct  208  IRVVCKKESCLEPQVLARSFAKLALKNSRHKDGDSPYSRAAMIEGYLKNGGKPDDITVVV  267

Query  395  SYIT  384
            ++I 
Sbjct  268  AHIV  271



>ref|XP_009797174.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=244

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            ++SP QQ  FN  YQL  GN+ D PS  Q  ++ V + DV+I GTDGL DN+  S+I  +
Sbjct  125  YKSPIQQRRFNCPYQL--GNSKDNPSVAQELELIVEKNDVLIVGTDGLLDNMNESEIEEL  182

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            V       L P+  A +I  +A   + D+   TPF  AA+   F + GGK+DDITV+V+Y
Sbjct  183  VQRGIAEKLKPKELASQIGNIALYNSFDRYADTPFGRAAEREWFSHRGGKVDDITVIVAY  242

Query  389  I  387
            I
Sbjct  243  I  243



>ref|XP_007042336.1| Phosphatase 2C 55, putative [Theobroma cacao]
 gb|EOX98167.1| Phosphatase 2C 55, putative [Theobroma cacao]
Length=302

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 72/124 (58%), Gaps = 3/124 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            +RSP QQHDFN  YQL      D P       V V  GD+++ GTDGLFDN+Y +++  +
Sbjct  177  YRSPIQQHDFNCPYQLGNSKTSDGPDMAMELFVRVKAGDIVVLGTDGLFDNMYPTEMEEI  236

Query  569  VVHAT---RAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVV  399
            +   T      + P+  A  IA  A   + DK   +PF+TAA++AG  + GGK+DDITVV
Sbjct  237  LKRETNEQEGSICPKKIASLIAGYALYNSFDKFAFSPFATAAKKAGLNHMGGKVDDITVV  296

Query  398  VSYI  387
            V  I
Sbjct  297  VGII  300



>ref|XP_010086629.1| putative protein phosphatase 2C 55 [Morus notabilis]
 gb|EXB22348.1| putative protein phosphatase 2C 55 [Morus notabilis]
Length=266

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 72/125 (58%), Gaps = 2/125 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            +RSP QQ  FN  YQL      D P      KV V  GDVII GTDG FDN++ S+   V
Sbjct  139  YRSPCQQRGFNCPYQLGNNKNSDKPECAIEIKVEVMEGDVIILGTDGFFDNVFASEAEEV  198

Query  569  VVHATR--AGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
            +   +R   G+ P+  A  IA LA   + D+ R++PFS  A+ AG    GGK+DDITV+V
Sbjct  199  LERESRKKGGIVPKNLACYIAELALYNSFDRFRESPFSRNAKLAGKNRRGGKIDDITVIV  258

Query  395  SYITS  381
            S I +
Sbjct  259  SQIVA  263



>ref|XP_004146087.1| PREDICTED: probable protein phosphatase 2C 55 [Cucumis sativus]
 gb|KGN55048.1| hypothetical protein Csa_4G625030 [Cucumis sativus]
Length=271

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            F S SQQH FN  +QL  G   +LP      +V V  GD+++AGTDGL DN++ S+I  V
Sbjct  143  FVSASQQHRFNCPFQLMDGFFVELPVQPWECRVEVWPGDIVVAGTDGLLDNVFASEIEKV  202

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVSY  390
            +    R  + P   A ++A LA   + DK R TPFS AA+ AG    GGK+DDITV+V +
Sbjct  203  LKEEER--VDPGKLAWRLAELALGNSVDKRRTTPFSAAARRAGLWCEGGKIDDITVIVGH  260

Query  389  I  387
            +
Sbjct  261  V  261



>ref|XP_007212971.1| hypothetical protein PRUPE_ppa021121mg [Prunus persica]
 gb|EMJ14170.1| hypothetical protein PRUPE_ppa021121mg [Prunus persica]
Length=243

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 2/117 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            + SP  QH FN  YQL      D P S    K+ V  GD+++ GTDGL+DN+Y ++I   
Sbjct  121  YVSPRPQHRFNHPYQLGYSTHFDNPRSATKTKIRVFPGDILVLGTDGLWDNMYPNEIVQF  180

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVV  399
            V +     + P+  A  +A++AR R+ DK R +PFS AAQ+AG ++ GGK DDITVV
Sbjct  181  VENMRE--MKPEALACALASVARGRSLDKGRFSPFSRAAQKAGIKHLGGKKDDITVV  235



>gb|KCW57011.1| hypothetical protein EUGRSUZ_I02678 [Eucalyptus grandis]
Length=682

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 82/129 (64%), Gaps = 6/129 (5%)
 Frame = -3

Query  767  EGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSS-GQVFKVPVARGDVIIAGTDGLFDNLY  591
            +G +Y   SP   H+FNF   +E    GD PS   + + + +  GDVI++ TDGLF+NLY
Sbjct  550  DGIIYKRSSP-MVHEFNFPVLIE---GGDTPSELMECYSIELDEGDVIVSATDGLFNNLY  605

Query  590  NSDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLD  414
              +I +++  + ++GL PQ  A  +AA A++  Q K+ +TPF+ AA  AG+  Y GGKLD
Sbjct  606  EQEIASIIRKSLQSGLSPQDIAALLAARAQEVGQSKSARTPFADAAHAAGYVGYTGGKLD  665

Query  413  DITVVVSYI  387
            D+TV+VS +
Sbjct  666  DVTVIVSTV  674



>ref|XP_010030054.1| PREDICTED: probable protein phosphatase 2C BIPP2C1 isoform X1 
[Eucalyptus grandis]
Length=686

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 82/129 (64%), Gaps = 6/129 (5%)
 Frame = -3

Query  767  EGWMYCFRSPSQQHDFNFTYQLECGNAGDLPSS-GQVFKVPVARGDVIIAGTDGLFDNLY  591
            +G +Y   SP   H+FNF   +E    GD PS   + + + +  GDVI++ TDGLF+NLY
Sbjct  554  DGIIYKRSSP-MVHEFNFPVLIE---GGDTPSELMECYSIELDEGDVIVSATDGLFNNLY  609

Query  590  NSDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLD  414
              +I +++  + ++GL PQ  A  +AA A++  Q K+ +TPF+ AA  AG+  Y GGKLD
Sbjct  610  EQEIASIIRKSLQSGLSPQDIAALLAARAQEVGQSKSARTPFADAAHAAGYVGYTGGKLD  669

Query  413  DITVVVSYI  387
            D+TV+VS +
Sbjct  670  DVTVIVSTV  678



>emb|CDS07785.1| hypothetical protein LRAMOSA01734 [Absidia idahoensis var. thermophila]
Length=346

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 72/134 (54%), Gaps = 8/134 (6%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAG-DLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDI  579
            Y FRS  QQH FNF YQL  G A  D PS  Q F V +  GDV+I  +DGL+DNL++ +I
Sbjct  205  YIFRSEEQQHSFNFPYQL--GTASFDYPSDAQQFSVKIEEGDVLIVASDGLYDNLFDDEI  262

Query  578  TAVVVHATRAGLGPQVTAQKIAALARQRAQ-----DKNRQTPFSTAAQEAGFRYYGGKLD  414
               V    R G   Q   Q I+    QRA+       N  +PF + A   G  Y GGK D
Sbjct  263  LEEVQACIRDGEQGQSIPQLISESLSQRAKIVSEDINNPASPFQSRAMHEGMYYQGGKAD  322

Query  413  DITVVVSYITSENN  372
            DITV+V+ I  E +
Sbjct  323  DITVLVAMIKREES  336



>gb|EYU18664.1| hypothetical protein MIMGU_mgv1a024169mg [Erythranthe guttata]
Length=276

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 76/132 (58%), Gaps = 6/132 (5%)
 Frame = -3

Query  779  IHGGEGWMYCFRSPSQQHDFNFTYQLE-CGNAGDLPSSGQVFKVPVARGDVIIAGTDGLF  603
            I GG  +   +RSP QQ+ FNF YQL+   +  D     +   V +  GDV++AGTDGLF
Sbjct  125  IRGGRTF---YRSPVQQYGFNFPYQLQNSSSEDDGAEQAEEMTVEMESGDVVVAGTDGLF  181

Query  602  DNLYNSDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGG  423
            DNL+  DI  +V       +     ++ +A  A +R++D    TPF  AA EAG R+ GG
Sbjct  182  DNLFPEDIETIVRDYCSDSM--LSLSETLATAALERSEDTTTVTPFEVAAYEAGKRHLGG  239

Query  422  KLDDITVVVSYI  387
            K DDITVVV+ +
Sbjct  240  KYDDITVVVARV  251



>emb|CCA25951.1| hypothetical protein SELMODRAFT_101879 [Albugo laibachii Nc14]
Length=171

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 73/134 (54%), Gaps = 15/134 (11%)
 Frame = -3

Query  761  WMYCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSD  582
            W   + S  Q H FN  YQL   N GD P      +  V   DVII GTDGLFDNLY S 
Sbjct  38   WEVVYESKHQSHFFNCPYQLGHLN-GDSPEISDQIEYSVQAEDVIILGTDGLFDNLYPSQ  96

Query  581  ITAVVVHATRAGLGP---------QVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYY  429
            I  ++ H     LGP         +  A  IA  A Q ++ K   TPF+ AA++AG++Y 
Sbjct  97   IAIILDH-----LGPNFLYEPQLVEEAANNIAHEAHQTSKCKQGSTPFAIAARKAGYKYD  151

Query  428  GGKLDDITVVVSYI  387
            GGK+DDITV++S +
Sbjct  152  GGKMDDITVIISMV  165



>ref|XP_006412349.1| hypothetical protein EUTSA_v10024559mg [Eutrema salsugineum]
 gb|ESQ53802.1| hypothetical protein EUTSA_v10024559mg [Eutrema salsugineum]
Length=701

 Score = 95.5 bits (236),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 70/117 (60%), Gaps = 3/117 (3%)
 Frame = -3

Query  728  HDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAVVVHATRA  549
            H F F  Q+  GN  D+    QV+ V +  GDV+I  TDGLFDNLY  DI ++V  +   
Sbjct  584  HHFCFPLQITQGN--DIFKLAQVYHVNLEEGDVVITATDGLFDNLYEEDIVSIVCRSLEQ  641

Query  548  GLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLDDITVVVSYITS  381
             L PQ  A  +AA A++  + +   TPF+ AA+E G+  Y GGK D +TV+VS++ S
Sbjct  642  SLEPQKIADLVAAKAQEVGRSETESTPFADAAKEEGYDGYNGGKPDAVTVIVSFVKS  698


 Score = 28.5 bits (62),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -1

Query  793  LGDSGFMVVRDG  758
            +GDSGFMV+RDG
Sbjct  562  IGDSGFMVIRDG  573



>gb|EIE88469.1| hypothetical protein RO3G_13180 [Rhizopus delemar RA 99-880]
Length=329

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            Y F+S  QQH FNF +QL   ++ D P   Q F V V +GD+II G+DGLFDNL++ DI 
Sbjct  205  YVFQSEEQQHSFNFPFQL-GPHSPDQPKDAQSFTVRVEKGDIIIMGSDGLFDNLFDKDIL  263

Query  575  AVVVHATRAGLGPQVTAQKIAALARQRAQDK-NRQTPFSTAAQEAGFRYYGGKLDDITVV  399
            ++V         PQ  + ++A  A + ++ K N   PF   A   G  Y GGK DDI+V+
Sbjct  264  SIVRQRHTLPFEPQKISDELARRANRISRSKTNVNCPFQEKAMGEGLYYQGGKADDISVI  323

Query  398  VSYI  387
            V+ +
Sbjct  324  VAVV  327



>dbj|GAN09367.1| Ser/Thr phosphatase, family 2C [Mucor ambiguus]
Length=388

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 76/138 (55%), Gaps = 16/138 (12%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            Y FRS  QQH FNF YQL    + D P   Q F + V +GD+II GTDGL+DNL++  I 
Sbjct  241  YVFRSEEQQHAFNFPYQLGI-RSRDQPHHAQSFNIKVKKGDIIIMGTDGLYDNLFDKTIL  299

Query  575  AVV---VHATRA-----------GLGPQVTAQKIAALARQRAQDK-NRQTPFSTAAQEAG  441
            ++V   VHA               L PQ+ +  +A  A++ ++ K N  TPF   A E G
Sbjct  300  SLVRDHVHAHTIPGNAQRPPRVRNLQPQILSDILANAAKEVSESKRNVDTPFQRRAMEEG  359

Query  440  FRYYGGKLDDITVVVSYI  387
                GGK DDI+V+V+ +
Sbjct  360  LLMEGGKADDISVIVAVV  377



>emb|CDH48835.1| protein phosphatase 2c 80 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=357

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 8/134 (6%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAG-DLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDI  579
            Y FRS  QQH FNF YQL  G A  D PS  Q F V +  GDV+I  +DGL+DNL++ +I
Sbjct  216  YLFRSEEQQHSFNFPYQL--GTASFDYPSDAQQFSVKIEEGDVLIVASDGLYDNLFDDEI  273

Query  578  T----AVVVHATRAGLGPQVTAQKIAALARQRAQD-KNRQTPFSTAAQEAGFRYYGGKLD  414
                 A +    +    PQ+ ++ ++  A+  ++D  N  +PF + A   G  Y GGK D
Sbjct  274  LEEVQACIRDCEQGQSIPQLISESLSQRAKIVSEDINNPASPFQSRAMHEGMYYQGGKAD  333

Query  413  DITVVVSYITSENN  372
            DITV+V+ I  E +
Sbjct  334  DITVIVAMIKREES  347



>ref|XP_010236832.1| PREDICTED: putative protein phosphatase 2C 23 [Brachypodium distachyon]
Length=173

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 74/122 (61%), Gaps = 2/122 (2%)
 Frame = -3

Query  746  RSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAVV  567
            RS  QQ  FN  YQL     GD  ++ +  +VPV  GDV++AGTDGLFDN+++ ++  VV
Sbjct  48   RSRPQQSRFNCPYQLNSTGNGDRVTAAETGEVPVEEGDVVVAGTDGLFDNMFDEELERVV  107

Query  566  VHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQ--EAGFRYYGGKLDDITVVVS  393
                  GL  +  A  IA +A + ++++ R +PFS  ++      R+ GGK DDITVVV+
Sbjct  108  RMGAALGLPAKNMADVIAGVAYEMSRNRARDSPFSVESRRHHRADRWSGGKEDDITVVVA  167

Query  392  YI  387
            ++
Sbjct  168  FV  169



>emb|CDH53433.1| protein phosphatase 2c-related protein [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=382

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 74/138 (54%), Gaps = 16/138 (12%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            Y FR+  QQH FNF YQL   N+ D P   Q F + V + D++I  TDGLFDNLY+ +I 
Sbjct  235  YVFRNEEQQHAFNFPYQLGT-NSPDKPKDAQEFDIKVEKNDIVILATDGLFDNLYDREIL  293

Query  575  AVVVHATRA--------------GLGPQVTAQKIAALARQRAQD-KNRQTPFSTAAQEAG  441
            A+V     A                 PQ  +  +AA AR  ++D +N  +PF + A   G
Sbjct  294  AIVRAHVNAYTLPGDGQRPSRLLNFNPQKLSDALAARARAVSEDRRNLDSPFQSRAINEG  353

Query  440  FRYYGGKLDDITVVVSYI  387
              Y GGK DDI+VVV+ +
Sbjct  354  LLYQGGKSDDISVVVALV  371



>emb|CDH53434.1| protein phosphatase 2c-related protein [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=385

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 74/138 (54%), Gaps = 16/138 (12%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            Y FR+  QQH FNF YQL   N+ D P   Q F + V + D++I  TDGLFDNLY+ +I 
Sbjct  238  YVFRNEEQQHAFNFPYQLGT-NSPDKPKDAQEFDIKVEKNDIVILATDGLFDNLYDREIL  296

Query  575  AVVVHATRA--------------GLGPQVTAQKIAALARQRAQD-KNRQTPFSTAAQEAG  441
            A+V     A                 PQ  +  +AA AR  ++D +N  +PF + A   G
Sbjct  297  AIVRAHVNAYTLPGDGQRPSRLLNFNPQKLSDALAARARAVSEDRRNLDSPFQSRAINEG  356

Query  440  FRYYGGKLDDITVVVSYI  387
              Y GGK DDI+VVV+ +
Sbjct  357  LLYQGGKSDDISVVVALV  374



>emb|CDS12243.1| hypothetical protein LRAMOSA04438 [Absidia idahoensis var. thermophila]
Length=385

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 74/138 (54%), Gaps = 16/138 (12%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            Y FR+  QQH FNF YQL   N+ D P   Q F + V + D++I  TDGLFDNLY+ +I 
Sbjct  238  YVFRNEEQQHAFNFPYQLGT-NSPDKPKDAQEFDIKVEKNDIVILATDGLFDNLYDREIL  296

Query  575  AVVVHATRA--------------GLGPQVTAQKIAALARQRAQD-KNRQTPFSTAAQEAG  441
            A+V     A                 PQ  +  +AA AR  ++D +N  +PF + A   G
Sbjct  297  AIVRAHVNAYTLPGDGTRPPRLLNFNPQKLSDALAARARAVSEDRRNLDSPFQSRAINEG  356

Query  440  FRYYGGKLDDITVVVSYI  387
              Y GGK DDI+VVV+ +
Sbjct  357  LLYQGGKSDDISVVVALV  374



>ref|XP_007212931.1| hypothetical protein PRUPE_ppa021890mg, partial [Prunus persica]
 gb|EMJ14130.1| hypothetical protein PRUPE_ppa021890mg, partial [Prunus persica]
Length=245

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            + SP +Q  FN  YQL      D P S    ++ V  GD+++ GTDGL+DN+Y ++I  V
Sbjct  122  YMSPREQRSFNCPYQLGNSRGSDNPCSATEIEIRVFPGDIVVLGTDGLWDNMYPNEIEQV  181

Query  569  VVHATRAG--LGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
            V+   R    + PQ  A  +A LA  R+ DK+  +P+S AAQ+AG  + GGK+DDITVVV
Sbjct  182  VLGNMRESRVMKPQALACLLADLAWLRSLDKDSFSPYSKAAQDAGKNHPGGKMDDITVVV  241

Query  395  SYI  387
             +I
Sbjct  242  GHI  244



>ref|XP_004955098.1| PREDICTED: putative protein phosphatase 2C 24-like [Setaria italica]
Length=315

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = -3

Query  782  WIHGGEGWMYCFR-------SPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVII  624
            W + G+     FR       S  QQH FN  YQL     G   +  +V +VP   GD+++
Sbjct  170  WAYVGDSGFLVFRDGRILARSQPQQHSFNCPYQLNSERDGTSVAEAEVGEVPAKEGDIVV  229

Query  623  AGTDGLFDNLYNSDITAVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQ-E  447
             GTDGLFDN+   ++  +V   T  G  P+  A+ +AA A + A+  NR TP+S   + E
Sbjct  230  VGTDGLFDNVTEDELERIVRMGTALGFSPKNMAEVMAAFAFEAARCGNRDTPYSVLGRSE  289

Query  446  AGFRYY-GGKLDDITVVVSYITSEN  375
             G  ++ GGK DDITVVV+YI   +
Sbjct  290  PGRAFFTGGKPDDITVVVAYIVPSS  314



>ref|XP_009400624.1| PREDICTED: probable protein phosphatase 2C 55 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 80/125 (64%), Gaps = 10/125 (8%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            + SP+QQ  FN  YQL+  N+G+  +  +V  + V  GD+I+  TDG+FDNL++S+    
Sbjct  259  YHSPAQQRGFNTPYQLQ--NSGETLNDAEVKSMGVEPGDIIVVATDGVFDNLFDSE----  312

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQ----DKNRQTPFSTAAQEAGFRYYGGKLDDITV  402
            VV   ++GL   ++A++IA+L    AQ     + ++TPFS A ++AG R  GGK DDITV
Sbjct  313  VVRLIKSGLVLNLSAERIASLIADEAQRNSLRRTKETPFSIACRKAGKRRKGGKKDDITV  372

Query  401  VVSYI  387
            VV +I
Sbjct  373  VVMFI  377



>ref|XP_008226580.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
Length=275

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 74/123 (60%), Gaps = 2/123 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            + SP +Q  FN  YQL      D P S    ++ V  GD+++ GTDGL+DN+Y ++I  V
Sbjct  117  YMSPREQRSFNCPYQLGNSRGSDNPCSATEIEIRVFPGDIVVIGTDGLWDNMYPNEIEQV  176

Query  569  VVHATRAG--LGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
            V+   R    + PQ  A  +A LA  R+ DK+  +P+S AAQEAG  + GGK DDITVVV
Sbjct  177  VLGNMRESRVMKPQALACLLADLAWLRSLDKDSFSPYSKAAQEAGKNHPGGKKDDITVVV  236

Query  395  SYI  387
             +I
Sbjct  237  GHI  239



>ref|NP_567923.1| putative protein phosphatase 2C 62 [Arabidopsis thaliana]
 sp|Q93V88.1|P2C62_ARATH RecName: Full=Probable protein phosphatase 2C 62; Short=AtPP2C62 
[Arabidopsis thaliana]
 gb|AAK59552.1| unknown protein [Arabidopsis thaliana]
 gb|AAK93729.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86236.1| putative protein phosphatase 2C 62 [Arabidopsis thaliana]
Length=724

 Score = 93.6 bits (231),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -3

Query  722  FNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAVVVHATRAGL  543
             +F + L      D+    +V+ V +  GDV+IA TDGLFDNLY  +I ++V  + +  L
Sbjct  607  HHFCFPLHITQGCDVLKLAEVYHVNLEEGDVVIAATDGLFDNLYEKEIVSIVCGSLKQSL  666

Query  542  GPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLDDITVVVSYI  387
             PQ  A+ +AA A++  + K  +TPF+ AA+E G+  + GGKLD +TV++S++
Sbjct  667  EPQKIAELVAAKAQEVGRSKTERTPFADAAKEEGYNGHKGGKLDAVTVIISFV  719


 Score = 28.5 bits (62),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -1

Query  793  LGDSGFMVVRDG  758
            +GDSGFMV+RDG
Sbjct  585  IGDSGFMVIRDG  596



>ref|XP_008226369.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
Length=335

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 74/124 (60%), Gaps = 1/124 (1%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVP-VARGDVIIAGTDGLFDNLYNSDITA  573
            ++SPSQQ  FN  YQL     GD P +   F V  +  GD+I+ GTDGL DN++ S+I  
Sbjct  186  YKSPSQQRMFNCPYQLGNHVGGDRPEAALEFVVEAIVPGDIIVLGTDGLLDNIFASEIED  245

Query  572  VVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVVS  393
            V+V    +G   +  A  IA LA   + DK   +PF   A++AG ++ GGK+DDITVVV+
Sbjct  246  VLVAYKGSGRDCEELASAIANLALFNSLDKYSVSPFQMEAEKAGLKHAGGKIDDITVVVA  305

Query  392  YITS  381
             I +
Sbjct  306  QIVA  309



>ref|XP_008352815.1| PREDICTED: probable protein phosphatase 2C BIPP2C1 [Malus domestica]
Length=169

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 79/122 (65%), Gaps = 5/122 (4%)
 Frame = -3

Query  746  RSPSQQHDFNFTYQLECGNAGDLPSSG-QVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            +S    H+FNF  ++E    GD PS   + +++ +  GDV++  TDGLFDNLY  +IT++
Sbjct  41   KSSPMVHEFNFPVRVE---RGDDPSELIEKYRIDLDEGDVVVTATDGLFDNLYEQEITSI  97

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLDDITVVVS  393
            V+ + + GL  Q  A+ +A  A++  + K+ ++PF+ AA  +G+  Y GGKLDD+ V++S
Sbjct  98   VLKSLQTGLELQDIAELLATSAQELGRSKSTRSPFADAAXASGYAGYSGGKLDDVVVILS  157

Query  392  YI  387
            Y+
Sbjct  158  YV  159



>ref|XP_006412350.1| hypothetical protein EUTSA_v10024559mg [Eutrema salsugineum]
 gb|ESQ53803.1| hypothetical protein EUTSA_v10024559mg [Eutrema salsugineum]
Length=702

 Score = 93.6 bits (231),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 10/121 (8%)
 Frame = -3

Query  728  HDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAVVVHATRA  549
            H F F  Q+  GN  D+    QV+ V +  GDV+I  TDGLFDNLY  DI ++V  +   
Sbjct  584  HHFCFPLQITQGN--DIFKLAQVYHVNLEEGDVVITATDGLFDNLYEEDIVSIVCRSLEQ  641

Query  548  GLGPQVTAQKIAALARQRAQDKNR----QTPFSTAAQEAGFR-YYGGKLDDITVVVSYIT  384
             L PQ   QKIA L   +AQ+  R     TPF+ AA+E G+  Y GGK D +TV+VS++ 
Sbjct  642  SLEPQ---QKIADLVAAKAQEVGRSETESTPFADAAKEEGYDGYNGGKPDAVTVIVSFVK  698

Query  383  S  381
            S
Sbjct  699  S  699


 Score = 28.5 bits (62),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -1

Query  793  LGDSGFMVVRDG  758
            +GDSGFMV+RDG
Sbjct  562  IGDSGFMVIRDG  573



>gb|KIY99196.1| hypothetical protein MNEG_8763 [Monoraphidium neglectum]
Length=421

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLEC--GNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            F+SP QQH+FNF YQL    G A D P S   F++ V  GD++I GTDGL+DN++  +  
Sbjct  293  FQSPQQQHNFNFPYQLGSADGGASDHPQSAMRFELTVQPGDIVITGTDGLWDNVFAEEAA  352

Query  575  AVVVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVV  399
             +V      G GP+  A  +   AR RA D    +PFS +A +AG+ + GG      +V
Sbjct  353  TIVARCRVQGDGPEAAAHALCRYARMRATDPKYHSPFSYSAIQAGYVFLGGGFQPSGIV  411



>emb|CEI91203.1| hypothetical protein RMCBS344292_05501 [Rhizopus microsporus]
Length=329

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 78/138 (57%), Gaps = 16/138 (12%)
 Frame = -3

Query  755  YCFRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDIT  576
            Y FRS  QQH FNF YQL    + D P   Q F V V +GD+II  TDGL+DNL++ DI 
Sbjct  182  YVFRSEEQQHAFNFPYQLGIL-SKDQPKDAQSFTVQVEKGDIIIMATDGLYDNLFDKDIL  240

Query  575  AVV--------VHATR------AGLGPQVTAQKIAALARQRAQDKNR-QTPFSTAAQEAG  441
             +V        + AT+        L PQ+ +  +A  A++ ++ + R +TPF   A + G
Sbjct  241  DIVRKHVQEHTIPATKDRPARICNLQPQMLSDVLANKAKEVSETRYRIETPFQRRAMKEG  300

Query  440  FRYYGGKLDDITVVVSYI  387
            F   GGK DDI+V+V+ +
Sbjct  301  FLMEGGKQDDISVIVAIV  318



>ref|XP_010261223.1| PREDICTED: probable protein phosphatase 2C 62 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261224.1| PREDICTED: probable protein phosphatase 2C 62 isoform X1 [Nelumbo 
nucifera]
Length=952

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 51/122 (42%), Positives = 80/122 (66%), Gaps = 5/122 (4%)
 Frame = -3

Query  746  RSPSQQHDFNFTYQLECGNAGDLPSSG-QVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            RS +  H+FNF +Q+E    GD PS   + + + +  GDVI+  TDGLFDNLY  +I ++
Sbjct  826  RSSAMVHEFNFPFQIE---RGDDPSELIEAYTIDLDEGDVIVTATDGLFDNLYEQEIASI  882

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLDDITVVVS  393
            V  + +A L P+  A+ +A  A++  + ++ ++PF+ AAQ AG+  Y GGKLDD+TV+VS
Sbjct  883  VSKSLKASLKPKEMAEFLAMRAQEVGRSESARSPFADAAQAAGYTGYIGGKLDDVTVIVS  942

Query  392  YI  387
             +
Sbjct  943  LV  944



>ref|XP_007043012.1| Phosphatase 2c-like protein isoform 1 [Theobroma cacao]
 gb|EOX98843.1| Phosphatase 2c-like protein isoform 1 [Theobroma cacao]
Length=960

 Score = 97.1 bits (240),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 79/122 (65%), Gaps = 5/122 (4%)
 Frame = -3

Query  746  RSPSQQHDFNFTYQLECGNAGDLPSS-GQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            RS    ++FNF  Q++    GD PS   +V+++ +  GDVI+  TDGLFDNLY  DIT++
Sbjct  812  RSSPMVYEFNFPLQIK---RGDNPSDLVEVYRIDLNEGDVIVTATDGLFDNLYEQDITSI  868

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGF-RYYGGKLDDITVVVS  393
            VV + +  L PQ  A+ +A  A++  Q  + ++PF+  AQ AG+  Y GGKLDD+TV+VS
Sbjct  869  VVKSLQESLRPQEIAKLLATRAQELGQLSSVRSPFADEAQAAGYVGYRGGKLDDVTVIVS  928

Query  392  YI  387
             +
Sbjct  929  LV  930



>emb|CDW91186.1| serine threonine family 2c [Stylonychia lemnae]
Length=311

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 5/130 (4%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            +RS  QQH ++F +Q  CG  GD  S  +  +  +   D+++ G+DGLFDNLYN+DI + 
Sbjct  182  YRSKEQQHGYDFPFQ--CGTNGDPTSDAETQEHTLKDNDILVVGSDGLFDNLYNNDIQSC  239

Query  569  V---VHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVV  399
            +   +      + P   A+ IAA A Q +  +   +PF+  A+EAG  Y GGK+DDITVV
Sbjct  240  IQTQIIGQNYEVDPTAVAECIAAKAEQVSFSETHFSPFAKHAKEAGKEYQGGKMDDITVV  299

Query  398  VSYITSENNE  369
            V    +  N+
Sbjct  300  VGQFKNRQND  309



>ref|XP_010261225.1| PREDICTED: probable protein phosphatase 2C 62 isoform X2 [Nelumbo 
nucifera]
Length=922

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 51/122 (42%), Positives = 80/122 (66%), Gaps = 5/122 (4%)
 Frame = -3

Query  746  RSPSQQHDFNFTYQLECGNAGDLPSSG-QVFKVPVARGDVIIAGTDGLFDNLYNSDITAV  570
            RS +  H+FNF +Q+E    GD PS   + + + +  GDVI+  TDGLFDNLY  +I ++
Sbjct  796  RSSAMVHEFNFPFQIE---RGDDPSELIEAYTIDLDEGDVIVTATDGLFDNLYEQEIASI  852

Query  569  VVHATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLDDITVVVS  393
            V  + +A L P+  A+ +A  A++  + ++ ++PF+ AAQ AG+  Y GGKLDD+TV+VS
Sbjct  853  VSKSLKASLKPKEMAEFLAMRAQEVGRSESARSPFADAAQAAGYTGYIGGKLDDVTVIVS  912

Query  392  YI  387
             +
Sbjct  913  LV  914



>ref|XP_007214047.1| hypothetical protein PRUPE_ppa017442mg [Prunus persica]
 gb|EMJ15246.1| hypothetical protein PRUPE_ppa017442mg [Prunus persica]
Length=313

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 73/125 (58%), Gaps = 2/125 (2%)
 Frame = -3

Query  749  FRSPSQQHDFNFTYQLECGNAGDLPSSGQVFKVP-VARGDVIIAGTDGLFDNLYNSDITA  573
            F+SP QQ  FN  YQL     GD P +   F V  +  GD+I+ GTDGL DN++ S+I  
Sbjct  186  FKSPPQQRMFNCPYQLGNHVGGDCPEAALEFVVEAIVPGDIIVLGTDGLLDNIFASEIED  245

Query  572  VVVHATRAGLGPQVT-AQKIAALARQRAQDKNRQTPFSTAAQEAGFRYYGGKLDDITVVV  396
            + VH     L   +  A+ IA LA    +DK++ TPF  AA++A   + GGK+D ITVVV
Sbjct  246  ISVHVITTELDLGICRARTIATLALFNFEDKDKVTPFQMAAEKAEVEHVGGKIDGITVVV  305

Query  395  SYITS  381
            + + +
Sbjct  306  AIVAA  310



>ref|XP_010437755.1| PREDICTED: probable protein phosphatase 2C 62 [Camelina sativa]
Length=134

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 73/122 (60%), Gaps = 4/122 (3%)
 Frame = -3

Query  743  SPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAVVV  564
            SP   H   F + L      D+ +  +V+ V +  GDV+IA TDGLFDNLY  ++ ++V 
Sbjct  13   SPMFHH---FCFPLHITQGCDVLNLAEVYNVKLDEGDVVIAATDGLFDNLYEKELVSIVC  69

Query  563  HATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLDDITVVVSYI  387
             +    L PQ  A+ +AA A++    +  +TPF+ AA+E G+  + GGKLD +TV+VS++
Sbjct  70   GSLEQSLEPQEIAELVAAKAQEVGGSETERTPFADAAKEEGYDGHKGGKLDAVTVIVSFV  129

Query  386  TS  381
             +
Sbjct  130  KT  131



>emb|CAB38808.1| putative protein [Arabidopsis thaliana]
 emb|CAB80067.1| putative protein [Arabidopsis thaliana]
Length=1066

 Score = 92.8 bits (229),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = -3

Query  743  SPSQQHDFNFTYQLECGNAGDLPSSGQVFKVPVARGDVIIAGTDGLFDNLYNSDITAVVV  564
            SP   H   F + L      D+    +V+ V +  GDV+IA TDGLFDNLY  +I ++V 
Sbjct  586  SPMFHH---FCFPLHITQGCDVLKLAEVYHVNLEEGDVVIAATDGLFDNLYEKEIVSIVC  642

Query  563  HATRAGLGPQVTAQKIAALARQRAQDKNRQTPFSTAAQEAGFR-YYGGKLDDITVVVSY  390
             + +  L PQ  A+ +AA A++  + K  +TPF+ AA+E G+  + GGKLD +TV++S+
Sbjct  643  GSLKQSLEPQKIAELVAAKAQEVGRSKTERTPFADAAKEEGYNGHKGGKLDAVTVIISF  701


 Score = 28.5 bits (62),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -1

Query  793  LGDSGFMVVRDG  758
            +GDSGFMV+RDG
Sbjct  568  IGDSGFMVIRDG  579



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798831613323