BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13494

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b         311   2e-98   Nicotiana sylvestris
ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b         308   2e-97   Nicotiana tomentosiformis
ref|XP_004236681.1|  PREDICTED: putative phagocytic receptor 1b         305   3e-96   Solanum lycopersicum
ref|XP_006346764.1|  PREDICTED: putative phagocytic receptor 1b-like    305   3e-96   Solanum tuberosum [potatoes]
ref|XP_009616336.1|  PREDICTED: putative phagocytic receptor 1b         303   1e-95   Nicotiana tomentosiformis
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b         302   4e-95   Nicotiana sylvestris
ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3    299   8e-94   
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like    298   1e-93   
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b         297   3e-93   Solanum lycopersicum
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg                295   2e-92   Erythranthe guttata [common monkey flower]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...    289   5e-90   Cucumis melo [Oriental melon]
ref|XP_010691703.1|  PREDICTED: transmembrane 9 superfamily member 2    288   9e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b         288   1e-89   Nelumbo nucifera [Indian lotus]
gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg                288   1e-89   Erythranthe guttata [common monkey flower]
ref|XP_010691704.1|  PREDICTED: transmembrane 9 superfamily membe...    287   3e-89   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004137376.1|  PREDICTED: transmembrane 9 superfamily member 3    287   3e-89   Cucumis sativus [cucumbers]
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b         286   4e-89   Eucalyptus grandis [rose gum]
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b         284   3e-88   Nelumbo nucifera [Indian lotus]
ref|XP_002285238.1|  PREDICTED: transmembrane 9 superfamily member 2    283   8e-88   Vitis vinifera
emb|CDP01680.1|  unnamed protein product                                283   1e-87   Coffea canephora [robusta coffee]
gb|AAF79216.1|AC006917_1  F10B6.2                                       272   2e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...    282   2e-87   Cucumis melo [Oriental melon]
ref|XP_011011376.1|  PREDICTED: transmembrane 9 superfamily membe...    278   3e-86   Populus euphratica
gb|EPS59962.1|  hypothetical protein M569_14842                         276   3e-86   Genlisea aurea
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b         278   8e-86   Tarenaya hassleriana [spider flower]
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...    278   1e-85   Sesamum indicum [beniseed]
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...    277   1e-85   Populus euphratica
ref|XP_004250237.1|  PREDICTED: putative phagocytic receptor 1b         276   3e-85   Solanum lycopersicum
ref|XP_006352389.1|  PREDICTED: putative phagocytic receptor 1b-l...    276   3e-85   Solanum tuberosum [potatoes]
emb|CDY62621.1|  BnaC08g46810D                                          276   3e-85   Brassica napus [oilseed rape]
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b         276   5e-85   Brassica rapa
ref|XP_011038404.1|  PREDICTED: transmembrane 9 superfamily member 4    276   5e-85   Populus euphratica
emb|CDY47549.1|  BnaA08g07380D                                          276   5e-85   Brassica napus [oilseed rape]
ref|XP_009785097.1|  PREDICTED: putative phagocytic receptor 1b         275   8e-85   Nicotiana sylvestris
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg             275   9e-85   Eutrema salsugineum [saltwater cress]
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b         275   1e-84   Tarenaya hassleriana [spider flower]
gb|KFK33411.1|  hypothetical protein AALP_AA5G009400                    275   2e-84   Arabis alpina [alpine rockcress]
ref|XP_006372420.1|  hypothetical protein POPTR_0017s01480g             273   2e-84   
ref|XP_007031333.1|  Endomembrane protein 70 protein family             273   2e-84   
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...    274   2e-84   Populus euphratica
emb|CDY15803.1|  BnaC02g34220D                                          274   2e-84   Brassica napus [oilseed rape]
gb|AAF63170.1|AC010657_6  T5E21.15                                      273   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg             274   2e-84   
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415             274   3e-84   Arabidopsis lyrata subsp. lyrata
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg             273   4e-84   Capsella rubella
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b         273   4e-84   Camelina sativa [gold-of-pleasure]
ref|NP_178306.1|  putative endomembrane protein 70                      273   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b         273   5e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b         273   5e-84   Tarenaya hassleriana [spider flower]
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b         273   5e-84   Prunus mume [ume]
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg             273   5e-84   Prunus persica
gb|KHG03505.1|  Putative phagocytic receptor 1b                         273   6e-84   Gossypium arboreum [tree cotton]
ref|NP_172919.1|  putative endomembrane protein 70                      273   6e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416990.1|  hypothetical protein EUTSA_v10007150mg             273   8e-84   Eutrema salsugineum [saltwater cress]
ref|XP_009355975.1|  PREDICTED: putative phagocytic receptor 1b         273   8e-84   Pyrus x bretschneideri [bai li]
ref|XP_006372421.1|  hypothetical protein POPTR_0017s01480g             273   1e-83   Populus trichocarpa [western balsam poplar]
ref|NP_198547.3|  putative endomembrane protein 70                      273   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g             272   1e-83   
emb|CDY52038.1|  BnaA08g31510D                                          269   1e-83   Brassica napus [oilseed rape]
ref|XP_002870515.1|  transporter                                        272   1e-83   Arabidopsis lyrata subsp. lyrata
gb|KJB15311.1|  hypothetical protein B456_002G170500                    271   2e-83   Gossypium raimondii
gb|KHG00678.1|  Putative phagocytic receptor 1b                         270   2e-83   Gossypium arboreum [tree cotton]
ref|XP_002521898.1|  transporter, putative                              270   2e-83   
ref|XP_009631354.1|  PREDICTED: putative phagocytic receptor 1b         271   2e-83   Nicotiana tomentosiformis
ref|XP_003620064.1|  Transmembrane 9 superfamily protein member         271   2e-83   Medicago truncatula
ref|XP_010496367.1|  PREDICTED: putative phagocytic receptor 1b         271   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010476529.1|  PREDICTED: putative phagocytic receptor 1b         271   3e-83   Camelina sativa [gold-of-pleasure]
gb|KJB60875.1|  hypothetical protein B456_009G329300                    270   3e-83   Gossypium raimondii
emb|CDX81659.1|  BnaC08g39420D                                          271   4e-83   
gb|KJB15313.1|  hypothetical protein B456_002G170500                    270   4e-83   Gossypium raimondii
gb|KHN43674.1|  Putative phagocytic receptor 1b                         271   4e-83   Glycine soja [wild soybean]
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...    271   4e-83   Populus euphratica
ref|XP_008393472.1|  PREDICTED: putative phagocytic receptor 1b         271   4e-83   Malus domestica [apple tree]
ref|XP_006372422.1|  endomembrane protein 70                            271   5e-83   Populus trichocarpa [western balsam poplar]
gb|KJB15310.1|  hypothetical protein B456_002G170500                    270   9e-83   Gossypium raimondii
ref|XP_010458976.1|  PREDICTED: putative phagocytic receptor 1b         270   9e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010440842.1|  PREDICTED: putative phagocytic receptor 1b i...    264   1e-82   
emb|CDY52035.1|  BnaA08g31480D                                          270   1e-82   Brassica napus [oilseed rape]
gb|KJB60874.1|  hypothetical protein B456_009G329300                    270   1e-82   Gossypium raimondii
ref|XP_010523531.1|  PREDICTED: putative phagocytic receptor 1b         270   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_010445554.1|  PREDICTED: putative phagocytic receptor 1b         264   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_009110524.1|  PREDICTED: putative phagocytic receptor 1b         270   1e-82   Brassica rapa
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like    270   1e-82   Glycine max [soybeans]
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b         270   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_004515238.1|  PREDICTED: putative phagocytic receptor 1b-like    269   2e-82   Cicer arietinum [garbanzo]
ref|XP_011463508.1|  PREDICTED: transmembrane 9 superfamily member 2    269   2e-82   Fragaria vesca subsp. vesca
gb|KJB08471.1|  hypothetical protein B456_001G083100                    268   2e-82   Gossypium raimondii
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b         269   2e-82   Malus domestica [apple tree]
ref|XP_009351612.1|  PREDICTED: putative phagocytic receptor 1b         269   2e-82   Pyrus x bretschneideri [bai li]
gb|KHG04463.1|  Putative phagocytic receptor 1b                         270   2e-82   Gossypium arboreum [tree cotton]
ref|XP_002305925.2|  endomembrane protein 70                            269   3e-82   Populus trichocarpa [western balsam poplar]
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g             269   3e-82   Phaseolus vulgaris [French bean]
ref|XP_008375035.1|  PREDICTED: putative phagocytic receptor 1b         269   3e-82   
ref|XP_007210263.1|  hypothetical protein PRUPE_ppa003204mg             268   5e-82   Prunus persica
ref|XP_007152616.1|  hypothetical protein PHAVU_004G145000g             268   6e-82   Phaseolus vulgaris [French bean]
ref|XP_008789222.1|  PREDICTED: putative phagocytic receptor 1b         268   6e-82   
gb|KJB08472.1|  hypothetical protein B456_001G083100                    268   7e-82   Gossypium raimondii
gb|KJB08470.1|  hypothetical protein B456_001G083100                    267   1e-81   Gossypium raimondii
emb|CDX84018.1|  BnaC08g16270D                                          267   1e-81   
ref|XP_006307070.1|  hypothetical protein CARUB_v10008657mg             267   1e-81   Capsella rubella
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like    267   1e-81   Glycine max [soybeans]
ref|XP_004299493.1|  PREDICTED: transmembrane 9 superfamily membe...    267   1e-81   Fragaria vesca subsp. vesca
gb|KHN24548.1|  Putative phagocytic receptor 1b                         267   1e-81   Glycine soja [wild soybean]
gb|KHN28892.1|  Putative phagocytic receptor 1b                         267   1e-81   Glycine soja [wild soybean]
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like    267   2e-81   Glycine max [soybeans]
ref|XP_012072398.1|  PREDICTED: transmembrane 9 superfamily membe...    266   2e-81   Jatropha curcas
ref|XP_008356702.1|  PREDICTED: transmembrane 9 superfamily membe...    262   2e-81   
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...    266   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010932502.1|  PREDICTED: transmembrane 9 superfamily membe...    266   3e-81   Elaeis guineensis
ref|XP_011654527.1|  PREDICTED: transmembrane 9 superfamily member 2    266   3e-81   Cucumis sativus [cucumbers]
gb|KFK43715.1|  hypothetical protein AALP_AA1G163400                    266   3e-81   Arabis alpina [alpine rockcress]
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b         266   4e-81   Camelina sativa [gold-of-pleasure]
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b         266   4e-81   Phoenix dactylifera
ref|XP_010105529.1|  Putative phagocytic receptor 1b                    266   4e-81   Morus notabilis
ref|XP_008389133.1|  PREDICTED: putative phagocytic receptor 1b         266   4e-81   
gb|KHG09925.1|  Putative phagocytic receptor 1b                         265   5e-81   Gossypium arboreum [tree cotton]
ref|XP_008466877.1|  PREDICTED: putative phagocytic receptor 1b         266   5e-81   Cucumis melo [Oriental melon]
ref|XP_006283389.1|  hypothetical protein CARUB_v10004434mg             265   6e-81   Capsella rubella
gb|AHA84153.1|  phagocytic receptor 1b                                  265   7e-81   Phaseolus vulgaris [French bean]
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...    264   2e-80   
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...    264   2e-80   
gb|ADQ43185.1|  endomemebrane protein 70                                264   2e-80   Schrenkiella parvula
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b         264   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...    263   3e-80   Elaeis guineensis
ref|XP_006448060.1|  hypothetical protein CICLE_v10014688mg             262   4e-80   
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b         263   5e-80   Brassica rapa
ref|XP_006448061.1|  hypothetical protein CICLE_v10014688mg             263   6e-80   Citrus clementina [clementine]
ref|XP_006431398.1|  hypothetical protein CICLE_v10000657mg             261   9e-80   
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like    262   1e-79   Cicer arietinum [garbanzo]
ref|XP_012072397.1|  PREDICTED: transmembrane 9 superfamily member 2    261   2e-79   Jatropha curcas
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg             261   2e-79   Citrus clementina [clementine]
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like    261   3e-79   Setaria italica
ref|XP_002521899.1|  transporter, putative                              260   5e-79   Ricinus communis
emb|CDY41095.1|  BnaC05g10860D                                          260   5e-79   Brassica napus [oilseed rape]
emb|CDP01681.1|  unnamed protein product                                260   6e-79   Coffea canephora [robusta coffee]
ref|XP_006854108.2|  PREDICTED: transmembrane 9 superfamily member 2    260   6e-79   Amborella trichopoda
ref|XP_010066537.1|  PREDICTED: putative phagocytic receptor 1b         260   7e-79   Eucalyptus grandis [rose gum]
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like    260   8e-79   Citrus sinensis [apfelsine]
gb|KHG20583.1|  Putative phagocytic receptor 1b                         259   1e-78   Gossypium arboreum [tree cotton]
gb|ERN15575.1|  hypothetical protein AMTR_s00048p00146310               260   2e-78   Amborella trichopoda
dbj|BAJ89640.1|  predicted protein                                      258   3e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001049492.1|  Os03g0237000                                       257   1e-77   
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b         256   2e-77   Nelumbo nucifera [Indian lotus]
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b         255   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...    254   7e-77   Elaeis guineensis
ref|XP_010920044.1|  PREDICTED: transmembrane 9 superfamily membe...    252   1e-76   
ref|XP_010920043.1|  PREDICTED: transmembrane 9 superfamily membe...    252   1e-76   
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b         254   1e-76   Phoenix dactylifera
ref|XP_010920042.1|  PREDICTED: transmembrane 9 superfamily membe...    252   6e-76   
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...    251   1e-75   
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b         250   3e-75   Brachypodium distachyon [annual false brome]
gb|AGT15903.1|  transmembrane 9 superfamily protein                     250   3e-75   Saccharum hybrid cultivar R570
ref|XP_009387842.1|  PREDICTED: putative phagocytic receptor 1b         250   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP05457.1|  unnamed protein product                                251   3e-75   Coffea canephora [robusta coffee]
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b         250   4e-75   Phoenix dactylifera
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b         250   4e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...    248   5e-75   
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...    250   5e-75   Elaeis guineensis
ref|XP_010099693.1|  Putative phagocytic receptor 1b                    251   5e-75   
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650          249   1e-74   Sorghum bicolor [broomcorn]
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b         249   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910474.1|  PREDICTED: transmembrane 9 superfamily membe...    248   1e-74   
gb|KJB43179.1|  hypothetical protein B456_007G188200                    249   1e-74   Gossypium raimondii
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...    248   2e-74   Elaeis guineensis
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...    248   3e-74   Zea mays [maize]
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...    248   3e-74   Zea mays [maize]
gb|KJB10378.1|  hypothetical protein B456_001G198000                    245   3e-74   Gossypium raimondii
ref|XP_008787888.1|  PREDICTED: putative phagocytic receptor 1b i...    246   4e-74   Phoenix dactylifera
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b         247   5e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008356712.1|  PREDICTED: putative phagocytic receptor 1b         238   8e-74   
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...    246   1e-73   Phoenix dactylifera
tpg|DAA44289.1|  TPA: hypothetical protein ZEAMMB73_547933              244   1e-73   
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...    246   1e-73   Nicotiana sylvestris
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b         245   3e-73   Phoenix dactylifera
ref|NP_001148980.1|  LOC100282600 precursor                             244   6e-73   Zea mays [maize]
ref|XP_010036999.1|  PREDICTED: putative phagocytic receptor 1b         244   6e-73   Eucalyptus grandis [rose gum]
ref|XP_002521900.1|  transporter, putative                              243   2e-72   Ricinus communis
ref|XP_010037000.1|  PREDICTED: putative phagocytic receptor 1b         242   3e-72   Eucalyptus grandis [rose gum]
ref|XP_004490795.1|  PREDICTED: putative phagocytic receptor 1b-like    241   1e-71   Cicer arietinum [garbanzo]
ref|XP_009628015.1|  PREDICTED: putative phagocytic receptor 1b i...    240   2e-71   Nicotiana tomentosiformis
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...    240   2e-71   Nicotiana tomentosiformis
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...    240   3e-71   Nicotiana sylvestris
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b         240   3e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388099.1|  PREDICTED: putative phagocytic receptor 1b         239   4e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007141945.1|  hypothetical protein PHAVU_008G239300g             239   4e-71   Phaseolus vulgaris [French bean]
ref|XP_006849485.2|  PREDICTED: transmembrane 9 superfamily member 2    239   5e-71   Amborella trichopoda
gb|ERN11066.1|  hypothetical protein AMTR_s00024p00115620               239   6e-71   Amborella trichopoda
ref|XP_003518365.2|  PREDICTED: putative phagocytic receptor 1b-l...    239   6e-71   Glycine max [soybeans]
gb|KHN41041.1|  Putative phagocytic receptor 1b                         239   6e-71   Glycine soja [wild soybean]
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...    238   2e-70   Zea mays [maize]
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b         238   2e-70   Brachypodium distachyon [annual false brome]
gb|EEC82941.1|  hypothetical protein OsI_27915                          238   2e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...    236   8e-70   Setaria italica
gb|ABK25212.1|  unknown                                                 229   9e-70   Picea sitchensis
ref|XP_006575472.1|  PREDICTED: putative phagocytic receptor 1b-l...    236   1e-69   Glycine max [soybeans]
gb|EPS73381.1|  hypothetical protein M569_01372                         235   2e-69   Genlisea aurea
gb|AES99151.2|  transmembrane 9 family protein                          235   2e-69   Medicago truncatula
ref|XP_003544357.1|  PREDICTED: putative phagocytic receptor 1b-like    235   2e-69   Glycine max [soybeans]
gb|EEE68090.1|  hypothetical protein OsJ_26137                          238   6e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008356706.1|  PREDICTED: transmembrane 9 superfamily membe...    229   6e-69   
ref|XP_003616193.1|  Transmembrane 9 superfamily protein member         236   6e-69   
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...    236   1e-68   
dbj|BAJ89513.1|  predicted protein                                      231   5e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS60954.1|  Putative phagocytic receptor 1b                         231   6e-68   Triticum urartu
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like    231   8e-68   Oryza brachyantha
gb|EMT19161.1|  Putative phagocytic receptor 1b                         230   1e-67   
gb|ABK24901.1|  unknown                                                 229   3e-67   Picea sitchensis
ref|XP_004240860.1|  PREDICTED: putative phagocytic receptor 1b i...    229   4e-67   
ref|XP_006358745.1|  PREDICTED: putative phagocytic receptor 1b-like    228   1e-66   
gb|ABR16201.1|  unknown                                                 224   2e-65   Picea sitchensis
ref|NP_001064040.1|  Os10g0112600                                       223   9e-65   
ref|XP_004228944.1|  PREDICTED: putative phagocytic receptor 1b         222   2e-64   Solanum lycopersicum
gb|AAK52585.1|AC079685_16  Putative endosomal protein                   223   2e-64   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66468.1|  hypothetical protein OsI_32547                          223   2e-64   Oryza sativa Indica Group [Indian rice]
gb|KHN39489.1|  Putative phagocytic receptor 1b                         220   6e-64   Glycine soja [wild soybean]
ref|XP_011003770.1|  PREDICTED: transmembrane 9 superfamily membe...    217   1e-62   Populus euphratica
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like    216   2e-62   Oryza brachyantha
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like    216   5e-62   Solanum tuberosum [potatoes]
ref|XP_007045412.1|  Endomembrane protein 70 protein family isofo...    208   5e-61   
gb|EPS73142.1|  hypothetical protein M569_01612                         211   6e-61   Genlisea aurea
emb|CDP05443.1|  unnamed protein product                                211   2e-60   Coffea canephora [robusta coffee]
emb|CDP05446.1|  unnamed protein product                                211   2e-60   Coffea canephora [robusta coffee]
ref|XP_002317710.2|  hypothetical protein POPTR_0012s03920g             210   7e-60   
ref|XP_006376703.1|  hypothetical protein POPTR_0012s03920g             210   1e-59   
dbj|BAC57816.1|  putative syntaxin SYP111                               209   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006849484.1|  PREDICTED: transmembrane 9 superfamily membe...    208   3e-59   Amborella trichopoda
emb|CDY03085.1|  BnaC07g21420D                                          206   7e-59   
ref|XP_001775546.1|  predicted protein                                  206   2e-58   
emb|CDY56297.1|  BnaC09g52300D                                          204   4e-58   Brassica napus [oilseed rape]
emb|CDP05449.1|  unnamed protein product                                197   6e-58   Coffea canephora [robusta coffee]
ref|XP_002892454.1|  endomembrane protein 70 family protein             203   2e-57   Arabidopsis lyrata subsp. lyrata
gb|AAF22904.1|AC006932_21  T27G7.5                                      201   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077489.1|  endomembrane protein 70                            201   9e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010261665.1|  PREDICTED: putative phagocytic receptor 1b         202   1e-56   Nelumbo nucifera [Indian lotus]
gb|EEC74833.1|  hypothetical protein OsI_10676                          206   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...    200   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_012077856.1|  PREDICTED: transmembrane 9 superfamily membe...    196   3e-56   
ref|XP_002523798.1|  transporter, putative                              198   3e-56   
ref|XP_007512838.1|  predicted protein                                  200   4e-56   Bathycoccus prasinos
ref|XP_001770691.1|  predicted protein                                  199   7e-56   
emb|CDX93569.1|  BnaA06g04790D                                          199   7e-56   
ref|XP_003059958.1|  predicted protein                                  199   1e-55   Micromonas pusilla CCMP1545
ref|XP_007208295.1|  hypothetical protein PRUPE_ppa003325mg             198   1e-55   
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg             198   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_009148094.1|  PREDICTED: putative phagocytic receptor 1b i...    197   2e-55   Brassica rapa
ref|XP_009148093.1|  PREDICTED: putative phagocytic receptor 1b i...    197   2e-55   Brassica rapa
ref|XP_005650990.1|  EMP/nonaspanin domain family protein               198   2e-55   Coccomyxa subellipsoidea C-169
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...    197   3e-55   Nicotiana sylvestris
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...    196   4e-55   Nicotiana sylvestris
ref|XP_009615619.1|  PREDICTED: putative phagocytic receptor 1b i...    196   6e-55   Nicotiana tomentosiformis
ref|XP_012077855.1|  PREDICTED: transmembrane 9 superfamily membe...    196   8e-55   Jatropha curcas
ref|XP_008228600.1|  PREDICTED: putative phagocytic receptor 1b         195   1e-54   Prunus mume [ume]
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                     194   4e-54   Eucalyptus grandis [rose gum]
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...    194   5e-54   Eucalyptus grandis [rose gum]
ref|XP_009615618.1|  PREDICTED: putative phagocytic receptor 1b i...    194   5e-54   
gb|KJB55631.1|  hypothetical protein B456_009G086000                    193   7e-54   Gossypium raimondii
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...    193   8e-54   
emb|CDX95066.1|  BnaC05g06050D                                          193   9e-54   
gb|KJB55630.1|  hypothetical protein B456_009G086000                    193   9e-54   Gossypium raimondii
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg             193   1e-53   Capsella rubella
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg             193   1e-53   Citrus clementina [clementine]
ref|XP_006487943.1|  PREDICTED: putative phagocytic receptor 1b-l...    192   2e-53   Citrus sinensis [apfelsine]
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...    192   2e-53   
emb|CEG02174.1|  Nonaspanin (TM9SF)                                     192   3e-53   Ostreococcus tauri
ref|XP_008382598.1|  PREDICTED: putative phagocytic receptor 1b         192   3e-53   
ref|XP_001699211.1|  EMP/nonaspanin domain family protein               192   3e-53   Chlamydomonas reinhardtii
ref|XP_006384818.1|  hypothetical protein POPTR_0004s21340g             192   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...    191   5e-53   
ref|XP_009350847.1|  PREDICTED: putative phagocytic receptor 1b         191   5e-53   
ref|XP_009343744.1|  PREDICTED: putative phagocytic receptor 1b         191   6e-53   
emb|CAN67239.1|  hypothetical protein VITISV_004804                     193   8e-53   Vitis vinifera
gb|KHG11801.1|  Putative phagocytic receptor 1b                         191   9e-53   Gossypium arboreum [tree cotton]
gb|KJB60873.1|  hypothetical protein B456_009G329300                    190   9e-53   Gossypium raimondii
gb|KHN21147.1|  Putative phagocytic receptor 1b                         190   1e-52   Glycine soja [wild soybean]
ref|XP_009592973.1|  PREDICTED: putative phagocytic receptor 1b         190   1e-52   Nicotiana tomentosiformis
emb|CDP06928.1|  unnamed protein product                                189   2e-52   Coffea canephora [robusta coffee]
ref|XP_011007160.1|  PREDICTED: transmembrane 9 superfamily member 5    189   3e-52   Populus euphratica
ref|XP_001422764.1|  predicted protein                                  189   4e-52   Ostreococcus lucimarinus CCE9901
ref|XP_010322438.1|  PREDICTED: putative phagocytic receptor 1b i...    187   5e-52   Solanum lycopersicum
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like    188   5e-52   
ref|XP_003540797.1|  PREDICTED: putative phagocytic receptor 1b-like    188   8e-52   
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5    188   9e-52   
ref|XP_010089827.1|  Putative phagocytic receptor 1b                    188   1e-51   
emb|CBI28324.3|  unnamed protein product                                188   1e-51   
ref|XP_004293072.1|  PREDICTED: transmembrane 9 superfamily member 5    187   1e-51   
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...    187   1e-51   
ref|XP_007015827.1|  Endomembrane protein 70 protein family isofo...    187   2e-51   
ref|XP_010045209.1|  PREDICTED: putative phagocytic receptor 1b         186   3e-51   
ref|XP_010271661.1|  PREDICTED: putative phagocytic receptor 1b         186   4e-51   
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118             186   6e-51   
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645             186   6e-51   
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg             184   8e-51   
ref|XP_009779343.1|  PREDICTED: putative phagocytic receptor 1b         186   8e-51   
ref|XP_011088887.1|  PREDICTED: transmembrane 9 superfamily membe...    185   1e-50   
ref|XP_010322125.1|  PREDICTED: putative phagocytic receptor 1b i...    183   3e-50   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    183   4e-50   
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941             183   5e-50   
ref|XP_010686009.1|  PREDICTED: transmembrane 9 superfamily membe...    182   8e-50   
ref|XP_002969094.1|  hypothetical protein SELMODRAFT_170330             182   1e-49   
gb|EMS68537.1|  Putative phagocytic receptor 1b                         181   1e-49   
ref|XP_004506179.1|  PREDICTED: putative phagocytic receptor 1b-like    182   2e-49   
gb|KGN64924.1|  hypothetical protein Csa_1G162600                       175   4e-49   
ref|XP_001783681.1|  predicted protein                                  180   6e-49   
ref|XP_002952428.1|  hypothetical protein VOLCADRAFT_75353              178   2e-48   
ref|XP_001689987.1|  EMP/nonaspanin domain family protein               179   3e-48   
gb|EYU26707.1|  hypothetical protein MIMGU_mgv1a002565mg                178   5e-48   
gb|KJB43178.1|  hypothetical protein B456_007G188200                    177   6e-48   
gb|KDO42648.1|  hypothetical protein CISIN_1g040008mg                   169   1e-47   
ref|XP_007132435.1|  hypothetical protein PHAVU_011G094100g             176   1e-47   
ref|XP_005650801.1|  putative endosomal protein                         176   2e-47   
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709              176   2e-47   
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022             175   4e-47   
ref|XP_004139482.1|  PREDICTED: transmembrane 9 superfamily membe...    175   4e-47   
ref|XP_009782694.1|  PREDICTED: putative phagocytic receptor 1b i...    174   7e-47   
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...    174   8e-47   
ref|XP_009628018.1|  PREDICTED: putative phagocytic receptor 1b i...    173   2e-46   
ref|XP_009615620.1|  PREDICTED: putative phagocytic receptor 1b i...    172   2e-46   
ref|XP_010039016.1|  PREDICTED: putative phagocytic receptor 1b         171   2e-45   
dbj|BAG99652.1|  unnamed protein product                                164   2e-45   
gb|KCW48636.1|  hypothetical protein EUGRSUZ_K02294                     168   6e-45   
ref|XP_003606114.1|  Transmembrane 9 superfamily member                 167   2e-44   
emb|CDP05453.1|  unnamed protein product                                163   6e-43   
ref|XP_001755694.1|  predicted protein                                  162   1e-42   
ref|XP_010271660.1|  PREDICTED: putative phagocytic receptor 1b         160   7e-42   
ref|XP_010105528.1|  Putative phagocytic receptor 1b                    158   8e-41   
gb|KIY96549.1|  Putative phagocytic receptor 1b                         155   9e-41   
gb|KDD75073.1|  endomembrane protein 70                                 154   1e-39   
ref|XP_006448059.1|  hypothetical protein CICLE_v10017699mg             151   1e-39   
gb|KDO58074.1|  hypothetical protein CISIN_1g036992mg                   152   3e-39   
gb|KDD72720.1|  endomembrane protein 70                                 146   1e-38   
ref|XP_011003771.1|  PREDICTED: transmembrane 9 superfamily membe...    150   3e-38   
ref|XP_008461519.1|  PREDICTED: putative phagocytic receptor 1b i...    149   4e-38   
gb|EFA76586.1|  TM9 protein B                                           149   1e-37   
ref|XP_011654422.1|  PREDICTED: transmembrane 9 superfamily membe...    148   1e-37   
ref|XP_011625258.1|  PREDICTED: transmembrane 9 superfamily membe...    145   9e-37   
ref|XP_787683.3|  PREDICTED: transmembrane 9 superfamily member 1       144   1e-36   
ref|XP_007255923.1|  PREDICTED: transmembrane 9 superfamily member 1    145   1e-36   
ref|XP_004352299.1|  TM9 protein B                                      146   3e-36   
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...    144   4e-36   
emb|CDP05442.1|  unnamed protein product                                142   4e-36   
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1    144   5e-36   
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1    144   5e-36   
ref|NP_001003550.1|  transmembrane 9 superfamily member 1               143   1e-35   
ref|XP_005824782.1|  hypothetical protein GUITHDRAFT_158562             142   2e-35   
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...    141   3e-35   
ref|XP_009043140.1|  hypothetical protein AURANDRAFT_72882              137   4e-35   
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    141   4e-35   
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1    141   5e-35   
ref|XP_010739917.1|  PREDICTED: transmembrane 9 superfamily membe...    140   1e-34   
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    139   2e-34   
ref|XP_003457937.2|  PREDICTED: transmembrane 9 superfamily membe...    139   2e-34   
ref|XP_009041654.1|  hypothetical protein AURANDRAFT_55500              138   4e-34   
dbj|BAJ87519.1|  predicted protein                                      138   4e-34   
emb|CDQ70386.1|  unnamed protein product                                138   5e-34   
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1    138   5e-34   
ref|XP_006809561.1|  PREDICTED: transmembrane 9 superfamily membe...    138   6e-34   
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                   138   6e-34   
ref|XP_008305730.1|  PREDICTED: transmembrane 9 superfamily member 1    138   6e-34   
ref|XP_010521658.1|  PREDICTED: putative phagocytic receptor 1b i...    137   6e-34   
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...    138   7e-34   
ref|XP_004575210.1|  PREDICTED: transmembrane 9 superfamily membe...    138   7e-34   
ref|XP_005754693.1|  PREDICTED: transmembrane 9 superfamily membe...    138   7e-34   
ref|XP_003226712.1|  PREDICTED: transmembrane 9 superfamily member 1    137   1e-33   
ref|XP_010475629.1|  PREDICTED: putative phagocytic receptor 1b i...    137   1e-33   
gb|KHG16990.1|  Transmembrane 9 superfamily member 3                    134   1e-33   
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...    137   1e-33   
ref|XP_003294418.1|  hypothetical protein DICPUDRAFT_59030              137   1e-33   
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...    137   1e-33   
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...    137   1e-33   
ref|XP_003967994.1|  PREDICTED: transmembrane 9 superfamily member 1    137   2e-33   
ref|XP_003802004.1|  PREDICTED: transmembrane 9 superfamily member 1    139   2e-33   
gb|KFO27482.1|  Importin-4                                              139   2e-33   
ref|XP_006883243.1|  PREDICTED: transmembrane 9 superfamily membe...    138   2e-33   
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1    138   3e-33   
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088             136   3e-33   
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1    136   3e-33   
ref|XP_008267651.1|  PREDICTED: transmembrane 9 superfamily membe...    138   4e-33   
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...    135   4e-33   
ref|XP_010994078.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    137   5e-33   
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...    135   5e-33   
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1    137   5e-33   
dbj|BAH13215.1|  unnamed protein product                                137   5e-33   
ref|XP_011733307.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    137   6e-33   
ref|XP_004584775.1|  PREDICTED: transmembrane 9 superfamily member 1    137   6e-33   
dbj|BAF84799.1|  unnamed protein product                                135   7e-33   
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...    135   7e-33   
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    135   7e-33   
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    135   7e-33   
ref|XP_006835458.1|  PREDICTED: charged multivesicular body prote...    137   7e-33   
ref|XP_012036327.1|  PREDICTED: transmembrane 9 superfamily membe...    137   8e-33   
dbj|BAJ96423.1|  predicted protein                                      135   8e-33   
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...    135   8e-33   
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...    135   8e-33   
dbj|BAJ86318.1|  predicted protein                                      135   8e-33   
gb|ELW69279.1|  Importin-4                                              138   8e-33   
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                    135   8e-33   
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1    135   8e-33   
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          135   9e-33   
ref|XP_004885399.1|  PREDICTED: transmembrane 9 superfamily membe...    135   9e-33   
ref|NP_001014842.1|  transmembrane 9 superfamily member 1 isoform...    134   9e-33   
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1    135   1e-32   
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3    134   1e-32   
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...    136   1e-32   
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_006172880.1|  PREDICTED: charged multivesicular body prote...    136   2e-32   
gb|ELK11218.1|  Importin-4                                              137   2e-32   
ref|XP_006217338.1|  PREDICTED: charged multivesicular body prote...    135   2e-32   
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...    135   2e-32   
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...    134   2e-32   
gb|KJB77693.1|  hypothetical protein B456_012G151500                    134   2e-32   
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_010333315.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_006487944.1|  PREDICTED: putative phagocytic receptor 1b-l...    133   2e-32   
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...    135   2e-32   
gb|EPY89936.1|  importin-4                                              137   2e-32   
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|XP_006835459.1|  PREDICTED: charged multivesicular body prote...    134   2e-32   
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor     134   2e-32   
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...    133   2e-32   
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|XP_004661882.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|XP_009004051.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...    134   2e-32   
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor     134   2e-32   
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...    134   2e-32   
ref|NP_001267415.1|  transmembrane 9 superfamily member 1 precursor     134   2e-32   
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1    133   2e-32   
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1    134   2e-32   
gb|AAC51782.1|  multispanning membrane protein                          134   2e-32   
ref|XP_004463432.1|  PREDICTED: transmembrane 9 superfamily membe...    135   3e-32   
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...    134   3e-32   
gb|KJB77692.1|  hypothetical protein B456_012G151500                    133   3e-32   
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    135   3e-32   
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1    133   3e-32   
ref|XP_006519680.1|  PREDICTED: transmembrane 9 superfamily membe...    132   3e-32   
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    133   3e-32   
ref|XP_010066535.1|  PREDICTED: putative phagocytic receptor 1b i...    133   3e-32   
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...    133   3e-32   
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1    133   3e-32   
ref|NP_001012155.1|  transmembrane 9 superfamily member 1 precursor     133   3e-32   
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...    134   3e-32   
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...    133   3e-32   
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...    134   3e-32   
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...    133   3e-32   
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...    133   3e-32   
emb|CDY03772.1|  BnaC01g28890D                                          133   3e-32   
ref|XP_007447941.1|  PREDICTED: transmembrane 9 superfamily membe...    134   3e-32   
ref|XP_006252052.1|  PREDICTED: transmembrane 9 superfamily membe...    133   3e-32   
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...    133   3e-32   
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...    134   3e-32   
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor     133   3e-32   
dbj|GAM27660.1|  hypothetical protein SAMD00019534_108360               133   3e-32   
gb|KDO50082.1|  hypothetical protein CISIN_1g012251mg                   132   4e-32   
ref|XP_006519679.1|  PREDICTED: transmembrane 9 superfamily membe...    132   4e-32   
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1    133   4e-32   
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...    133   4e-32   
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...    133   4e-32   
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg             133   4e-32   
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...    133   4e-32   
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...    133   4e-32   
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1    133   4e-32   
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...    133   4e-32   
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...    133   5e-32   
ref|XP_011243511.1|  PREDICTED: transmembrane 9 superfamily membe...    132   5e-32   
ref|XP_012071292.1|  PREDICTED: transmembrane 9 superfamily member 1    132   5e-32   
ref|XP_006739631.1|  PREDICTED: transmembrane 9 superfamily membe...    132   5e-32   
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...    133   5e-32   
ref|NP_001065897.1|  Os11g0181100                                       132   5e-32   
ref|XP_004463434.1|  PREDICTED: transmembrane 9 superfamily membe...    132   6e-32   
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...    132   6e-32   
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1    132   7e-32   
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...    132   7e-32   
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...    132   7e-32   
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              132   7e-32   
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...    132   7e-32   
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...    132   8e-32   
ref|XP_004463433.1|  PREDICTED: transmembrane 9 superfamily membe...    132   8e-32   
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...    132   9e-32   
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1    132   9e-32   
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1    132   9e-32   
emb|CDY34861.1|  BnaA09g47870D                                          132   1e-31   
ref|NP_001066292.1|  Os12g0175700                                       132   1e-31   
ref|XP_011088888.1|  PREDICTED: transmembrane 9 superfamily membe...    131   1e-31   
emb|CDY46193.1|  BnaA01g23150D                                          132   1e-31   
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...    131   1e-31   
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...    132   1e-31   
ref|XP_008156681.1|  PREDICTED: transmembrane 9 superfamily membe...    132   1e-31   
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...    132   1e-31   



>ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PVRSDGSDHKYKAGD VPLYANKVGPFHNPSETYR+FDLPFC  D VKEKKEALGEVLNG
Sbjct  22   PVRSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPDHVKEKKEALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDFMYDKDSE VCKKKLS++EVAQFR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  82   DRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVAQFRSAVAKDYYFQMYYDDLPIWGFLGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GKSDPSE+KYYLFKHLHFEIFYN DRVIEINARTDP+A
Sbjct  142  DKEGKSDPSEYKYYLFKHLHFEIFYNNDRVIEINARTDPNA  182



>ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=594

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PVRSDGSDHKYKAGD VPLYANKVGPFHNPSETYR+FDLPFC    VKEKKEALGEVLNG
Sbjct  23   PVRSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPAHVKEKKEALGEVLNG  82

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDFMYDKDSE VCKKKLS++EVAQFR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  83   DRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVAQFRSAVAKDYYFQMYYDDLPIWGFLGKV  142

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GKSDPSE+KYYLFKHLHFEIFYN DRVIEINARTDP+A
Sbjct  143  DKEGKSDPSEYKYYLFKHLHFEIFYNNDRVIEINARTDPNA  183



>ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=598

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            P RSDGSDHKYK+GD VPLYANKVGPFHNPSETYR+FDLPFC  D VKEKKEALGEVLNG
Sbjct  27   PARSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCTPDHVKEKKEALGEVLNG  86

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDF+YDKDSE VCKKKLS++EV+QFR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  87   DRLVSAPYKLDFLYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKV  146

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GKSDPSE+KYYLFKHLHFEIFYN DRVIEINARTDP+A
Sbjct  147  DKEGKSDPSEYKYYLFKHLHFEIFYNDDRVIEINARTDPNA  187



>ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=598

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            P RSDGSDHKYK+GD VPLYANKVGPFHNPSETYR+FDLPFC  D VKEKKEALGEVLNG
Sbjct  27   PARSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCTPDHVKEKKEALGEVLNG  86

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDF+YDKDSE VCKKKLS++EV+QFR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  87   DRLVSAPYKLDFLYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKV  146

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GKSDPSE+KYYLFKHLHFEIFYN DRVIEINARTDP+A
Sbjct  147  DKEGKSDPSEYKYYLFKHLHFEIFYNDDRVIEINARTDPNA  187



>ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=593

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            P RSDGSDHKYKAGD+VPLYANKVGPFHNPSETYR+FDLPFC    VKEKKEALGEVLNG
Sbjct  22   PARSDGSDHKYKAGDSVPLYANKVGPFHNPSETYRFFDLPFCAPAHVKEKKEALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDFMYDKDSE VCKKKLS++EV+QFR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  82   DRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             KDGKSDP E+KYYLFKHLHFEIFYN DRV+EINARTDP+A
Sbjct  142  GKDGKSDPIEYKYYLFKHLHFEIFYNNDRVVEINARTDPNA  182



>ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            P RSDGSDHKYKAGD VPLYANKVGPFHNPSETYR+FDLPFC     KEKKEALGEVLNG
Sbjct  22   PARSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPAHAKEKKEALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDFMYDKDSE VCKKKLS++EV+QFR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  82   DRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DKDGKSDPSE+KYYLFKHLHFEIFYN D V+EINARTDP+A
Sbjct  142  DKDGKSDPSEYKYYLFKHLHFEIFYNNDHVVEINARTDPNA  182



>ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
Length=592

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDHKYK GDAVPLYANKVGPFHNPSETYRYFDLPFC   DVK+K EALGEVLNGD
Sbjct  22   VRSDASDHKYKIGDAVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ DK+SE +CKKKLS KEVA+FR AV+KDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVSAPYKLDFLVDKESEVICKKKLSVKEVAEFRSAVAKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KYYLFKHLHFEIFYNKDRVIEINARTDP+A
Sbjct  142  KEGKTDPSEYKYYLFKHLHFEIFYNKDRVIEINARTDPNA  181



>ref|XP_006365862.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=588

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            P RSDGSDHKYKAGD V +YANKVGPFHNPSETYR+FDLPFC    V EKKEALGEVLNG
Sbjct  17   PARSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCAPAHVTEKKEALGEVLNG  76

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDFMYDKDSE VCKKKLS++EV+QFR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  77   DRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKV  136

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GK+DPS++KYYLFKHLHFEIFYN DRV+EINARTDP+A
Sbjct  137  DKEGKTDPSKYKYYLFKHLHFEIFYNNDRVVEINARTDPNA  177



>ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=597

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            P RSDGSDHKYKAGD V +YANKVGPFHNPSETYR+FDLPFC    V EKKEALGEVLNG
Sbjct  26   PARSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCAPAHVTEKKEALGEVLNG  85

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDFMYDKDSE VCKKKLS++EV+ FR AV+KDYYFQMYYDDLPIWGFLGKV
Sbjct  86   DRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVSLFRNAVAKDYYFQMYYDDLPIWGFLGKV  145

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GK+DPSE+KYYLFKHLHFEIFYN DRV+EINARTDP+A
Sbjct  146  DKEGKTDPSEYKYYLFKHLHFEIFYNNDRVVEINARTDPNA  186



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            RSDGSDHKYK GD VPLYANKVGPFHNPSETYRYFDLPFC   DVK+K EALGEVLNGDR
Sbjct  23   RSDGSDHKYKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGDR  82

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LVSAPYKLDF+ D++SE +CKK+LS++EVA FR AV+KDYYFQMYYDDLPIWGFLGKVDK
Sbjct  83   LVSAPYKLDFLADRESEVICKKQLSKEEVAVFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  142

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            +GK+DPSE+KYYLFKHLHFEIFYNKDRVIEINARTDPSA
Sbjct  143  EGKADPSEYKYYLFKHLHFEIFYNKDRVIEINARTDPSA  181



>ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis 
melo]
Length=591

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 152/161 (94%), Gaps = 1/161 (1%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PVRSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ DDVKEKKEALGEVLNG
Sbjct  21   PVRSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKKEALGEVLNG  80

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDF+ +KDS SVC+KKLS+++VA+FR AV KDYYFQMYYDDLPIWGF+GKV
Sbjct  81   DRLVSAPYKLDFLQEKDSSSVCQKKLSKEDVARFRAAVDKDYYFQMYYDDLPIWGFIGKV  140

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GK DPS+FKYYL+KH+HF+IFYNKDRVIEIN RTDP+A
Sbjct  141  DKEGK-DPSDFKYYLYKHIHFDIFYNKDRVIEINVRTDPNA  180



>ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score =   288 bits (737),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YKAG+AVPLYANKVGPFHNPSETYRYFDLPFC  D VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCAPDHVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ DKDSE +CKKK+S++EV +FR+AVSKDYYFQMYYDDLPIWGFLGK D
Sbjct  82   RLVSAPYKLDFLVDKDSELICKKKMSKEEVVKFRDAVSKDYYFQMYYDDLPIWGFLGKAD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE+K+YL+KH+HF+IFYNKDRVIEIN R DP++
Sbjct  142  KEGKLDPSEYKFYLYKHIHFDIFYNKDRVIEINVRMDPNS  181



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YKAGD VPLYANKVGPFHNPSETYRYFDLPFC    V EKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGHVTEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ DKDSE VC+KKL+++EVAQFR+AVSKDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLDFLSDKDSELVCRKKLTKEEVAQFRKAVSKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KY+L+KH+HF+I YNKDRVIEIN RTDP+A
Sbjct  142  KEGKADPSEYKYFLYKHIHFDILYNKDRVIEINVRTDPNA  181



>gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata]
Length=592

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDHK+K GD VPLYANKVGPFHNPSETYRYFDLPFC   +VK+K EALGEVLNGD
Sbjct  22   VRSDASDHKFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGNVKDKSEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ DK+SE +CKK LS++EVA FR AV+KDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVSAPYKLDFLADKESEVICKKHLSKEEVAVFRSAVAKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KY+LFKHLHFEIFYNKDRVIEINARTDP+A
Sbjct  142  KEGKADPSEYKYHLFKHLHFEIFYNKDRVIEINARTDPNA  181



>ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YKAG+AVPLYANKVGPFHNPSETYRYFDLPFC+ D VKEK+EALGEVLNGD
Sbjct  23   VRSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCIPDHVKEKREALGEVLNGD  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ DKDSE++CKK L ++E A+FR+AV+KDYYFQMYYDDLPIWGFLGKVD
Sbjct  83   RLVSAPYKLDFLVDKDSEAICKKTLKKEEAAKFRDAVAKDYYFQMYYDDLPIWGFLGKVD  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPS++KYYL+KH+HF+++YNKDRVIEIN RTDP++
Sbjct  143  KEGKLDPSDYKYYLYKHIHFDVYYNKDRVIEINVRTDPNS  182



>ref|XP_004137376.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis sativus]
 gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus]
Length=591

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PVRSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ DDVKEK+EALGEVLNG
Sbjct  21   PVRSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKREALGEVLNG  80

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDF+ +KDS SVC+KKLS+++V +FR AV KDYYFQMYYDDLPIWGF+GKV
Sbjct  81   DRLVSAPYKLDFLQEKDSSSVCQKKLSKEDVGRFRAAVDKDYYFQMYYDDLPIWGFIGKV  140

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GK DPS+FKYYL+KH+HF+IFYNKDRVIEIN RTDP+A
Sbjct  141  DKEGK-DPSDFKYYLYKHIHFDIFYNKDRVIEINVRTDPNA  180



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            P RSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+   +KEKKEALGEVLNG
Sbjct  20   PARSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCIPAHLKEKKEALGEVLNG  79

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKLDFM DK+SE +CKKKLS++EVAQFR AV KDYYFQMYYDDLPIWGF+GKV
Sbjct  80   DRLVSAPYKLDFMKDKESEVICKKKLSKEEVAQFRSAVIKDYYFQMYYDDLPIWGFIGKV  139

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DK+GK DPSE+KY+L+KH+HF+IFYNKDRVIEIN RTDP+A
Sbjct  140  DKEGK-DPSEYKYFLYKHIHFDIFYNKDRVIEINVRTDPNA  179



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YKAGD VPLYANKVGPFHNPSETYRYFDLPFC    V EKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCSPAHVTEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ +KDSE VCKKKLS  EVAQFR+AV  DYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLDFLSEKDSELVCKKKLSTGEVAQFRKAVINDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KY+L+KH+HF+I YNKDRVIEIN RTDP+A
Sbjct  142  KEGKTDPSEYKYFLYKHIHFDILYNKDRVIEINVRTDPNA  181



>ref|XP_002285238.1| PREDICTED: transmembrane 9 superfamily member 2 [Vitis vinifera]
 emb|CBI26762.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S H+YKAG+AVPLYANKVGPFHNPSETYRYFDLPFC+   +KEKKEALGEVLNGD
Sbjct  21   VRSDASSHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCVPAHLKEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ +KDSE VCKKKL ++EVAQFR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  81   RLVSAPYKLDFLREKDSEVVCKKKLKKEEVAQFRAAVAKDYYFQMYYDDLPIWGFIGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ F+I YNKDRVIEINARTDP
Sbjct  141  KEGKADPSEYKYFLYKHIQFDIRYNKDRVIEINARTDP  178



>emb|CDP01680.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDHKYK  D VPLYANKVGPFHNPSETYRYFDLPFCL   VKEKKEALGEVLNGD
Sbjct  24   VRSDASDHKYKVSDQVPLYANKVGPFHNPSETYRYFDLPFCLPAQVKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY L+F++DK+SE VCKKKLS++EVAQFR AVSKDYYF+MYYDDLP+WGFLGKV+
Sbjct  84   RLVVAPYNLEFLHDKESEVVCKKKLSKEEVAQFRNAVSKDYYFEMYYDDLPLWGFLGKVE  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K GK+DPSE+KYYLFK++HFEI Y KDRVIEINARTDP +
Sbjct  144  KTGKTDPSEYKYYLFKNIHFEILYKKDRVIEINARTDPGS  183



>gb|AAF79216.1|AC006917_1 F10B6.2 [Arabidopsis thaliana]
Length=260

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+SE  C KKLS++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            KD KSDPSEFKY+L+KH+ FEI YNKDRVIEI+AR DP +
Sbjct  142  KDIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHS  181



>ref|XP_008462539.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Cucumis 
melo]
Length=601

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 150/160 (94%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            + SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ DDVKEKKEALGEVLNGD
Sbjct  32   LLSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKKEALGEVLNGD  91

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ +KDS SVC+KKLS+++VA+FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  92   RLVSAPYKLDFLQEKDSSSVCQKKLSKEDVARFRAAVDKDYYFQMYYDDLPIWGFIGKVD  151

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPS+FKYYL+KH+HF+IFYNKDRVIEIN RTDP+A
Sbjct  152  KEGK-DPSDFKYYLYKHIHFDIFYNKDRVIEINVRTDPNA  190



>ref|XP_011011376.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=542

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  CK  L++++VAQFREAVSKDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+GK+DPSE+KYYLFKHLHF IFYNKDRVIEI+A++D
Sbjct  142  KEGKNDPSEYKYYLFKHLHFTIFYNKDRVIEISAQSD  178



>gb|EPS59962.1| hypothetical protein M569_14842, partial [Genlisea aurea]
Length=510

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S+H+Y  GD VPLYANKVGPFHNPSETYRYFDLPFC   DVK+K EALGEVLNGD
Sbjct  12   VRSDASNHRYNQGDTVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGD  71

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ D++SE +CKKKLS+ EV  FR AV+KDYYFQMYYDDLPIWGFLGKV 
Sbjct  72   RLVSAPYKLDFLVDRESEVICKKKLSKTEVTVFRNAVAKDYYFQMYYDDLPIWGFLGKVY  131

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+ K+DPS++KYYLFKHLHFEI YNKDRVIEINARTDP+A
Sbjct  132  KEDKTDPSDYKYYLFKHLHFEISYNKDRVIEINARTDPNA  171



>ref|XP_010528590.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=595

 Score =   278 bits (711),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+Y+AGD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNGD
Sbjct  25   VRSDGSDHRYRAGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGD  84

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+ DKDSE  CKK+L+++EV+QFREA+SKDYYFQMYYDDLPIWGFLGKVD
Sbjct  85   RLVSAPYKLEFLGDKDSEVACKKRLNREEVSQFREAISKDYYFQMYYDDLPIWGFLGKVD  144

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            ++ K++PSE++YYLF HL FEIFYNKDRVIEI  RTD ++
Sbjct  145  RERKTNPSEYRYYLFNHLQFEIFYNKDRVIEIIVRTDQNS  184



>ref|XP_011085893.1| PREDICTED: transmembrane 9 superfamily member 2-like [Sesamum 
indicum]
Length=587

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  264  SDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSA  443
            SDH +KAGD VPLYANKVGPFHNPSETYRYFDLPFC    +KEKKEALGEVLNGDRLVSA
Sbjct  22   SDHTFKAGDPVPLYANKVGPFHNPSETYRYFDLPFCFPAHMKEKKEALGEVLNGDRLVSA  81

Query  444  PYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKS  623
            PY LDF+ DK SE VC KKL + EVAQFR AV+KDYYFQMY+DDLPIWGFLGKV+K+ KS
Sbjct  82   PYTLDFLQDKSSEVVCNKKLDKNEVAQFRSAVAKDYYFQMYFDDLPIWGFLGKVEKEEKS  141

Query  624  DPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DPSE+KYYLFKHLHFEIFYNKDRVIEINARTDP+A
Sbjct  142  DPSEYKYYLFKHLHFEIFYNKDRVIEINARTDPNA  176



>ref|XP_011038406.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=592

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  CK  L++++VAQFREAVSKDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+GK+DPSE+KYYLFKHLHF IFYNKDRVIEI+A++D
Sbjct  142  KEGKNDPSEYKYYLFKHLHFTIFYNKDRVIEISAQSD  178



>ref|XP_004250237.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
 ref|XP_010312729.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=596

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDHKYK+G+ VPLYANKVGPFHNPSETYRYFDLPFC    VK+K EALGEVLNGD
Sbjct  26   VRSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGD  85

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF  D+++E VCKK LS++EVA+FR+AV+KDYYFQM+YDDLPIWGF+GKVD
Sbjct  86   RLVTAPYKLDFTNDRETEVVCKKTLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVD  145

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KYYLFKHLHF+I +NKDRVIE+NARTDP+A
Sbjct  146  KEGKADPSEYKYYLFKHLHFDIHHNKDRVIEVNARTDPNA  185



>ref|XP_006352389.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352390.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDHKYK+G+ VPLYANKVGPFHNPSETYRYFDLPFC    VK+K EALGEVLNGD
Sbjct  26   VRSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGD  85

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF  D+++E VCKK LS++EVA+FR+AV+KDYYFQM+YDDLPIWGF+GKVD
Sbjct  86   RLVTAPYKLDFTNDRETEVVCKKTLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVD  145

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KYYLFKHLHF+I +NKDRVIE+NARTDP+A
Sbjct  146  KEGKADPSEYKYYLFKHLHFDIHHNKDRVIEVNARTDPNA  185



>emb|CDY62621.1| BnaC08g46810D [Brassica napus]
Length=592

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  21   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  80

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLV+APYKL+F+ +K+S+  C+K+LS+++VAQFR+ +SKDYYFQMYYDDLPIWGFLGKV
Sbjct  81   DRLVTAPYKLEFLGEKNSQVACRKRLSREDVAQFRDVISKDYYFQMYYDDLPIWGFLGKV  140

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             KDGKSDPSE+KYYLF HL FEIFYNKDRVIEI  RTD S
Sbjct  141  VKDGKSDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQS  180



>ref|XP_009108077.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=592

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  21   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  80

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLV+APYKL+F+ +K+S   C+K+LS+++VAQFR+ +S+DYYFQMYYDDLPIWGFLGKV
Sbjct  81   DRLVTAPYKLEFLGEKNSHVACRKRLSREDVAQFRDVISRDYYFQMYYDDLPIWGFLGKV  140

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             KDGKSDPSEFKYYLF HL FEIFYNKDRVIEI  RTD S
Sbjct  141  VKDGKSDPSEFKYYLFNHLQFEIFYNKDRVIEIIVRTDQS  180



>ref|XP_011038404.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
 ref|XP_011038405.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
Length=592

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK G+ VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  C+K+L++++VAQFRE VSKDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+GK+DPSE+KYYLFKHLHF IFYNKDRVIEI A++D
Sbjct  142  KEGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITAQSD  178



>emb|CDY47549.1| BnaA08g07380D [Brassica napus]
Length=592

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV+SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  21   PVKSDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  80

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLV+APYKL+F+ +K+S   C+K+LS+++VAQFR+ +S+DYYFQMYYDDLPIWGFLGKV
Sbjct  81   DRLVTAPYKLEFLGEKNSHVACRKRLSREDVAQFRDVISRDYYFQMYYDDLPIWGFLGKV  140

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             KDGKSDPSE+KYYLF HL FEIFYNKDRVIEI  RTD S
Sbjct  141  VKDGKSDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQS  180



>ref|XP_009785097.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=596

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDHKYK G+ VPLYANKVGPFHNPSETYRYFDLPFC    VK+K EALGEVLNGD
Sbjct  26   VRSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGD  85

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ D+++E VCKK LS++EVA+FR+AV+KDYYFQM+YDDLPIWGF+GKVD
Sbjct  86   RLVTAPYKLDFLSDRETEVVCKKSLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVD  145

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GKSDP+E+KYYLFKHLHF+I +N DRVIE+NARTDP+A
Sbjct  146  KEGKSDPNEYKYYLFKHLHFDIHFNNDRVIEVNARTDPNA  185



>ref|XP_006395825.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
 gb|ACQ90591.1| putative transmembrane transporter [Eutrema halophilum]
 gb|ESQ33111.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
Length=592

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEIYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  179



>ref|XP_010554368.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=592

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ D VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  C+KKLS+ +V QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFGEEKDSEVYCRKKLSKDDVKQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSEFKY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KEGKADPSEFKYFLYKHIQFEILYNKDRVIEISARMDP  179



>gb|KFK33411.1| hypothetical protein AALP_AA5G009400 [Arabis alpina]
Length=592

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK G+ VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGETVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSERYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  179



>ref|XP_006372420.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50217.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=526

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK G+ VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  C+K+L++++VAQFRE VSKDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+ K+DPSE+KYYLFKHLHF IFYNKDRVIEI A++D
Sbjct  142  KERKNDPSEYKYYLFKHLHFTIFYNKDRVIEITAQSD  178



>ref|XP_007031333.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY02259.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=561

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YKAG  VPLYANKVGPFHNPSETYRYFD PFC +  VKEK EALGEVLNGD
Sbjct  22   VRSSASDHRYKAGAEVPLYANKVGPFHNPSETYRYFDFPFCSSTPVKEKNEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF+ DK++E  CKKKL+++EVA+FR AVSKDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVSAPYKLDFLNDKEAEIACKKKLTKEEVAKFRSAVSKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE+KYYLFKHL FEI YNKDRVIEI  ++DP+A
Sbjct  142  KEGKVDPSEYKYYLFKHLIFEILYNKDRVIEITVQSDPNA  181



>ref|XP_011005915.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005916.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S+H+YK GD VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGE+LNGD
Sbjct  22   VRSDASNHRYKVGDGVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  CK KL++++VAQFREAVSKDYYFQMYYDDLPIWGF+GKV+
Sbjct  82   RLVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFIGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+GK+DPSE+KYYLFKHLHF IFYNKDRVIEI A +D
Sbjct  142  KEGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITALSD  178



>emb|CDY15803.1| BnaC02g34220D [Brassica napus]
Length=592

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEA GEVLNGD
Sbjct  22   VRSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKDKKEAFGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL F  +KDSE+ CKKKLS+KEV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLSFRDEKDSETYCKKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YN DRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNNDRVIEINARMDP  179



>gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana]
Length=546

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+SE  C KKLS++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSEFKY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KDIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDP  179



>ref|XP_006405901.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 ref|XP_006405902.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47354.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47355.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
Length=595

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  24   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  83

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+ +K+SE  C+K+LS+++VA+FR+ ++KDYYFQMYYDDLPIWGFLGKV
Sbjct  84   DRLVSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVITKDYYFQMYYDDLPIWGFLGKV  143

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             KDGKSDPSE+KYYLF HL FEIFYNKDRVIEI  RTD
Sbjct  144  VKDGKSDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTD  181



>ref|XP_002876790.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53049.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ D VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCIPDGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS+  C+KKLS+++V QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFREEKDSDVYCRKKLSREQVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  179



>ref|XP_006292411.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
 gb|EOA25309.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
Length=592

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK  D+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  C+KKLS+KEV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  179



>ref|XP_010502204.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK  D+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  C+KKLS+KEV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  179



>ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9ZPS7.1|TMN3_ARATH RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=Endomembrane protein 9; AltName: Full=Transmembrane nine 
protein 3; Short=AtTMN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana]
 dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV  FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEVYCKKKLSREEVEHFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  179



>ref|XP_010513951.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
 ref|XP_010424990.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK  D+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  C+KKLS+KEV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  142  KESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  179



>ref|XP_010527833.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=593

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ D VKEKKEALGEVLNGD
Sbjct  23   VRSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGD  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  C KKLS+ EV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  83   RLVSAPYKLNFREEKDSEVYCSKKLSKDEVKQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSEFKY+L+KH+ FEI YNK RVIEI+AR DP
Sbjct  143  KEGKADPSEFKYFLYKHIQFEILYNKYRVIEISARMDP  180



>ref|XP_008220963.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=591

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+Y  GDAVPLYANKVGPFHNPSETYRYFDLPFC   DVKEK+EALGEVLNGD
Sbjct  21   VRSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KD+E  C++KL+++EVAQFR AV KDYYFQMYYDDLPIWGFLGKVD
Sbjct  81   RLVSAPYKLEFRKEKDTEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ FE+ YNKDRVIEI A+ DP
Sbjct  141  KEGKTDPSEYKYFLYKHIQFEVMYNKDRVIEIGAKMDP  178



>ref|XP_007225615.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
 gb|EMJ26814.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
Length=591

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+Y  GDAVPLYANKVGPFHNPSETYRYFDLPFC   DVKEK+EALGEVLNGD
Sbjct  21   VRSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KD+E  C++KL+++EVAQFR AV KDYYFQMYYDDLPIWGFLGKVD
Sbjct  81   RLVSAPYKLEFRKEKDTEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ FE+ YNKDRVIEI A+ DP
Sbjct  141  KEGKTDPSEYKYFLYKHIQFEVMYNKDRVIEIGAKMDP  178



>gb|KHG03505.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            RS  SDH+Y AGD VPLYANKVGPFHNPSETYR+FD PFC +  VKEKKEALGEVLNGDR
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRFFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LVSAPY+LDF+ +K++E  CK+KL+++EVA+FR AVSKDYYFQMYYDDLPIWGFLGKVDK
Sbjct  83   LVSAPYRLDFLGNKEAEVACKRKLTKEEVAKFRTAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            +GK+DPSE+KYYLFKHL FEI YNKDRVIEI  R+DP+A
Sbjct  143  EGKADPSEYKYYLFKHLIFEILYNKDRVIEITVRSDPNA  181



>ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q940S0.1|TMN2_ARATH RecName: Full=Transmembrane 9 superfamily member 2; AltName: 
Full=Endomembrane protein 8; AltName: Full=Transmembrane nine 
protein 2; Short=AtTMN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana]
 gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana]
 gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+SE  C KKLS++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSEFKY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KDIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDP  179



>ref|XP_006416990.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
 gb|ESQ35343.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
Length=592

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+SE  CKKKLS++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKESEVYCKKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSE+KY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KDIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDP  179



>ref|XP_009355975.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=593

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEK+EALGEVLNGD
Sbjct  24   VRSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKREALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+  KD+E  CKK L+++EVA+FR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLEFLRHKDTEVACKKTLTKEEVARFRSAVNKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE+K YL+KH+HF+++YNKDRVIE+N RTDP+A
Sbjct  144  KEGK-DPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNA  182



>ref|XP_006372421.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50218.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=592

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK G+ VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  C+K+L++++VAQFRE VSKDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+ K+DPSE+KYYLFKHLHF IFYNKDRVIEI A++D
Sbjct  142  KERKNDPSEYKYYLFKHLHFTIFYNKDRVIEITAQSD  178



>ref|NP_198547.3| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9FHT4.1|TMN4_ARATH RecName: Full=Transmembrane 9 superfamily member 4; AltName: 
Full=Endomembrane protein 10; AltName: Full=Transmembrane nine 
protein 4; Short=AtTMN4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09103.1| endosomal protein-like [Arabidopsis thaliana]
 dbj|BAE99006.1| multispanning membrane protein - like [Arabidopsis thaliana]
 gb|AED94164.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=593

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  22   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+ +K+SE  C+K+LS+++VA+FR+ ++KDYYFQMYYDDLPIWGFLGKV
Sbjct  82   DRLVSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVIAKDYYFQMYYDDLPIWGFLGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             K+GK+DPSE+KYYLF HL FEIFYNKDRVIEI  RTD
Sbjct  142  VKEGKTDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTD  179



>ref|XP_006384123.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
 gb|ERP61920.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
Length=592

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S ++YK GD VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGE+LNGD
Sbjct  22   VRSDASTNRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  CK KL++++VAQFREAVSKDYYFQMYYDDLPIWGF+GKV+
Sbjct  82   RLVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFIGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KYYLFKHLHF IFYNKDRVIEI A +DP
Sbjct  142  KEGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITALSDP  179



>emb|CDY52038.1| BnaA08g31510D [Brassica napus]
Length=480

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  19   VRSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV +FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSE+KY+L+KH+ FEI YN DRVIEI+AR DP
Sbjct  139  KEIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDP  176



>ref|XP_002870515.1| transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46774.1| transporter [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  22   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+ +K+SE  C+K+LS+++VA+FR+ ++KDYYFQMYYDDLPIWGFLGKV
Sbjct  82   DRLVSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVIAKDYYFQMYYDDLPIWGFLGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             K+GK+DPSE+KYYLF HL FEIFYNKDRVIEI  RTD
Sbjct  142  FKEGKTDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTD  179



>gb|KJB15311.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=540

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEKKEALGEVLNGD
Sbjct  24   VRSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS  VCKKKLS+ EV  FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KYYL+KH+ F++ YNKDRVIEI+AR DP
Sbjct  144  KEGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDP  181



>gb|KHG00678.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=528

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GDAVPLYANKVGPFHNPSETYRYFDLPFC  D V EK+EALGEVLNGD
Sbjct  24   VRSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS  VCKK+LS+ EVA FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLNFKEEKDSSVVCKKQLSKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+LFKH+ F++ YNKDRVIE+NAR DP
Sbjct  144  KEGKTDPSEYKYFLFKHIQFDVLYNKDRVIEVNARMDP  181



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            +RSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ D VKEKKEALGEVLNGD
Sbjct  21   IRSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHVKEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY+L+F  +K SE VC+KKLS+++VA FR A+ KDYYFQMYYDDLPIWGF+GKVD
Sbjct  81   RLVSAPYQLNFRDEKSSEGVCRKKLSKEDVAHFRSAIDKDYYFQMYYDDLPIWGFIGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            KDGK+DPSE+KY+L+KH+ F++ YNKDRVIE++ R DP A
Sbjct  141  KDGKTDPSEYKYFLYKHIQFDVLYNKDRVIEVSVRMDPQA  180



>ref|XP_009631354.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
 ref|XP_009631355.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=596

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDHKYK G+ VPLYANKVGPFHNPSETYRYFDLPFC    VK+K EALGEVLNGD
Sbjct  26   VRSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGD  85

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ D+++E VCKK LS++EVA+FR+AV+KDYYFQM+YDDLPIWGF+GKVD
Sbjct  86   RLVTAPYKLDFLSDRETEVVCKKSLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVD  145

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+ KSDP+E+KYYLFKHLHF+I +N DRVIE+NARTDP+A
Sbjct  146  KERKSDPNEYKYYLFKHLHFDIHFNNDRVIEVNARTDPNA  185



>ref|XP_003620064.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES76282.1| transmembrane 9 family protein [Medicago truncatula]
Length=588

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SD +YK GD VPL+ANKVGPFHNPSETYRYFDLPFC+ D +KEKKEALGEVLNGD
Sbjct  19   VRSDSSDKRYKEGDLVPLFANKVGPFHNPSETYRYFDLPFCIPDHLKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY+L+F  DKDS SVCKK L+++EVA FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYQLEFQKDKDSLSVCKKTLTKEEVANFRSAVRKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPS+++YYL+KH+HF+IFYNKDRVIEIN RTDP+A
Sbjct  139  KEGK-DPSDYRYYLYKHIHFDIFYNKDRVIEINVRTDPNA  177



>ref|XP_010496367.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S+H+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  C KKL+++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSEFKY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KDIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDP  179



>ref|XP_010476529.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S+H+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  C KKL+++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSEFKY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KDIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDP  179



>gb|KJB60875.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=549

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GDAVPLYANKVGPFHNPSETYRYFDLPFC  D V EK+EALGEVLNGD
Sbjct  24   VRSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS  VCKKKL + EVA FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLNFKEEKDSSVVCKKKLLKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+LFKH+ F++ YNKDRVIE+NAR DP
Sbjct  144  KEGKTDPSEYKYFLFKHIQFDVLYNKDRVIEVNARMDP  181



>emb|CDX81659.1| BnaC08g39420D [Brassica napus]
Length=589

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  19   VRSDSSDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV  FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLNFRDEKDSEVYCKKKLSKEEVKHFRKAVEKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSE+KY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  139  KDIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDP  176



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEKKEALGEVLNGD
Sbjct  24   VRSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS  VCKKKLS+ EV  FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KYYL+KH+ F++ YNKDRVIEI+AR DP
Sbjct  144  KEGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDP  181



>gb|KHN43674.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC   D+KEKKEALGEVLNGD
Sbjct  19   VRSDPSDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  DK+S SVC +KLS+++VA+FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLEFQRDKESISVCNRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPS+++Y+L+KH+HF++FYNKDRVIEIN RTDP+A
Sbjct  139  KEGK-DPSDYRYFLYKHIHFDVFYNKDRVIEINVRTDPNA  177



>ref|XP_011005913.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005914.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SD++YK G+ VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGE+LNGD
Sbjct  22   VRSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  CK KL++++VAQFREA+SKD+YFQMYYDDLPIWGF+GKV+
Sbjct  82   RLVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAISKDFYFQMYYDDLPIWGFIGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KYYLFKHLHF IFYNKDRVIEI A +DP
Sbjct  142  KEGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITALSDP  179



>ref|XP_008393472.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=593

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC    VKEKKEALGEVLNGD
Sbjct  24   VRSDGSDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCSPGAVKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+  KD++  CK KL ++EVAQFR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLEFLKHKDTDVACKTKLKKEEVAQFRSAVNKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE+K YL+KH+HF+++YNKDRVIE+N RTDP+A
Sbjct  144  KEGK-DPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNA  182



>ref|XP_006372422.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP50219.1| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  CK  L++++VAQFREAVSKDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+ K+DPSE+KYYLFKHLHF IFYNK RVIEI+A++D
Sbjct  142  KERKNDPSEYKYYLFKHLHFTIFYNKYRVIEISAQSD  178



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEKKEALGEVLNGD
Sbjct  24   VRSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS  VCKKKLS+ EV  FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KYYL+KH+ F++ YNKDRVIEI+AR DP
Sbjct  144  KEGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDP  181



>ref|XP_010458976.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S+H+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+SE  C KKL+++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKESEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSEFKY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KDIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDP  179



>ref|XP_010440842.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Camelina 
sativa]
Length=386

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  16   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  75

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+  K S   C+K+LS+++VA+FR+ + KDYYFQMYYDDLPIWGFLGKV
Sbjct  76   DRLVSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKV  135

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             KDGK+DPSE+KYYLF HL FEIFYN+DRVIE+  RTD
Sbjct  136  VKDGKTDPSEYKYYLFNHLQFEIFYNQDRVIEVIVRTD  173



>emb|CDY52035.1| BnaA08g31480D [Brassica napus]
Length=589

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  19   VRSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV +FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSE+KY+L+KH+ FEI YN DRVIEI+AR DP
Sbjct  139  KEIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDP  176



>gb|KJB60874.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=594

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GDAVPLYANKVGPFHNPSETYRYFDLPFC  D V EK+EALGEVLNGD
Sbjct  24   VRSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS  VCKKKL + EVA FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLNFKEEKDSSVVCKKKLLKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+LFKH+ F++ YNKDRVIE+NAR DP
Sbjct  144  KEGKTDPSEYKYFLFKHIQFDVLYNKDRVIEVNARMDP  181



>ref|XP_010523531.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=584

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK  D+VPLYANKVGPFHNPSETYRYFDLPFC+ D VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS+ EV QFR AV KD+YFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFREEKDSEVYCKKKLSKDEVKQFRRAVEKDFYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKD VIEI+AR DP
Sbjct  142  KERKSDPSEFKYFLYKHIQFEILYNKDHVIEISARMDP  179



>ref|XP_010445554.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=400

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  16   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  75

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+  K S   C+K+LS+++VA+FR+ + KDYYFQMYYDDLPIWGFLGKV
Sbjct  76   DRLVSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKV  135

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             KDGK+DPSE+KYYLF HL FEIFYN+DRVIE+  RTD
Sbjct  136  VKDGKTDPSEYKYYLFNHLQFEIFYNQDRVIEVIVRTD  173



>ref|XP_009110524.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  19   VRSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV +FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSE+KY+L+KH+ FEI YN DRVIEI+AR DP
Sbjct  139  KEIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDP  176



>ref|XP_003524839.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
 gb|KHN25962.1| Putative phagocytic receptor 1b [Glycine soja]
Length=601

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+T   KEK EALGEVLNGD
Sbjct  31   VRSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKEKTEALGEVLNGD  90

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY+L F  +KDS+ VCK+KL++++VAQFREAV KDYYFQMYYDDLPIWGF+G +D
Sbjct  91   RLVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTID  150

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  151  KEGKTDPSEYKYFLYKHIQFDILYNKDRVIEISARMDP  188



>ref|XP_010523409.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
 ref|XP_010523411.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523412.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523413.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Tarenaya 
hassleriana]
Length=592

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK  D+VPLYANKVGPFHNPSETYRYFDLPFC+ D VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS+ EV QFR AV KD+YFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFREEKDSEVYCKKKLSKDEVKQFRRAVEKDFYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSEFKY+L+KH+ FEI YNKD VIEI+AR DP
Sbjct  142  KERKSDPSEFKYFLYKHIQFEILYNKDHVIEISARMDP  179



>ref|XP_004515238.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH++K GD VPL+ANKVGPFHNPSETYRYFDLPFC+ D +KEKKEALGEVLNGD
Sbjct  23   VRSDSSDHRFKEGDLVPLFANKVGPFHNPSETYRYFDLPFCIPDHLKEKKEALGEVLNGD  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY+L++  DK+S SVCKKKL++++V +FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  83   RLVSAPYQLEYRRDKESVSVCKKKLTKEDVGKFRSAVRKDYYFQMYYDDLPIWGFIGKVD  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPS+++YYL+KH+HF+IFYNKDRVIEIN RTDP+A
Sbjct  143  KEGK-DPSDYRYYLYKHIHFDIFYNKDRVIEINVRTDPNA  181



>ref|XP_011463508.1| PREDICTED: transmembrane 9 superfamily member 2 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+Y   D VPLYANKVGPFHNPSETYRYFDLPFC   DVKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYNENDVVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KD+E  C++KL+++EVA+FR+AV KDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVSAPYKLEFRKEKDTEVACRRKLTKEEVAEFRKAVEKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ FEI YNKDRVIEI A+ DP
Sbjct  142  KEGKTDPSEYKYFLYKHIQFEILYNKDRVIEIGAKMDP  179



>gb|KJB08471.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=531

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YKAGD VPLYANKVGP+HNPSETYRYFD PFC +  VKEKKEALGEVLNGD
Sbjct  22   VRSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+ +K++E  CK+KL+++EV +FR+AVSKDYYFQMYYDDLPIWGFLGKV+
Sbjct  82   RLVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DP+++KYYLFKHL FEI +NKDRVIEI  R+DP+A
Sbjct  142  KEGKTDPADYKYYLFKHLVFEIHHNKDRVIEITVRSDPNA  181



>ref|XP_008340538.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=592

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+Y  GDAVPLYANKVGPFHNPSETYRYFDLPFC   DVKEK+EALGEVLNGD
Sbjct  22   VRSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  DKDSE  C++KL+++EVAQFR AV KDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVSAPYKLEFRKDKDSEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DP E+KY+L+KH+ F+  YNKDRVIEI A+ DP
Sbjct  142  KEGKTDPREYKYFLYKHIQFDARYNKDRVIEITAKMDP  179



>ref|XP_009351612.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=592

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+Y  GDAVPLY+NKVGPFHNPSETYRYFDLPFC   DVKEK+EALGEVLNGD
Sbjct  22   VRSDASDHRYNEGDAVPLYSNKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  DKDSE  C+KKL+++EVAQFR AV KDYYFQMYYDDLPIWGFLGKVD
Sbjct  82   RLVSAPYKLEFRKDKDSEVACRKKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DP E+KY+L+KH+ F+  YNKDRVIEI A+ DP
Sbjct  142  KEGKTDPREYKYFLYKHIQFDAQYNKDRVIEITAKMDP  179



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEKKEALGEVLNGD
Sbjct  59   VRSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGD  118

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDS  VCKKKLS+ EV  FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  119  RLVSAPYKLNFKEEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVD  178

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KYYL+KH+ F++ YNKDRVIEI+AR DP
Sbjct  179  KEGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDP  216



>ref|XP_002305925.2| endomembrane protein 70 [Populus trichocarpa]
 gb|EEE86436.2| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SD++YK G+ VPLY NKVGPFHNPSETYRYFDLPFC +   K+KKEALGE+LNGD
Sbjct  22   VRSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF+ DKDSE  CK KL++++VAQFREA+SKD+YFQMYYDDLPIWGF+GKV+
Sbjct  82   RLVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAISKDFYFQMYYDDLPIWGFIGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KYYL KHLHF IFYNKDRVIEI A +DP
Sbjct  142  KEGKNDPSEYKYYLLKHLHFTIFYNKDRVIEITALSDP  179



>ref|XP_007158822.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
 gb|ESW30816.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
Length=592

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+T + KEK EALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDHVPLYANKVGPFHNPSETYRYFDLPFCVTGNEKEKTEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVS PY+LDF  +KD++ VC +KL ++EVAQFREAV KDYYFQMYYDDLPIWGF+G VD
Sbjct  82   RLVSTPYELDFRTEKDAKLVCSRKLKKQEVAQFREAVKKDYYFQMYYDDLPIWGFIGTVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KY+L+KH+ F+I YNKDRV+EI+AR DP++
Sbjct  142  KEGKTDPSEYKYFLYKHIQFDILYNKDRVVEISARMDPNS  181



>ref|XP_008375035.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=611

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEK+EALGEVLNGD
Sbjct  42   VRSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSRDAVKEKREALGEVLNGD  101

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+  KD+E  CKK L+++EVA+FR AV+KDYYFQMYYDDLP WGF+GKVD
Sbjct  102  RLVSAPYKLEFLRHKDTEVACKKXLTKEEVARFRSAVNKDYYFQMYYDDLPXWGFIGKVD  161

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE+K YL+ H+HF+++YNKDRVIE+N RTDP+A
Sbjct  162  KEGK-DPSEYKTYLYXHIHFDLYYNKDRVIEVNVRTDPNA  200



>ref|XP_007210263.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
 ref|XP_008240392.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
 gb|EMJ11462.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
Length=593

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEKKEALGEVLNGD
Sbjct  24   VRSDASDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F   KDSE  CK+ + ++EVA+FR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLEFQKHKDSEVACKRTIKKEEVARFRSAVNKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE+K YL+KH+HF+I YNKDRVIEIN RTDP+A
Sbjct  144  KEGK-DPSEYKTYLYKHIHFDISYNKDRVIEINVRTDPNA  182



>ref|XP_007152616.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
 gb|ESW24610.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
Length=594

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC   D+KEKKEALGEVLNGD
Sbjct  25   VRSDSSDHRYKQGDIVPLYANKVGPFHNPSETYRYFDLPFCPPVDLKEKKEALGEVLNGD  84

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY L+F  DK+S  VC  KLS+K+VA+FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  85   RLVSAPYVLEFQRDKESVHVCDAKLSKKDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVD  144

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE++Y+L+KH+HF++FYNKDRVIEIN RTDP+A
Sbjct  145  KEGK-DPSEYRYFLYKHIHFDVFYNKDRVIEINVRTDPNA  183



>ref|XP_008789222.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789223.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789224.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789225.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789226.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=595

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +D SDH+YKAG+AVPLYANKVGPFHNPSETYRYFDLPFC  + +KEK EALGEVLNGD
Sbjct  25   VAADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCSPEPMKEKSEALGEVLNGD  84

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D DS+  CKKKL+++EVAQFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  85   RLVDAPYKLDFRVDLDSKVACKKKLTKEEVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVD  144

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            ++GK+D +EFKYYL++H+HF+I YN DRVIEINA TDP+A
Sbjct  145  REGKTDENEFKYYLYRHIHFDILYNGDRVIEINAHTDPNA  184



>gb|KJB08472.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YKAGD VPLYANKVGP+HNPSETYRYFD PFC +  VKEKKEALGEVLNGD
Sbjct  22   VRSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+ +K++E  CK+KL+++EV +FR+AVSKDYYFQMYYDDLPIWGFLGKV+
Sbjct  82   RLVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DP+++KYYLFKHL FEI +NKDRVIEI  R+DP+A
Sbjct  142  KEGKTDPADYKYYLFKHLVFEIHHNKDRVIEITVRSDPNA  181



>gb|KJB08470.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YKAGD VPLYANKVGP+HNPSETYRYFD PFC +  VKEKKEALGEVLNGD
Sbjct  22   VRSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+ +K++E  CK+KL+++EV +FR+AVSKDYYFQMYYDDLPIWGFLGKV+
Sbjct  82   RLVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DP+++KYYLFKHL FEI +NKDRVIEI  R+DP+A
Sbjct  142  KEGKTDPADYKYYLFKHLVFEIHHNKDRVIEITVRSDPNA  181



>emb|CDX84018.1| BnaC08g16270D [Brassica napus]
Length=589

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEA GEVLNGD
Sbjct  19   VRSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEAFGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV +FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLNFRDEKDSEVYCKKKLSKEEVKKFRQAVEKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSE+KY+L+KH+ FEI YN DRVIEI+AR DP
Sbjct  139  KEIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDP  176



>ref|XP_006307070.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
 gb|EOA39968.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
Length=592

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK  D VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKERDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+ E  C KKLS++EV QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFREEKEGEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KD KSDPSE+KY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KDIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDP  179



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC   D+KEKKEALGEVLNGD
Sbjct  18   VRSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGD  77

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  DK+  SVC +KLS+++VA+FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  78   RLVSAPYKLEFQRDKELVSVCDRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVD  137

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPS+++Y+L+KH+HF++FYNKDRVIEIN RTDP+A
Sbjct  138  KEGK-DPSDYRYFLYKHIHFDVFYNKDRVIEINVRTDPNA  176



>ref|XP_004299493.1| PREDICTED: transmembrane 9 superfamily member 3-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD S+H+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEKKEALGEVLNGD
Sbjct  30   VSSDASNHRYKEGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKKEALGEVLNGD  89

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+  KDSE VCKK L+++EVA+FR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  90   RLVSAPYKLEFLKHKDSEQVCKKSLTKEEVAKFRSAVNKDYYFQMYYDDLPIWGFIGKVD  149

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+ K DPSE+K YL+KH+HF+I YNKDRVIEIN +TDP A
Sbjct  150  KENK-DPSEYKTYLYKHIHFDILYNKDRVIEINVQTDPHA  188



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC   D+KEKKEALGEVLNGD
Sbjct  17   VRSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGD  76

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  DK+  SVC +KLS+++VA+FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  77   RLVSAPYKLEFQRDKELVSVCDRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVD  136

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPS+++Y+L+KH+HF++FYNKDRVIEIN RTDP+A
Sbjct  137  KEGK-DPSDYRYFLYKHIHFDVFYNKDRVIEINVRTDPNA  175



>gb|KHN28892.1| Putative phagocytic receptor 1b [Glycine soja]
Length=604

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+T   K+K EALGEVLNGD
Sbjct  34   VRSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKDKTEALGEVLNGD  93

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY+L F  +KDS+ VCK+KL++++VAQFREAV KDYYFQMYYDDLPIWGF+G VD
Sbjct  94   RLVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVD  153

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  154  KEGKTDPSEYKYFLYKHIQFDIHYNKDRVIEISARMDP  191



>ref|XP_003531127.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=604

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+T   K+K EALGEVLNGD
Sbjct  34   VRSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKDKTEALGEVLNGD  93

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY+L F  +KDS+ VCK+KL++++VAQFREAV KDYYFQMYYDDLPIWGF+G VD
Sbjct  94   RLVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVD  153

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  154  KEGKTDPSEYKYFLYKHIQFDIHYNKDRVIEISARMDP  191



>ref|XP_012072398.1| PREDICTED: transmembrane 9 superfamily member 2-like [Jatropha 
curcas]
 gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ D +KEKKEALGEVLNGD
Sbjct  21   VRSDGSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K S  VC+KKL+Q++VA+FR A+ KDYYFQMYYDDLPIWGF+GKVD
Sbjct  81   RLVSAPYKLNFRDEKVSAVVCQKKLTQEDVARFRSAIGKDYYFQMYYDDLPIWGFIGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY L+KH+ F++ YNKDRVIE++ R DP
Sbjct  141  KEGKADPSEYKYLLYKHIQFDVLYNKDRVIEVSVRMDP  178



>ref|XP_008356702.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356703.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356704.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356705.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
Length=433

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+YK GD VPLYANKVGPFHNPSE Y YFDLPFC  D V EK EALGEVLNGD
Sbjct  24   VRSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCSPDAVTEKGEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+  KD E  CKK L+++EV +FR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVSAPYKLEFLRHKDPEVACKKTLTKEEVGRFRSAVNKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK  PSE+K YL+KH+HF+++YNKDRVIE+N RTDP+A
Sbjct  144  KEGKDPPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNA  183



>ref|XP_010440841.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Camelina 
sativa]
Length=587

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  16   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  75

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+  K S   C+K+LS+++VA+FR+ + KDYYFQMYYDDLPIWGFLGKV
Sbjct  76   DRLVSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKV  135

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             KDGK+DPSE+KYYLF HL FEIFYN+DRVIEI  RTD
Sbjct  136  VKDGKTDPSEYKYYLFNHLQFEIFYNQDRVIEIIVRTD  173



>ref|XP_010932502.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
 ref|XP_010932503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=597

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +D SDH+YKAG+AVPLYANKVGPFHNPSETYRYFDLPFC  + +KEK EALGEVLNGD
Sbjct  27   VAADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCPPEHMKEKSEALGEVLNGD  86

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D DS++VCKKKL+ +EVAQFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  87   RLVDAPYKLDFRVDLDSKAVCKKKLTIEEVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVD  146

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            ++GK+D  E+KYYL++H+HF+I YN DRVIEIN  TDP+A
Sbjct  147  REGKTDEDEYKYYLYRHIHFDILYNGDRVIEINVHTDPNA  186



>ref|XP_011654527.1| PREDICTED: transmembrane 9 superfamily member 2 [Cucumis sativus]
 gb|KGN49739.1| hypothetical protein Csa_5G096460 [Cucumis sativus]
Length=589

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V  D S+H+Y  GD+VPLYANKVGPFHNPSETYRYFDLPFC   DVKEKKEALGEVLNGD
Sbjct  19   VAPDASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF  +KD+E  CK KLS+KEVAQFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLDFKREKDTEVACKSKLSKKEVAQFRAAVKKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            ++G+ DPSE+KY+LFKH+ F+I YN+DRVIEI+AR DP
Sbjct  139  REGRDDPSEYKYFLFKHIQFDISYNRDRVIEISARMDP  176



>gb|KFK43715.1| hypothetical protein AALP_AA1G163400 [Arabis alpina]
Length=592

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK  D VPLYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEADNVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+SE  C+KKLS+++V QFR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKESEVYCRKKLSKEDVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSE+KY+L+KH+ FEI YNKDRVIEI+AR DP
Sbjct  142  KEIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDP  179



>ref|XP_010450487.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=593

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  22   PVISDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+  K S   C+K+LS+++VA+FR+ + KDYYFQMYYDDLPIWGFLGKV
Sbjct  82   DRLVSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             KDGK+DPSE+KYYLF HL FEIFYN+DRVIEI  RTD
Sbjct  142  VKDGKTDPSEYKYYLFNHLQFEIFYNQDRVIEIIVRTD  179



>ref|XP_008791844.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=596

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +D SDH+YKAG+AVPLYANKVGPFHNPSETYRYFDLPFC+ + VKEK EALGEVLNGD
Sbjct  26   VAADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCIPEHVKEKSEALGEVLNGD  85

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D DS+ VC KKL  ++VAQFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  86   RLVDAPYKLDFRVDLDSKVVCPKKLKGEDVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVD  145

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            ++GK+D +E+KYYL++H+HFE+ YN DRVIEINA T+P+A
Sbjct  146  REGKTDENEYKYYLYRHIHFEVLYNSDRVIEINAHTNPNA  185



>ref|XP_010105529.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXC05024.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=591

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK G+ VPLYANKVGPFHNPSETYRYFDLPFC   DVKEKKEALGEVLNGD
Sbjct  21   VRSDDSDHRYKDGNPVPLYANKVGPFHNPSETYRYFDLPFCSGGDVKEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +K+SE  C  KL +++VA+FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  81   RLVSAPYKLEFKKEKESEVACTTKLKREDVAKFRDAVKKDYYFQMYYDDLPIWGFIGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DPSE+KY+L+KH+HFEI YNKDRVIEI+A+ DP +
Sbjct  141  KEGKADPSEYKYFLYKHIHFEILYNKDRVIEISAKMDPQS  180



>ref|XP_008389133.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=591

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+Y  GDAVPLYANKVGPFHNPSETYRYFDLPFC   DVKEK+EALGEVLNGD
Sbjct  21   VRSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY L+F  DKDSE  C++ L+++EVAQFR AV KDYYFQMYYDDLPIWGFLGKVD
Sbjct  81   RLVSAPYNLEFRKDKDSEVACRRMLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DP E+KY+L+KH+ F+  YNKDRVIEI A+ DP
Sbjct  141  KEGKTDPREYKYFLYKHIQFDARYNKDRVIEITAKMDP  178



>gb|KHG09925.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YKAGD VPLYANKVGP+HNPSETYRYFD PFC +  VKEKKEALGEVLNGD
Sbjct  22   VRSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+ +K++E  CK+KL++ EV +FR+AVSKDYYFQMYYDDLPIWGFLGKV+
Sbjct  82   RLVSAPYKLEFLTEKEAEIACKRKLTRDEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK+DP+++KYYLFKHL FEI +NKDRVIE+  R+DP+A
Sbjct  142  KEGKTDPADYKYYLFKHLVFEIHHNKDRVIEVTVRSDPNA  181



>ref|XP_008466877.1| PREDICTED: putative phagocytic receptor 1b [Cucumis melo]
Length=602

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V  D S+H+Y  GD+VPLYANKVGPFHNPSETYRYFDLPFC   DVKEKKEALGEVLNGD
Sbjct  32   VAPDASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGD  91

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKLDF  +KD+E  CK KLS+KEVAQFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  92   RLVSAPYKLDFKREKDTEVACKSKLSKKEVAQFRAAVKKDYYFQMYYDDLPIWGFIGKVD  151

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            ++G+ DPSE+KY+LFKH+ F+I YN+DRVIEI+AR DP
Sbjct  152  REGRDDPSEYKYFLFKHIQFDISYNRDRVIEISARMDP  189



>ref|XP_006283389.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 ref|XP_006283390.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16287.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16288.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
Length=590

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+Y  GD VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  19   PVISDGSDHRYMVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  78

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+  K S   C+K+LS+++VA+FR+ + KDYYFQMYYDDLPIWGFLGKV
Sbjct  79   DRLVSAPYKLEFLSYKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKV  138

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             KDGK+DPSE+KYYLF HL FEIFYNKDRVIEI  RTD
Sbjct  139  VKDGKTDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTD  176



>gb|AHA84153.1| phagocytic receptor 1b [Phaseolus vulgaris]
Length=588

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC   D+KEKKEALGEVLNGD
Sbjct  25   VRSDSSDHRYKQGDIVPLYANKVGPFHNPSETYRYFDLPFCPPVDLKEKKEALGEVLNGD  84

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY L+F  DK+S  VC  KLS+K+VA+FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  85   RLVSAPYVLEFQRDKESVHVCDAKLSKKDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVD  144

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSE++Y+L+KH+HF++FYNKDRVIEIN RTDP+ 
Sbjct  145  KEGK-DPSEYRYFLYKHIHFDVFYNKDRVIEINVRTDPNG  183



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D +KEKKEALGEVLNGD
Sbjct  24   VRSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHLKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKL+F  ++DS  VCK KLS+ EVA FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVNAPYKLNFREERDSYVVCKTKLSKDEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  144  KEGKADPSEYKYFLYKHIQFDILYNKDRVIEISARMDP  181



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D +KEKKEALGEVLNGD
Sbjct  24   VRSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHLKEKKEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKL+F  ++DS  VCK KLS+ EVA FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  84   RLVNAPYKLNFREERDSYVVCKTKLSKDEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  144  KEGKADPSEYKYFLYKHIQFDILYNKDRVIEISARMDP  181



>gb|ADQ43185.1| endomemebrane protein 70 [Schrenkiella parvula]
Length=587

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNP ETYRYFDLPFC+   VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDSVPLYANKVGPFHNP-ETYRYFDLPFCV-PGVKDKKEALGEVLNGD  79

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL F  +KDSE+ CKKKLS++EV QFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  80   RLVSAPYKLSFRDEKDSETYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVD  139

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ K+DPSEFKY+L+KH+ FEI YNKDRVIEINAR DP
Sbjct  140  KESKADPSEFKYFLYKHIQFEILYNKDRVIEINARMDP  177



>ref|XP_010435562.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=589

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PV SDGSDH+YK  D VPLYANKVGPFHNPSETYRYFDLPFC +  VKEKKEALGEVLNG
Sbjct  18   PVISDGSDHRYKVSDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNG  77

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F+  K S   C+K+LS+++VA+FR+ + KDYYFQMYYDDLPIWGFLGKV
Sbjct  78   DRLVSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKV  137

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             KDGK+DPSE+KYYLF HL FEIFYN+DRVIEI  RTD
Sbjct  138  VKDGKTDPSEYKYYLFNHLQFEIFYNQDRVIEIVVRTD  175



>ref|XP_010917284.1| PREDICTED: transmembrane 9 superfamily member 2-like [Elaeis 
guineensis]
Length=596

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +D SDH+YKAG+ VPLYANKVGPFHNPSETYRYFDLPFC  + VKEK EALGEVLNGD
Sbjct  26   VAADASDHRYKAGEPVPLYANKVGPFHNPSETYRYFDLPFCSPEHVKEKSEALGEVLNGD  85

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D DS+ VC KKL  +EVAQFR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  86   RLVDAPYKLDFRVDLDSKVVCTKKLKSEEVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVD  145

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            ++GK+D +E+KYYL++H+HF++ YN DRVIEINA TDP+A
Sbjct  146  REGKTDENEYKYYLYRHIHFDVLYNGDRVIEINAHTDPNA  185



>ref|XP_006448060.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61300.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=545

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDV-KEKKEALGEVLNG  425
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D + KEK+EALGEVLNG
Sbjct  22   VRSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDGIIKEKREALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F  +KDS   C+KKLS+++VAQFR AV KD+YFQMYYDDLPIWGF+GKV
Sbjct  82   DRLVSAPYKLNFRDEKDSAVACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            DK+GK+ P+E+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  142  DKEGKTHPNEYKYFLYKHIQFDILYNKDRVIEISARMDP  180



>ref|XP_009110529.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YK GD V LYANKVGPFHNPSETYRYFDLPFC+ + VKEKKEALGEVLNGD
Sbjct  19   VRSYASDHRYKEGDIVLLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV +FR+AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  79   RLVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSE+KY+L+KH+ FEI YN DRVIEI+AR DP
Sbjct  139  KEIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDP  176



>ref|XP_006448061.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 ref|XP_006492286.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492287.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR61301.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=593

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDV-KEKKEALGEVLNG  425
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D + KEK+EALGEVLNG
Sbjct  22   VRSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDGIIKEKREALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F  +KDS   C+KKLS+++VAQFR AV KD+YFQMYYDDLPIWGF+GKV
Sbjct  82   DRLVSAPYKLNFRDEKDSAVACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            DK+GK+ P+E+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  142  DKEGKTHPNEYKYFLYKHIQFDILYNKDRVIEISARMDP  180



>ref|XP_006431398.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44638.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=545

 Score =   261 bits (667),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDV-KEKKEALGEVLNG  425
            VRSD SDH++K GD VPLYANKVGPFHNPSETYRYFDLPFC  D + KEK+EALGEVLNG
Sbjct  22   VRSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F  +KDS   C+KKLS+++VAQFR AV KD+YFQMYYDDLPIWGF+GKV
Sbjct  82   DRLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            DK+GK+ PSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  142  DKEGKTHPSEYKYFLYKHIQFDILYNKDRVIEISARMDP  180



>ref|XP_004504610.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+Y  GD VPLYANKVGPFHNPSETYRY DLPFC+T   KEK EALGEVLNGD
Sbjct  22   VRSDASDHRYGDGDPVPLYANKVGPFHNPSETYRYLDLPFCVTGHEKEKTEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY+L F  +KDS  VCKKKL+++EV QFREAV KDYYFQMYYDDLPIWGF+G VD
Sbjct  82   RLVSAPYELHFRKEKDSNVVCKKKLTREEVNQFREAVKKDYYFQMYYDDLPIWGFIGTVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPSE+KY+L+KH+ F++ YNKDRVIE++AR DP
Sbjct  142  KEGKTDPSEYKYFLYKHIQFDVLYNKDRVIEVSARMDP  179



>ref|XP_012072397.1| PREDICTED: transmembrane 9 superfamily member 2 [Jatropha curcas]
 gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas]
Length=591

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ D +KEK EALGEVLNGD
Sbjct  21   VRSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKTEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KD+  VC+KKL+++EVA+FR AV KDYYFQMYYDDLPIWGF+GKVD
Sbjct  81   RLVSAPYKLNFRDEKDTAVVCRKKLTKEEVAKFRSAVDKDYYFQMYYDDLPIWGFIGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GK+DPS++KY+L+KH+ ++I YNKDRVIE++ R DP
Sbjct  141  KEGKADPSDYKYFLYKHIQYDILYNKDRVIEVSNRMDP  178



>ref|XP_006431397.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44637.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=593

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDV-KEKKEALGEVLNG  425
            VRSD SDH++K GD VPLYANKVGPFHNPSETYRYFDLPFC  D + KEK+EALGEVLNG
Sbjct  22   VRSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F  +KDS   C+KKLS+++VAQFR AV KD+YFQMYYDDLPIWGF+GKV
Sbjct  82   DRLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            DK+GK+ PSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  142  DKEGKTHPSEYKYFLYKHIQFDILYNKDRVIEISARMDP  180



>ref|XP_004985073.1| PREDICTED: putative phagocytic receptor 1b-like [Setaria italica]
Length=593

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
            DGSDH+YKAG+ VPLYANKVGPFHNPSETYRYFDLPFC  + V+EK EALGEVLNGDRLV
Sbjct  26   DGSDHRYKAGEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  85

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
             APYKLDF  D DS SVC KKL+ ++VA+FR AV+KDYYFQMYYDDLP+WGF+GKVDK+G
Sbjct  86   DAPYKLDFRVDLDSRSVCSKKLTTEDVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVDKEG  145

Query  618  KSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+DPSE+KYYL+KH+ F+I +N DRVIEIN  TD SA
Sbjct  146  KADPSEWKYYLYKHIIFDILFNNDRVIEINVHTDQSA  182



>ref|XP_002521899.1| transporter, putative [Ricinus communis]
 gb|EEF40535.1| transporter, putative [Ricinus communis]
Length=592

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VP YANKVGPFHNPSETYRYFDLPFC+ D +KEKKEALGEVLNGD
Sbjct  22   VRSDTSDHRYKEGDPVPFYANKVGPFHNPSETYRYFDLPFCVPDHLKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPY L+F  DK S  VC+KKLS+++VAQFR A++KDYYFQMYYDDLPIWGF+GKV 
Sbjct  82   RLVSAPYTLNFRDDKVSAPVCQKKLSKEDVAQFRSAIAKDYYFQMYYDDLPIWGFIGKVV  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            KDGK DPSE+KY+L++H+ F++ YNKDRVIE+  R DP++
Sbjct  142  KDGKDDPSEYKYFLYQHVQFDVLYNKDRVIEVGVRMDPNS  181



>emb|CDY41095.1| BnaC05g10860D [Brassica napus]
Length=589

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDL FC+ + VKEKKEA GEVLNGD
Sbjct  22   VRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLAFCVPEGVKEKKEAFGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE  CKKKLS++EV QFR+AV K YYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVSAPYKLNFRDEKDSEVYCKKKLSKEEVKQFRKAVEKAYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+ KSDPSE +Y L+KH+ FEI YN DRVIEI+AR DP
Sbjct  142  KEIKSDPSEHRYVLYKHIQFEILYNNDRVIEISARMDP  179



>emb|CDP01681.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD SDH YK  D VPLYANKVGPF NPSETYR+FDLPFC    VKEK+EALGEVLNGD
Sbjct  22   VKSDASDHTYKPKDQVPLYANKVGPFQNPSETYRFFDLPFCSPAHVKEKREALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+ DKDSE VCKK+L++ +VAQFR+AV+KDYYF+MYYDDLP+WGFLG+V+
Sbjct  82   RLVSAPYKLEFLVDKDSELVCKKQLTKDDVAQFRKAVAKDYYFEMYYDDLPVWGFLGRVE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            KDGKSDP E KYYLFKHLHF+I YNKD VIEI ART+
Sbjct  142  KDGKSDPGEHKYYLFKHLHFDISYNKDHVIEIGARTE  178



>ref|XP_006854108.2| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011626941.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
Length=592

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDHKYK GD VPLYANKVGPFHNPSETYRY+DLPFC  + V EK+E LGEVLNGD
Sbjct  22   VGADGSDHKYKQGDRVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKREDLGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L F  +++SE +CKKKLS+ +VAQ R+AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  82   RLVDAPYQLQFRLERESEVLCKKKLSKDKVAQLRDAVNKDYYFQMYYDDLPIWGFIGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K+DPSE++Y LFKH+HFEI YNKDRVIEIN +TDP+
Sbjct  142  KDNKADPSEYRYLLFKHIHFEISYNKDRVIEINVKTDPN  180



>ref|XP_010066537.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW64446.1| hypothetical protein EUGRSUZ_G02064 [Eucalyptus grandis]
Length=598

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            RSD SDH+YK G+ VPLYANKVGPFHNPSETYR+FDLPFC  D+VK+K EALGEVLNGDR
Sbjct  29   RSDASDHRYKDGEVVPLYANKVGPFHNPSETYRFFDLPFCSPDNVKDKPEALGEVLNGDR  88

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LVSAPYKL+F  + DS+ VC KKLS++EVA+FR AV KDYYFQMYYDDLPIWGF+GKV+K
Sbjct  89   LVSAPYKLNFKEEHDSKVVCSKKLSKEEVARFRAAVKKDYYFQMYYDDLPIWGFIGKVEK  148

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            +GK DPSE+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  149  EGKGDPSEYKYFLYKHIQFDILYNKDRVIEISARMDP  185



>ref|XP_006470811.1| PREDICTED: putative phagocytic receptor 1b-like [Citrus sinensis]
Length=593

 Score =   260 bits (664),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDV-KEKKEALGEVLNG  425
            VRSD SDH++K GD VPLYANKVGPFHNPSETYRYFDLPFC  D + KEK+EALGEVLNG
Sbjct  22   VRSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNG  81

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVSAPYKL+F  +KDS   C+KKLS+++VAQFR AV KD+YFQMYYDDLPIWGF+GKV
Sbjct  82   DRLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKV  141

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            DK+GK+ P+E+KY+L+KH+ F+I YNKDRVIEI+AR DP
Sbjct  142  DKEGKTHPNEYKYFLYKHIQFDILYNKDRVIEISARMDP  180



>gb|KHG20583.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=589

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YKAGD VPLYANKVGPF NPSETYRYFD PFC +  +KEKKEA GEVLNGD
Sbjct  22   VRSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCSSVPLKEKKEAFGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVS PY++DF+ +KD+E  CK+KLS++EVA+FR A+SKDYYFQMY+DDLP WGF GKVD
Sbjct  82   RLVSGPYRIDFLREKDAEIACKRKLSKEEVARFRTAISKDYYFQMYFDDLPFWGFFGKVD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
              GK+DPS+ KYYL+KHL FEIFYNKDRVIEIN R DP A
Sbjct  142  NVGKADPSDCKYYLYKHLVFEIFYNKDRVIEINVRIDPRA  181



>gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDHKYK GD VPLYANKVGPFHNPSETYRY+DLPFC  + V EK+E LGEVLNGD
Sbjct  61   VGADGSDHKYKQGDRVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKREDLGEVLNGD  120

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L F  +++SE +CKKKLS+ +VAQ R+AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  121  RLVDAPYQLQFRLERESEVLCKKKLSKDKVAQLRDAVNKDYYFQMYYDDLPIWGFIGKVD  180

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K+DPSE++Y LFKH+HFEI YNKDRVIEIN +TDP+
Sbjct  181  KDNKADPSEYRYLLFKHIHFEISYNKDRVIEINVKTDPN  219



>dbj|BAJ89640.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32275.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=593

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            SDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  + VKEK EALGEVLNGDRL
Sbjct  25   SDGSDHRYKLGDPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRL  84

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            V APYKLDF  D DS++VC KKL++++VA+FR AV+KDYYFQMYYDDLP+WGF+GKV+K 
Sbjct  85   VDAPYKLDFRTDHDSKAVCPKKLTKEDVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKG  144

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            GK DPSE+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  145  GKPDPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  182



>ref|NP_001049492.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|AAO06970.1| Putative endosomal protein [Oryza sativa Japonica Group]
 gb|ABF94848.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11406.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|EAZ26202.1| hypothetical protein OsJ_10070 [Oryza sativa Japonica Group]
 dbj|BAG89207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDH+YKA + VPLYANKVGPFHNPSETYRYFDLPFC  + VKEK EALGEVLNGD
Sbjct  25   VVADGSDHRYKANELVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGD  84

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D DS+ VC KKL+++EVA+FR AV+KDYYFQMYYDDLP+WGF+GKV+
Sbjct  85   RLVDAPYKLDFRVDYDSKPVCSKKLTKEEVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVE  144

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K GK+DP E+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  145  KGGKTDPKEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  184



>ref|XP_010276746.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=590

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGS+HKYK  D VPLYANKVGPFHNPSETYRY+DLPFC  D VKEK+EALGEVLNGD
Sbjct  20   VEADGSNHKYKERDLVPLYANKVGPFHNPSETYRYYDLPFCSPDHVKEKREALGEVLNGD  79

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  DK S+ +C+KKL+++EVAQ R AV KDYYFQMYYDDLP WGF+GKV+
Sbjct  80   RLVDAPYELNFRVDKQSKIICQKKLTKEEVAQLRTAVLKDYYFQMYYDDLPFWGFVGKVE  139

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K DP+E+KY LFKH+HF++ YN DRVIEINA+TDP+
Sbjct  140  KDNKEDPNEYKYLLFKHIHFDVLYNNDRVIEINAQTDPN  178



>ref|XP_009380058.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ + V EKKEALGEVLNGD
Sbjct  18   VVSDASDHRYKQGDPVPLYANKVGPFHNPSETYRYFDLPFCVPEHVTEKKEALGEVLNGD  77

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D+DSE +CKKKL++++VA+FR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  78   RLVEAPYKLDFRVDRDSEPLCKKKLTKEDVAKFRSAVTKDYYFQMYYDDLPIWGFIGKVD  137

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+ K D SE+KYYL++H+HF+I YN D VIEI+  TDP++
Sbjct  138  KERK-DLSEYKYYLYRHIHFDILYNSDHVIEISVHTDPNS  176



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = +3

Query  183  MGKKravarfvavllvvccaaPVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDL  362
            MGKK      VA LL+    A V SD SDH+YK  D VPLYANKVGPF NPSETYRYFDL
Sbjct  1    MGKKAMSPAAVAALLLFLGIAGVVSDASDHRYKPEDPVPLYANKVGPFQNPSETYRYFDL  60

Query  363  PFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVS  542
            PFC  + V EKKE LGEVLNGDRLV APYKLDF  D+DS+ VCKK+L++++VA+FR AV 
Sbjct  61   PFCTPEHVTEKKEDLGEVLNGDRLVVAPYKLDFRVDQDSQVVCKKQLTKEDVAKFRNAVI  120

Query  543  KDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KDYYFQMYYDDLPIWGF+GKVDK+G+ DPSE+KY+L+KH+HF+I YN DRVIEIN  TDP
Sbjct  121  KDYYFQMYYDDLPIWGFIGKVDKEGR-DPSEYKYFLYKHIHFDILYNNDRVIEINVHTDP  179

Query  723  SA  728
            +A
Sbjct  180  NA  181



>ref|XP_010920044.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X4 [Elaeis guineensis]
Length=516

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V++DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  D V EKKEALGEVLNGD
Sbjct  19   VKADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  D++S ++C+K LS+K++A+ R AV+KDYYFQMYYDDLP WGF+GKVD
Sbjct  79   RLVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD   DPSE+KY LFKH+HF+IFYN DRVIEI+ +TDP+
Sbjct  139  KDNL-DPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPN  176



>ref|XP_010920043.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=524

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V++DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  D V EKKEALGEVLNGD
Sbjct  19   VKADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  D++S ++C+K LS+K++A+ R AV+KDYYFQMYYDDLP WGF+GKVD
Sbjct  79   RLVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD   DPSE+KY LFKH+HF+IFYN DRVIEI+ +TDP+
Sbjct  139  KDNL-DPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPN  176



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = +3

Query  183  MGKKravarfvavllvvccaaPVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDL  362
            MGKK      VA LL+    A V SD SDH+YK  D VPLYANKVGPFHNPSETYRYFDL
Sbjct  1    MGKKAMAPAAVAALLLCFGIAGVVSDASDHRYKPDDPVPLYANKVGPFHNPSETYRYFDL  60

Query  363  PFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVS  542
            PFC  + + EKKE LGEVLNGDRLV APYKLDF  D+DS+ VCKK L++++ A+FR AV 
Sbjct  61   PFCTPEHLTEKKEDLGEVLNGDRLVVAPYKLDFRVDQDSQVVCKKHLTKEDAAKFRNAVM  120

Query  543  KDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KDYYFQMYYDDLPIWGF+GKVDK+GK DPSE+KY+L+KH+HF+I YN DRVIEIN  TDP
Sbjct  121  KDYYFQMYYDDLPIWGFIGKVDKEGK-DPSEYKYFLYKHIHFDILYNNDRVIEINVHTDP  179

Query  723  SA  728
            +A
Sbjct  180  NA  181



>ref|XP_010920042.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=582

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V++DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  D V EKKEALGEVLNGD
Sbjct  19   VKADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  D++S ++C+K LS+K++A+ R AV+KDYYFQMYYDDLP WGF+GKVD
Sbjct  79   RLVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD   DPSE+KY LFKH+HF+IFYN DRVIEI+ +TDP+
Sbjct  139  KDNL-DPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPN  176



>ref|XP_010920041.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=588

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V++DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  D V EKKEALGEVLNGD
Sbjct  19   VKADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  D++S ++C+K LS+K++A+ R AV+KDYYFQMYYDDLP WGF+GKVD
Sbjct  79   RLVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD   DPSE+KY LFKH+HF+IFYN DRVIEI+ +TDP+
Sbjct  139  KD-NLDPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPN  176



>ref|XP_003558407.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=593

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SDGSDH+YK+ + VPLYANKVGPFHNPSETYRYFDLPFC  + VKEK EALGEVLNGD
Sbjct  23   VLSDGSDHRYKSSEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGD  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D DS+ VC KKL++++VA+FR +V+KDYYFQMYYDDLP+WGF+GK++
Sbjct  83   RLVDAPYKLDFRVDLDSKPVCSKKLTKEDVAKFRNSVAKDYYFQMYYDDLPLWGFIGKLE  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K  K+DPSE+KYYL++H+ F+I YN DRVIEI   TD SA
Sbjct  143  KTAKADPSEWKYYLYRHIIFDILYNNDRVIEITVHTDQSA  182



>gb|AGT15903.1| transmembrane 9 superfamily protein [Saccharum hybrid cultivar 
R570]
Length=593

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
            DGSDH+YK  + VPLYANKVGPFHNPSETYRYFDLPFC  + V+EK EALGEVLNGDRLV
Sbjct  26   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  85

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
             APYKLDF ++ +S++VC KKL+ ++V +FR AV+KDYYFQMYYDDLP+WGF+GKV+K G
Sbjct  86   DAPYKLDFRFEVESKAVCSKKLTVEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  618  KSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+DPSE+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  146  KADPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  182



>ref|XP_009387842.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=597

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD S+H+YK GD VPLY NKVGPFHNPSETYRYFDLPFC  + V EKKEALGEVLNGD
Sbjct  28   VRSDASNHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCTPEHVTEKKEALGEVLNGD  87

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D++SE +CKKKL +++VA+FR AV+KDYYFQMYYDDLP+WGF+GKVD
Sbjct  88   RLVDAPYKLDFRVDRESEVLCKKKLKKEDVAKFRSAVTKDYYFQMYYDDLPLWGFIGKVD  147

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK D  E+KYYL+K  HF++ YN DRVIEI   TDP+ 
Sbjct  148  KEGK-DLGEYKYYLYKRFHFDVLYNNDRVIEIIVHTDPNT  186



>emb|CDP05457.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +3

Query  246  PVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNG  425
            PVRSD S+H+Y+ G+ VPLYANK+GPFHNPSETYRYFDLPFC+ D +KEKKEALGEVLNG
Sbjct  19   PVRSDASNHRYQPGEPVPLYANKIGPFHNPSETYRYFDLPFCIPDHIKEKKEALGEVLNG  78

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DRLVS PY LDF+ DK+S+ +CKKKL+++EV+QFR+AV KDYYFQMYYDDLPIWG +G+V
Sbjct  79   DRLVSGPYSLDFLVDKESDLLCKKKLTKEEVSQFRKAVEKDYYFQMYYDDLPIWGLIGRV  138

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            D++G+++  +++YYL++H+HF+I YNKDRVI+I AR D
Sbjct  139  DREGRAE-KDYRYYLYEHVHFDIQYNKDRVIDITARMD  175



>ref|XP_008788644.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008788651.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=588

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  D V EKKEALGEVLNGD
Sbjct  19   VEADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVTEKKEALGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  D++S ++CKK LS++++A+ R+AV+KDYYFQM+YDDLP WGF+GK+D
Sbjct  79   RLVDAPYELNFREDRESTTICKKSLSEEDIAKLRDAVAKDYYFQMFYDDLPFWGFIGKID  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD   DPSE KY LFKH+HF+IFYN DRVIEIN +TDP+
Sbjct  139  KD-NLDPSENKYLLFKHIHFDIFYNDDRVIEINVQTDPN  176



>ref|XP_009404153.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V S+ SDH+YK GD VPLYANKVGPFHNPSETYR+FDLPFC+ D V EKKEALGEVLNGD
Sbjct  18   VVSEASDHRYKQGDPVPLYANKVGPFHNPSETYRFFDLPFCIPDHVTEKKEALGEVLNGD  77

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D DSE +CKKKL++ +V +FR+AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  78   RLVGAPYKLDFRVDYDSELLCKKKLTKGDVGKFRDAVTKDYYFQMYYDDLPIWGFIGKVD  137

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK D S   YYL++H+HF+I YN DRVIEI   TDP++
Sbjct  138  KEGK-DLSNDNYYLYRHIHFDILYNNDRVIEITVHTDPNS  176



>ref|XP_010910475.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=515

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  + V EKKEALGEVLNGD
Sbjct  21   VEADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  DK S S+C K LS++ VA+ R AVSKDYYFQMYYDDLP WGFLGKV+
Sbjct  81   RLVDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVE  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K DP+E KY LFKH+HFEI YN DRVIEIN +TDP+
Sbjct  141  KD-KLDPNENKYLLFKHIHFEILYNDDRVIEINVQTDPN  178



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  177  REMGKKravarfvavllvvccaaPVRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYF  356
            REM KK      VA LL+    A V S  SDH+YK  D VPLYANKVGPF NPSETYRYF
Sbjct  16   REMRKKAMAPAAVAALLLCFGIAGVVSSASDHRYKPEDPVPLYANKVGPFQNPSETYRYF  75

Query  357  DLPFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREA  536
            DLPFC  + V EKKE LGEVLNGDRLV APYKLDF  ++DS+ VCKK+L++++VA+FR A
Sbjct  76   DLPFCTPEHVTEKKEDLGEVLNGDRLVVAPYKLDFHVNQDSKVVCKKQLTKEDVAKFRNA  135

Query  537  VSKDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINART  716
            V KDYYFQMYYDDLPIWGF+GKVDK+GK DPSE+KY+L+KH+HF+I YN DRV+EIN  T
Sbjct  136  VIKDYYFQMYYDDLPIWGFIGKVDKEGK-DPSEYKYFLYKHIHFDILYNDDRVVEINVHT  194

Query  717  DPSA  728
            DP+A
Sbjct  195  DPNA  198



>ref|XP_010099693.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXB80270.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=637

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +3

Query  264  SDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSA  443
            SDH+Y  GD+VPLYANKVGPF NPSETYRYFDLPFC  D VKEKKEALGEVLNGDRLVSA
Sbjct  26   SDHRYHEGDSVPLYANKVGPFQNPSETYRYFDLPFCSPDGVKEKKEALGEVLNGDRLVSA  85

Query  444  PYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKS  623
            PYKL+F  +K+S+  CK KL ++EVA+FR AV+KDYYFQMYYDDLP+WGF+GKV K+GK 
Sbjct  86   PYKLEFQKNKESKVACKSKLKKEEVARFRSAVNKDYYFQMYYDDLPVWGFIGKVVKEGK-  144

Query  624  DPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            +PSE+KYYL++H+HF+I YN DRVIEIN RTDP A
Sbjct  145  EPSEYKYYLYRHIHFDISYNNDRVIEINVRTDPKA  179



>ref|XP_002468203.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
 gb|EER95201.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
Length=595

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
            DGSDH+YK  + VPLYANKVGPFHNPSETYRYFDLPFC  + V+EK EALGEVLNGDRLV
Sbjct  28   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  87

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
             APYKLDF  + +S++VC KKL+ ++V +FR AV+KDYYFQMYYDDLP+WGF+GKV+K G
Sbjct  88   DAPYKLDFRLEVESKAVCSKKLTVEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  147

Query  618  KSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+DPSE+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  148  KADPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  184



>ref|XP_009419338.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=593

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+YK  D+VPLYANKVGPFHNPSETYRYFDLPFC  + V E +EALGEVLNGD
Sbjct  24   VASDASDHRYKKRDSVPLYANKVGPFHNPSETYRYFDLPFCAPEHVTEIREALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKL+F+ D DS+ +CKKKL++++VA+FR AV+KDYYFQMY+DDLPIWGF+GKVD
Sbjct  84   RLVDAPYKLNFLVDLDSKQLCKKKLTKEDVAKFRSAVTKDYYFQMYFDDLPIWGFIGKVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK D  ++KYYL++H+HF++ YN DRVIEI   TDPSA
Sbjct  144  KEGK-DLGDYKYYLYRHIHFDVLYNGDRVIEITVHTDPSA  182



>ref|XP_010910474.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=554

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  + V EKKEALGEVLNGD
Sbjct  21   VEADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  DK S S+C K LS++ VA+ R AVSKDYYFQMYYDDLP WGFLGKV+
Sbjct  81   RLVDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVE  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K DP+E KY LFKH+HFEI YN DRVIEIN +TDP+
Sbjct  141  KD-KLDPNENKYLLFKHIHFEILYNDDRVIEINVQTDPN  178



>gb|KJB43179.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
 gb|KJB43180.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=589

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRS  SDH+YKAGD VPLYANKVGPF NPSETYRYFD PFC    +KEKKEALGEVLNGD
Sbjct  22   VRSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCSPVPLKEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVS PY++DF+ +KD+E  CK+KLS++EVA+FR A+SKDYYFQMY+DDLP WGF GKV 
Sbjct  82   RLVSGPYRIDFLSEKDAEIACKRKLSKEEVARFRTAISKDYYFQMYFDDLPFWGFFGKVY  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
              GK+DPS+ KYYL+KH  F+IFYNKDRVIEIN R D  A
Sbjct  142  NVGKADPSDCKYYLYKHPVFQIFYNKDRVIEINVRMDTRA  181



>ref|XP_010910473.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=590

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  + V EKKEALGEVLNGD
Sbjct  21   VEADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  DK S S+C K LS++ VA+ R AVSKDYYFQMYYDDLP WGFLGKV+
Sbjct  81   RLVDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVE  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K DP+E KY LFKH+HFEI YN DRVIEIN +TDP+
Sbjct  141  KD-KLDPNENKYLLFKHIHFEILYNDDRVIEINVQTDPN  178



>gb|ACG42357.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
Length=593

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
            DGSDH+YK  + VPLYANKVGPFHNPSETYRYFDLPFC  D VKEK EALGEVLNGDRLV
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKSEALGEVLNGDRLV  85

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
             APYKLDF  + +S++VC KKL+ ++V +FR AV+KDYYFQMYYDDLP+WGF+GKV+K G
Sbjct  86   DAPYKLDFRDEVESKAVCSKKLTTEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  618  KSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K DPSE+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  146  KDDPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  182



>ref|NP_001151315.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN28721.1| unknown [Zea mays]
 gb|AFW89069.1| transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
            DGSDH+YK  + VPLYANKVGPFHNPSETYRYFDLPFC  D VKEK EALGEVLNGDRLV
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKSEALGEVLNGDRLV  85

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
             APYKLDF  + +S++VC KKL+ ++V +FR AV+KDYYFQMYYDDLP+WGF+GKV+K G
Sbjct  86   DAPYKLDFRDEVESKAVCSKKLTTEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  618  KSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K DPSE+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  146  KDDPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  182



>gb|KJB10378.1| hypothetical protein B456_001G198000 [Gossypium raimondii]
Length=500

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 132/159 (83%), Gaps = 12/159 (8%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            RS  SDH+Y AGD VPLYANKVGPFHNPSETYR FD PFC +  VKEKKEALGEVLNGDR
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRLFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LVSAPY+LDF+            L+++EVA+FR AVSK+YYFQMYY+DLPIWGFLGKVD 
Sbjct  83   LVSAPYRLDFL------------LAKEEVAKFRTAVSKNYYFQMYYNDLPIWGFLGKVDN  130

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            +GK+DPSE+KYYLFKHL FEI YNKDRVIEI  R+DP++
Sbjct  131  EGKADPSEYKYYLFKHLIFEILYNKDRVIEITVRSDPNS  169



>ref|XP_008787888.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Phoenix 
dactylifera]
Length=555

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V    SD +YK  D VPLYANKVGPFHNPSETYRYFDLPFC  + V EKKE LGEVLNGD
Sbjct  23   VVLGASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGD  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D+DS+ VCKK+L +++VA+FR A+ KDYYFQMYYDDLPIWG++GKVD
Sbjct  83   RLVIAPYKLDFRVDRDSKVVCKKQLKKEDVAKFRNAIIKDYYFQMYYDDLPIWGYIGKVD  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSEFKY+L+KH+HF+I YN DRVIEIN  TDP+A
Sbjct  143  KEGK-DPSEFKYFLYKHIHFDILYNDDRVIEINVHTDPNA  181



>ref|XP_009389646.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=599

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+YK GD VPLY NKVGPFHNPSETYRYFDLPFC  + V EK+EALGEVLNGD
Sbjct  30   VVSDASDHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCTPEHVTEKREALGEVLNGD  89

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D +SE +CKK+L+++EV++FR AV+KDYYFQMYYDDLP+WGF+GKVD
Sbjct  90   RLVDAPYKLDFRVDHESEVLCKKRLTREEVSKFRSAVTKDYYFQMYYDDLPLWGFIGKVD  149

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            K+GK D  E+KYYL+K  HF++ YN DRVIEI   TDP+
Sbjct  150  KEGK-DLGEYKYYLYKRFHFDVLYNNDRVIEIVVHTDPN  187



>ref|XP_008356712.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=301

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC  D VKEK+EALGE LNGD
Sbjct  24   VRSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKREALGEALNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F+  KD+E  CKK L+++EVA+FR AV+KDYYFQMYYDDLP WGF+G VD
Sbjct  84   RLVSAPYKLEFLRHKDTEVACKKTLTKEEVARFRSAVNKDYYFQMYYDDLPTWGFIGXVD  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
            K+GK D SE+K YL++H+HF+++YNK+R  E     D
Sbjct  144  KEGK-DXSEYKTYLYEHIHFDLYYNKERWKETTTPFD  179



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V    SD +YK  D VPLYANKVGPFHNPSETYRYFDLPFC  + V EKKE LGEVLNGD
Sbjct  23   VVLGASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGD  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D+DS+ VCKK+L +++VA+FR A+ KDYYFQMYYDDLPIWG++GKVD
Sbjct  83   RLVIAPYKLDFRVDRDSKVVCKKQLKKEDVAKFRNAIIKDYYFQMYYDDLPIWGYIGKVD  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK DPSEFKY+L+KH+HF+I YN DRVIEIN  TDP+A
Sbjct  143  KEGK-DPSEFKYFLYKHIHFDILYNDDRVIEINVHTDPNA  181



>tpg|DAA44289.1| TPA: hypothetical protein ZEAMMB73_547933 [Zea mays]
Length=526

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  264  SDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSA  443
            SDH+YK  + VPLYANKVGPFHNPSETYRYFDLPFC  + VKEK EALGEVLNGDRLV A
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDA  87

Query  444  PYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKS  623
            PYKLDF  + +S++VC KKL++++V +FR AV+KDYYFQMYYDDLP+WGF+GKV+K GK+
Sbjct  88   PYKLDFRSEVESKAVCSKKLTKEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKA  147

Query  624  DPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DPSE+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  148  DPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  182



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 137/161 (85%), Gaps = 3/161 (2%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVK--EKKEALGEVLN  422
            +  D SDH+YK GD VPLYANKVGPFHNPSE+YRY+DLPFC+ D VK  EKKEALGEVLN
Sbjct  23   ISQDASDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFCIPDKVKLEEKKEALGEVLN  82

Query  423  GDRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGK  602
            GDRLVS PY LDF+ +KD E +C+KKL+++EVAQFR AV KDYYF+MYYD+LPIWG +G+
Sbjct  83   GDRLVSGPYALDFLVEKDMEILCRKKLTKEEVAQFRRAVDKDYYFEMYYDELPIWGLIGR  142

Query  603  V-DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            V +++   DP ++KYYL+KH+HF+I YNKDRVIEI ARTDP
Sbjct  143  VENREETDDPKDYKYYLYKHIHFDILYNKDRVIEITARTDP  183



>ref|XP_008813153.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=590

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +D SDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  + V EKKEALGEVLNGD
Sbjct  21   VEADESDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  DK S S+CKK LS+++VA+ R AVSKDYYFQMYYDDLP WGFLGKV+
Sbjct  81   RLVDAPYELNFREDKQSMSLCKKTLSKEKVAELRNAVSKDYYFQMYYDDLPFWGFLGKVE  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K DPSE KY LFKH+HF+I Y+ DRVIEIN +TDP+
Sbjct  141  KD-KPDPSENKYLLFKHIHFDILYSGDRVIEINVQTDPN  178



>ref|NP_001148980.1| LOC100282600 precursor [Zea mays]
 gb|ACG33705.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 tpg|DAA44288.1| TPA: transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   244 bits (623),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  264  SDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSA  443
            SDH+YK  + VPLYANKVGPFHNPSETYRYFDLPFC  + VKEK EALGEVLNGDRLV A
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDA  87

Query  444  PYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKS  623
            PYKLDF  + +S++VC KKL++++V +FR AV+KDYYFQMYYDDLP+WGF+GKV+K GK+
Sbjct  88   PYKLDFRSEVESKAVCSKKLTKEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKA  147

Query  624  DPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            DPSE+KYYL++H+ F+I YN DRVIEIN  TD SA
Sbjct  148  DPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSA  182



>ref|XP_010036999.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48635.1| hypothetical protein EUGRSUZ_K02293 [Eucalyptus grandis]
Length=592

 Score =   244 bits (623),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            S  S+H+Y+  D VPLYANKVGPFHNPSETYRYFDLP+C  D +K+KKEALGEVLNGDRL
Sbjct  25   SSPSNHRYEERDPVPLYANKVGPFHNPSETYRYFDLPYCTPDQMKDKKEALGEVLNGDRL  84

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            VSAP+ L+F+ +K+ E VCKK LS+ EVA+FR A+ +DYYFQMYYDDLPIWGF+GKVDK+
Sbjct  85   VSAPFDLNFLTNKEYEVVCKKTLSKAEVARFRSAIIQDYYFQMYYDDLPIWGFIGKVDKE  144

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             + DPSE+KY L+KH+ FEIFYNK+RVIEIN RTDP++
Sbjct  145  DR-DPSEYKYLLYKHIIFEIFYNKNRVIEINVRTDPNS  181



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 6/160 (4%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD VPLYANKVGPFHNPSETYRYFDLPFC+ D +KEK EALGEVLNGD
Sbjct  24   VRSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKTEALGEVLNGD  83

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KD+  VC+KKL+++EV +FR AV KDYYFQMYYDDLP+WGF+GK+D
Sbjct  84   RLVSAPYKLNFRDEKDTAVVCRKKLTKEEVGRFRSAVDKDYYFQMYYDDLPVWGFIGKID  143

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K         KY+L+KH+ F++ YNKDRVIE+N R DP +
Sbjct  144  KQDN------KYFLYKHIQFDVLYNKDRVIEVNTRMDPQS  177



>ref|XP_010037000.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48638.1| hypothetical protein EUGRSUZ_K02296 [Eucalyptus grandis]
Length=592

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            S  S  +YK G+ VPLYANKVGPFHNPSETYRYFDLP+C  D VKEKKE LGEVLNGDRL
Sbjct  25   SSPSGQRYKEGEPVPLYANKVGPFHNPSETYRYFDLPYCTPDRVKEKKETLGEVLNGDRL  84

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            VSAP+KL+F+  K+ E  C+K LS+ EVA+FR A+ +DYYFQMYYDDLPIWGF+G +DKD
Sbjct  85   VSAPFKLEFLVSKEDEVACRKTLSKVEVARFRTAIIQDYYFQMYYDDLPIWGFIGMIDKD  144

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            G+ DP+E+KY LFK + FEIFYNKDRVIEI  RTDP
Sbjct  145  GR-DPNEYKYLLFKRVIFEIFYNKDRVIEITVRTDP  179



>ref|XP_004490795.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=593

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD  DH+YK GD VP YANKVGPFHNPSETYRYFDLPFC  D+V+EKKE LGEVLNGD
Sbjct  23   VKSDSLDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCAPDNVEEKKEDLGEVLNGD  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYK+DF+ +K  ES+C KKL++ EVAQFR AV KDY++QMYYDDLPIWGFLG+ +
Sbjct  83   RLVVAPYKMDFLINKKPESICGKKLTRNEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFE  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             D K D +E   YLF+H+HFEI YNKD +I++  R DP+A
Sbjct  143  NDDKDDTNEATVYLFRHVHFEILYNKDNIIDVFIRNDPNA  182



>ref|XP_009628015.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628016.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD S H+YK+G+ VPLYANKVGPF NPSETY YFDLPFC  D++++KKE+LGE+LNGD
Sbjct  21   VQSDASTHRYKSGEEVPLYANKVGPFFNPSETYAYFDLPFCRPDNMEKKKESLGELLNGD  80

Query  429  RLVSAPYKLDFMYDK-DSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            RL  APYKL+F+ DK D++ VCKK+L+++EVAQFR AV+ DYY QMYYDDLPIW F+GK+
Sbjct  81   RLTFAPYKLEFLADKKDAKVVCKKRLTKEEVAQFRTAVALDYYIQMYYDDLPIWAFIGKI  140

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            DK+G  DP+EFKY+++   HFEIFY+KDRVIEIN R DP
Sbjct  141  DKEGSYDPNEFKYHIYTMFHFEIFYHKDRVIEINLRADP  179



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 4/162 (2%)
 Frame = +3

Query  249  VRSDGSD-HKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVK--EKKEALGEVL  419
            +  D SD H+YK GD VPLYANKVGPFHNPSE+YRY+DLPFC+ D VK  EKKEALGEVL
Sbjct  23   ISQDASDDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFCIPDKVKLEEKKEALGEVL  82

Query  420  NGDRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLG  599
            NGDRLVS PY LDF+ +KDSE +C+KKL+++EVAQFR+AV KDYYF+MYYDDLPIWG +G
Sbjct  83   NGDRLVSGPYALDFLVEKDSEILCRKKLTKEEVAQFRKAVDKDYYFEMYYDDLPIWGLIG  142

Query  600  KV-DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            +V +K+   DP ++KY+++KH+HF+I YNKD VIEI ARTDP
Sbjct  143  RVENKEETEDPKDYKYFMYKHIHFDIHYNKDHVIEITARTDP  184



>ref|XP_009782678.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782682.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782687.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=592

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD S H+YK+G+ VPLYANKVGPF NPSETY Y+DLPFC  D++++KKE+LGEVLNGD
Sbjct  21   VQSDASTHQYKSGEKVPLYANKVGPFFNPSETYSYYDLPFCRPDNLEKKKESLGEVLNGD  80

Query  429  RLVSAPYKLDFMYDK-DSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            RL  APYKL+F+ DK D++ VCKK+L+++EVAQFR AV+ DYY QMYYDDLPIW F+GK+
Sbjct  81   RLTFAPYKLEFLADKKDAKVVCKKRLTKEEVAQFRTAVTLDYYIQMYYDDLPIWAFIGKI  140

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            DK+G  DP+EFKY+++   HFEIFY+KDRVIEIN R DP
Sbjct  141  DKEGSYDPNEFKYHIYTMFHFEIFYHKDRVIEINLRADP  179



>ref|XP_009408099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=589

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DG DH+YK GD VPLYANKVGPFHNPSETYR++DLPFC  D V EKKEALGEVLNGD
Sbjct  20   VGADGRDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCSPDHVTEKKEALGEVLNGD  79

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  +K S+S+CKK LS+K+V + R+AVSKDYYFQMYYDDLP+WGFLG++ 
Sbjct  80   RLVDAPYELNFREEKRSKSLCKKALSKKDVGKLRDAVSKDYYFQMYYDDLPLWGFLGRIK  139

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KD K+D S+ KY LFKH+HFEI YN D VIEIN + DP+
Sbjct  140  KD-KTDSSKSKYLLFKHIHFEILYNGDHVIEINVQADPN  177



>ref|XP_009388099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388100.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=586

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V +DGSDH+YK GD VPLYANKVGPFHNPSETYR++DLPFC    V EKKEALGEVLNGD
Sbjct  17   VGADGSDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCSPGHVTEKKEALGEVLNGD  76

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APY+L+F  +K ++S+CK+ LS+ +V + R+AVSKDYYFQMYYDDLP+WGFLG+++
Sbjct  77   RLVDAPYELNFREEKQAKSLCKRTLSEGDVGKLRDAVSKDYYFQMYYDDLPLWGFLGRIE  136

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            K+ K D SEFKY LF H+HFEI YN DRVI IN +TDP+
Sbjct  137  KN-KLDSSEFKYLLFLHIHFEILYNDDRVIVINVQTDPN  174



>ref|XP_007141945.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
 gb|ESW13939.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
Length=596

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD +DH+Y  GD+VP YANKVGPFHNPSETY+YFDLPFC   +V+EKKE LGEVLNGD
Sbjct  26   VTSDAADHRYNKGDSVPFYANKVGPFHNPSETYKYFDLPFCSPANVEEKKEDLGEVLNGD  85

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKL+F  DK+ ES+CKK+L++KEVAQFR AV KDY++QMYYDDLPIWGFLGK D
Sbjct  86   RLVVAPYKLNFQIDKEPESICKKRLTKKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFD  145

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             + K DP+    +LF H+HFEI YN DR+I++  R DP A
Sbjct  146  SEDKDDPTGATVHLFTHVHFEILYNNDRIIDVFIRNDPRA  185



>ref|XP_006849485.2| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011625259.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011625260.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
Length=595

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD S+HKYK GD VPLY NKVGPFHNPSETYRYFDLPFC    + EKKEALGEVLNGD
Sbjct  22   VQSDASNHKYKPGDPVPLYVNKVGPFHNPSETYRYFDLPFCPPAHLTEKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV A YKLDF  DKDS+ VCKK+LS+ EVA FR AV KDYYFQM YDDLP+WGF+GK++
Sbjct  82   RLVEAAYKLDFRVDKDSDVVCKKRLSRDEVASFRNAVIKDYYFQMIYDDLPLWGFVGKIE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINAR  713
            KD K+D  EF+Y L+KH+HFE  YNKDR+IEI+ +
Sbjct  142  KDIKADVPEFRYLLYKHIHFEAIYNKDRIIEISVQ  176



>gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD S+HKYK GD VPLY NKVGPFHNPSETYRYFDLPFC    + EKKEALGEVLNGD
Sbjct  18   VQSDASNHKYKPGDPVPLYVNKVGPFHNPSETYRYFDLPFCPPAHLTEKKEALGEVLNGD  77

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV A YKLDF  DKDS+ VCKK+LS+ EVA FR AV KDYYFQM YDDLP+WGF+GK++
Sbjct  78   RLVEAAYKLDFRVDKDSDVVCKKRLSRDEVASFRNAVIKDYYFQMIYDDLPLWGFVGKIE  137

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINAR  713
            KD K+D  EF+Y L+KH+HFE  YNKDR+IEI+ +
Sbjct  138  KDIKADVPEFRYLLYKHIHFEAIYNKDRIIEISVQ  172



>ref|XP_003518365.2| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Glycine 
max]
Length=592

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+Y  GD+VP YANKVGPFHNPSETYRYFDLPFC   +V+EK+E LGEVLNGD
Sbjct  22   VTSDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF  D + ES CKK+L+ KEVAQFR AV KDY++QMYYDDLPIWGFLGK D
Sbjct  82   RLVAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             + K D S    +LFKH+HFEI YNKDR+I++  R DP A
Sbjct  142  SEDKDDQSGAIVHLFKHVHFEILYNKDRIIDVFIRNDPQA  181



>gb|KHN41041.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+Y  GD+VP YANKVGPFHNPSETYRYFDLPFC   +V+EK+E LGEVLNGD
Sbjct  18   VTSDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGD  77

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV+APYKLDF  D + ES CKK+L+ KEVAQFR AV KDY++QMYYDDLPIWGFLGK D
Sbjct  78   RLVAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFD  137

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             + K D S    +LFKH+HFEI YNKDR+I++  R DP A
Sbjct  138  SEDKDDQSGAIVHLFKHVHFEILYNKDRIIDVFIRNDPQA  177



>ref|NP_001148367.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACG31130.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN29105.1| unknown [Zea mays]
 gb|AFW57246.1| putative Transmembrane 9 family protein member 1 [Zea mays]
Length=589

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            R+DGSDHKYK GD VPLYANKVGPFHNPSETYRY+DLPFC  +  K+KKEALGEVLNGDR
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  81

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LV APY+L+F  D++S+ +CKK LS+++VA+ R+AV+KDYYFQMYYDDLP+WGFLGK+DK
Sbjct  82   LVDAPYELNFKEDRNSKVLCKKVLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  141

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            D   +  + KY LFKH+HF+I YN +RVIEIN +TDP+ 
Sbjct  142  D--KEQGDVKYLLFKHIHFDIMYNDNRVIEINVQTDPNV  178



>ref|XP_003573450.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=588

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 135/158 (85%), Gaps = 2/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            +DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  +  K+KKEALGEVLNGDRL
Sbjct  22   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDRL  81

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            V APY+L+F  DK+S+++CKK LS++EVA+ R+AV+KDYYFQMYYDDLP+WGFLGK++KD
Sbjct  82   VDAPYELNFKEDKNSKTLCKKTLSKEEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLEKD  141

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +      KY LFKH+HF+I YN DRV+EIN +TDP+ 
Sbjct  142  KEQGAG--KYLLFKHIHFDIMYNNDRVVEINVQTDPNV  177



>gb|EEC82941.1| hypothetical protein OsI_27915 [Oryza sativa Indica Group]
Length=592

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            R+DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  D  K+K+EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDR  84

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LV APY+L+F  D++S+ +C+K LS+ EVA+ R+AV+KDYYFQMYYDDLP+WGFLGK+DK
Sbjct  85   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  144

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            D +   +  KY LFKH+HF+I YN DRVIEIN +TDP+ 
Sbjct  145  DKEQGNA--KYLLFKHIHFDIMYNGDRVIEINVQTDPNV  181



>ref|XP_004972769.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Setaria 
italica]
Length=589

 Score =   236 bits (602),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            R+DGSDHKYK GD VPLYANKVGPFHNPSETYRY+DLPFC  +  K+KKEALGEVLNGDR
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  81

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LV APY+L+F  DK+S+ +C+K L++++VA+ R+AV+KDYYFQMYYDDLP+WGFLGK+DK
Sbjct  82   LVDAPYELNFKEDKNSKILCEKTLTKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKMDK  141

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            D   +  + KY LFKH+HF+I YN +RVIEIN +TDP+ 
Sbjct  142  D--REQGDAKYLLFKHIHFDIMYNDNRVIEINVQTDPNV  178



>gb|ABK25212.1| unknown [Picea sitchensis]
Length=355

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 126/159 (79%), Gaps = 4/159 (3%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V    SDH+Y  GD VPLYANKVGPFHNPSETYRYFDLPFC  D V EK+E LGEVLNGD
Sbjct  19   VEGSASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFCPPDKVTEKREDLGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            R+V A YKL F  DK+SE +C+KKL++ ++ +FREAV KDYYFQMYYDDLPIWGF+GK D
Sbjct  79   RMVDARYKLHFQDDKNSELLCRKKLTKDDLEKFREAVKKDYYFQMYYDDLPIWGFIGKTD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            ++  +DP    + L+KHLHFEI YN DRVIEI  RTDP+
Sbjct  139  RETNADP----FLLYKHLHFEILYNNDRVIEITVRTDPN  173



>ref|XP_006575472.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Glycine 
max]
Length=594

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 129/162 (80%), Gaps = 2/162 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFC--LTDDVKEKKEALGEVLN  422
            V SD SDH+Y  GD+VP YANKVGPFHNPSETYRYFDLPFC     +V+EK+E LGEVLN
Sbjct  22   VTSDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPAAANVEEKREDLGEVLN  81

Query  423  GDRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGK  602
            GDRLV+APYKLDF  D + ES CKK+L+ KEVAQFR AV KDY++QMYYDDLPIWGFLGK
Sbjct  82   GDRLVAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGK  141

Query  603  VDKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             D + K D S    +LFKH+HFEI YNKDR+I++  R DP A
Sbjct  142  FDSEDKDDQSGAIVHLFKHVHFEILYNKDRIIDVFIRNDPQA  183



>gb|EPS73381.1| hypothetical protein M569_01372, partial [Genlisea aurea]
Length=584

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = +3

Query  261  GSDHK--YKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            GSDH   YKAGD VPLYANKVGPF NPSETYRY+ LPFC   D++EKKEALGEVLNGDRL
Sbjct  13   GSDHNHVYKAGDLVPLYANKVGPFRNPSETYRYYYLPFCSPGDIEEKKEALGEVLNGDRL  72

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            VSAPYKL F  D ++++VCKKKL+ KE A FR A+SK Y F+MY+DDLPIWGF+GK++ +
Sbjct  73   VSAPYKLHFKQDVETKTVCKKKLTMKEGALFRYAISKSYTFEMYFDDLPIWGFVGKIEGE  132

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            GK+ PSEF+YYLF HLHF+I Y+ DRVIE+NAR +  A
Sbjct  133  GKTVPSEFRYYLFNHLHFDILYHDDRVIEVNARVNSDA  170



>gb|AES99151.2| transmembrane 9 family protein [Medicago truncatula]
Length=591

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+YK GD VP YANKVGPFHNPSETYRYFDLPFC  ++V+EKKE LGEVLNGD
Sbjct  20   VTSDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCSPENVEEKKEDLGEVLNGD  79

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKL+F+ DK  ES+C+K L++KEVAQFR AV KDY++QMYYDDLPIWGFLG+ +
Sbjct  80   RLVVAPYKLEFLIDKKPESICQKMLTRKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFE  139

Query  609  KDGK-SDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             D K  D +E   YLF+++HFEI YN DR+I++  + DP+A
Sbjct  140  TDEKDVDTNEATVYLFRNVHFEILYNNDRIIDVFVKNDPNA  180



>ref|XP_003544357.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=593

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+Y  GD VP YANKVGPFHNPSETYRYFDLPFC   +V+EK+E LGEVLNGD
Sbjct  22   VTSDASDHRYMKGDFVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKLDF  D + ES+C K+L+ KEVAQFR AV KDY++QMYYDDLPIWGFLGK D
Sbjct  82   RLVVAPYKLDFQIDIEPESICTKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFD  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             + K D +    +LFKH+HFEI YNKDR+I++  + DP A
Sbjct  142  SEDKDDQTGAIVHLFKHVHFEILYNKDRIIDVFIQNDPQA  181



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score =   238 bits (608),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            R+DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  D  K+K+EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDR  84

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LV APY+L+F  D++S+ +C+K LS+ EVA+ R+AV+KDYYFQMYYDDLP+WGFLGK+DK
Sbjct  85   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  144

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            D   +    KY LFKH+HF+I YN DRVIEIN +TDP+ 
Sbjct  145  D--KEQGNAKYLLFKHIHFDIMYNGDRVIEINVQTDPNV  181



>ref|XP_008356706.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Malus domestica]
Length=421

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 127/160 (79%), Gaps = 12/160 (8%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSDGSDH+YK GD VPLYANKVGPFHNPSE Y YFDLPFC  D V EK EALG      
Sbjct  24   VRSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCSPDAVTEKGEALG------  77

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
                  YKL+F+  KD E  CKK L+++EV +FR AV+KDYYFQMYYDDLPIWGF+GKVD
Sbjct  78   ------YKLEFLRHKDPEVACKKTLTKEEVGRFRSAVNKDYYFQMYYDDLPIWGFIGKVD  131

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            K+GK  PSE+K YL+KH+HF+++YNKDRVIE+N RTDP+A
Sbjct  132  KEGKDPPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNA  171



>ref|XP_003616193.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=682

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD SDH+YK GD VP YANKVGPFHNPSETYRYFDLPFC  ++V+EKKE LGEVLNGD
Sbjct  20   VTSDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCSPENVEEKKEDLGEVLNGD  79

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLV APYKL+F+ DK  ES+C+K L++KEVAQFR AV KDY++QMYYDDLPIWGFLG+ +
Sbjct  80   RLVVAPYKLEFLIDKKPESICQKMLTRKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFE  139

Query  609  KDGK-SDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             D K  D +E   YLF+++HFEI YN DR+I++  + DP+A
Sbjct  140  TDEKDVDTNEATVYLFRNVHFEILYNNDRIIDVFVKNDPNA  180



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            R+DGSDHKYK GD VPLYANKVGPFHNPSETYRY+DLPFC  +  K+KKEALGEVLNGDR
Sbjct  201  RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  260

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LV APY+L+F  DK+S+ +C+K L++++VA+ R+AV+KDYYFQMYYDDLP+WGFLGK+DK
Sbjct  261  LVDAPYELNFKEDKNSKILCEKTLTKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKMDK  320

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            D   +  + KY LFKH+HF+I YN +RVIEIN +TDP+ 
Sbjct  321  D--REQGDAKYLLFKHIHFDIMYNDNRVIEINVQTDPNV  357



>dbj|BAJ89513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            +DGSDH+YKAGD VPLYANK+GPFHNPSETYRY+DL FC  D  K+K+EALGEVLNGDRL
Sbjct  24   ADGSDHRYKAGDRVPLYANKIGPFHNPSETYRYYDLSFCAPDHPKDKREALGEVLNGDRL  83

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            V APY+L+F  D +S+++CKK LS+++VA+ R+AV+KDYYFQMYYDDLP+WGFLGK++KD
Sbjct  84   VDAPYELNFKEDMNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLEKD  143

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +      K  LFKH+HF+I YN DRVIEIN +TDP+ 
Sbjct  144  KERGGG--KCLLFKHIHFDIMYNSDRVIEINVQTDPNV  179



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            +DGSDHKYK GD VPLYANKVGPFHNPSETYRY+DLPFC  +  K+K+EALGEVLNGDRL
Sbjct  24   ADGSDHKYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKREALGEVLNGDRL  83

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            V APY+L+F  D +S+++CKK LS+++VA+ R+AV+KDYYFQMYYDDLP+WGFLGK+D++
Sbjct  84   VDAPYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRN  143

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +      K  LFKH+HF+I YN DRVIEIN +TDP+ 
Sbjct  144  KEHGGG--KCLLFKHIHFDIMYNNDRVIEINVQTDPNV  179



>ref|XP_006659860.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=590

 Score =   231 bits (588),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            +DGSDH+YK  D VPLYANKVGPFHNPSETYRY+DLPFC  D  K+K+EALGEVLNGDRL
Sbjct  24   ADGSDHRYKDRDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDRL  83

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            V APY+L+F  D+ S+ +C+K LS+ EVA+ R+AV+KDYYFQMYYDDLP+WGFLGK+DKD
Sbjct  84   VDAPYELNFKEDRTSKILCQKTLSKAEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDKD  143

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +   +  KY LFKH+HF+I YN DRVIEIN +TDP+ 
Sbjct  144  KEQGNA--KYLLFKHIHFDIMYNDDRVIEINVQTDPNV  179



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            +DGSDH+YK GD VPLYANKVGPFHNPSETYRY+DLPFC  +  K+K+EALGEVLNGDRL
Sbjct  24   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKREALGEVLNGDRL  83

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            V APY+L+F  D +S+++CKK LS+++VA+ R+AV+KDYYFQMYYDDLP+WGFLGK+D++
Sbjct  84   VDAPYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRN  143

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +      K  LFKH+HF+I YN DRVIEIN +TDP+ 
Sbjct  144  KEHGGG--KCLLFKHIHFDIMYNNDRVIEINVQTDPNV  179



>gb|ABK24901.1| unknown [Picea sitchensis]
Length=585

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 126/159 (79%), Gaps = 4/159 (3%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V    SDH+Y  GD VPLYANKVGPFHNPSETYRYFDLPFC  D V EK+E LGEVLNGD
Sbjct  19   VEGSASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFCPPDKVTEKREDLGEVLNGD  78

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            R+V A YKL F  DK+SE +C+KKL++ ++ +FREAV KDYYFQMYYDDLPIWGF+GK D
Sbjct  79   RMVDARYKLHFQDDKNSELLCRKKLTKDDLEKFREAVKKDYYFQMYYDDLPIWGFIGKTD  138

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            ++  +DP    + L+KHLHFEI YN DRVIEI  RTDP+
Sbjct  139  RETNADP----FLLYKHLHFEILYNNDRVIEITVRTDPN  173



>ref|XP_004240860.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322124.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=591

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD S H+YK+GD VP YANKVGPF NPSETY YFDLPFC  D++++KKE+ GE LNGD
Sbjct  21   VQSDASTHRYKSGDDVPFYANKVGPFSNPSETYAYFDLPFCQPDNLEKKKESFGEPLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RL+ APYKL+F+ +KD++ +CKK+L+++EVAQFR AV+ DYY QMYYDDLPIW FLGKV+
Sbjct  81   RLIFAPYKLEFLAEKDAKVICKKRLTKEEVAQFRTAVALDYYVQMYYDDLPIWAFLGKVE  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KDG  DP+E++Y+++    FEI+Y+KD VIEI  R DPS
Sbjct  141  KDGIDDPNEYRYHIYTFYQFEIYYHKDHVIEILVRVDPS  179



>ref|XP_006358745.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=591

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD S H+YK+GD VP YANKVGP+ NPSETY YFDLPFC  D++++KKE+ GE LNGD
Sbjct  21   VQSDASTHRYKSGDDVPFYANKVGPYFNPSETYAYFDLPFCQPDNLEKKKESFGEALNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
             L  APYKL+F+ DKD++ +CKK+L+++EVAQFR AV+ DYY QMYYDDLPIW FLGKVD
Sbjct  81   HLTFAPYKLEFLADKDAKVICKKRLTKEEVAQFRTAVALDYYVQMYYDDLPIWAFLGKVD  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            KDG  DP+E++Y+++    FEI+Y+KD VIEI  R DPS
Sbjct  141  KDGIDDPNEYRYHIYTFYQFEIYYHKDHVIEILVRVDPS  179



>gb|ABR16201.1| unknown [Picea sitchensis]
Length=585

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 126/159 (79%), Gaps = 3/159 (2%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+   SDHKY  GD VPLYANKVGPF NPSETYRYFDLPFC  + + EK+E LGEVLNGD
Sbjct  18   VQGGYSDHKYSKGDHVPLYANKVGPFQNPSETYRYFDLPFCQPEHMTEKREDLGEVLNGD  77

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            R+V A YKLDF  DK+SE +CKKK   ++VA+FREAV   YYFQMYYDDLP+WGF+GKV+
Sbjct  78   RMVDAQYKLDFNVDKESEVLCKKKFKAEDVAKFREAVKNSYYFQMYYDDLPLWGFIGKVE  137

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            K+ K D    KY LF HLHF+I +NKDRVIEI+ RTDPS
Sbjct  138  KESKIDQ---KYSLFTHLHFDIKFNKDRVIEISVRTDPS  173



>ref|NP_001064040.1| Os10g0112600 [Oryza sativa Japonica Group]
 gb|AAP51848.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25954.1| Os10g0112600 [Oryza sativa Japonica Group]
 dbj|BAG94270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   223 bits (567),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +3

Query  267  DHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAP  446
             H+Y+ GDAVPLYANKVGPFHNPSETYRYFDLPFC  + VK+K EALGEVLNGDRLV AP
Sbjct  24   SHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRLVDAP  83

Query  447  YKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSD  626
            YKLDF  D D++SVC ++LS+ +V +FR AVSKDYYFQMYYDDLP WGF+G   K  K+D
Sbjct  84   YKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIG--TKPEKAD  141

Query  627  PSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
              + KYYL++H+ F+I YNKDRVIEIN  TD +A
Sbjct  142  AGD-KYYLYRHIIFDILYNKDRVIEINVHTDQNA  174



>ref|XP_004228944.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=594

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 128/157 (82%), Gaps = 3/157 (2%)
 Frame = +3

Query  267  DHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVK--EKKEALGEVLNGDRLVS  440
            DH YK GD VPL+ANK+GPFHNPSE+YRY+DLPFC+ D VK  E KE +GEVLNGDRL+S
Sbjct  32   DHFYKQGDHVPLFANKIGPFHNPSESYRYYDLPFCIPDHVKLEENKEDVGEVLNGDRLMS  91

Query  441  APYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV-DKDG  617
             PY LDF+ DKDSE +C+KKL++ EVAQFR AV KDYYF+MYYD+LPIWG +G+V +++ 
Sbjct  92   GPYALDFLVDKDSEILCRKKLTKDEVAQFRRAVDKDYYFEMYYDELPIWGLIGRVENREV  151

Query  618  KSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
              D   + Y+L+KH+HF+I YN+DRVIEI AR DP +
Sbjct  152  TEDTKYYSYFLYKHIHFDIHYNRDRVIEITARMDPHS  188



>gb|AAK52585.1|AC079685_16 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|AAM44876.1|AC098694_15 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|EAZ15105.1| hypothetical protein OsJ_30519 [Oryza sativa Japonica Group]
Length=627

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +3

Query  267  DHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAP  446
             H+Y+ GDAVPLYANKVGPFHNPSETYRYFDLPFC  + VK+K EALGEVLNGDRLV AP
Sbjct  21   SHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRLVDAP  80

Query  447  YKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSD  626
            YKLDF  D D++SVC ++LS+ +V +FR AVSKDYYFQMYYDDLP WGF+G   K  K+D
Sbjct  81   YKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KPEKAD  138

Query  627  PSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
              + KYYL++H+ F+I YNKDRVIEIN  TD +A
Sbjct  139  AGD-KYYLYRHIIFDILYNKDRVIEINVHTDQNA  171



>gb|EEC66468.1| hypothetical protein OsI_32547 [Oryza sativa Indica Group]
Length=631

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +3

Query  267  DHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAP  446
             H+Y+ GDAVPLYANKVGPFHNPSETYRYFDLPFC  + VK+K EALGEVLNGDRLV AP
Sbjct  25   SHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRLVDAP  84

Query  447  YKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSD  626
            YKLDF  D D++SVC ++LS+ +V +FR AVSKDYYFQMYYDDLP WGF+G   K  K+D
Sbjct  85   YKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KPEKAD  142

Query  627  PSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
              + KYYL++H+ F+I YNKDRVIEIN  TD +A
Sbjct  143  AGD-KYYLYRHIIFDILYNKDRVIEINVHTDQNA  175



>gb|KHN39489.1| Putative phagocytic receptor 1b [Glycine soja]
Length=561

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  285  GDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFM  464
            GD VP YANKVGPFHNPSETYRYFDLPFC   +V+EK+E LGEVLNGDRLV APYKLDF 
Sbjct  3    GDFVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRLVVAPYKLDFQ  62

Query  465  YDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKY  644
             D + ES+C K+L+ KEVAQFR AV KDY++QMYYDDLPIWGFLGK D + K D +    
Sbjct  63   IDIEPESICTKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSEDKDDQTGAIV  122

Query  645  YLFKHLHFEIFYNKDRVIEINARTDPSA  728
            +LFKH+HFEI YNKDR+I++  + DP A
Sbjct  123  HLFKHVHFEILYNKDRIIDVFIQNDPQA  150



>ref|XP_011003770.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Populus euphratica]
Length=586

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 126/158 (80%), Gaps = 6/158 (4%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            SD SDH+Y+ GD VP Y NKVGPFHNPSETYRYFDLP+CL D  KEK+ +LGEVLNGDRL
Sbjct  25   SDESDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDKTKEKRLSLGEVLNGDRL  84

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            VS P+ ++F+ +++S  VCKKKLS+++VA+FR  + +DYY+QMY+DDLPIWGFLG V+K+
Sbjct  85   VSRPFPIEFLRERNSVPVCKKKLSKEDVAKFRAVIHEDYYYQMYFDDLPIWGFLGMVNKE  144

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +      +YYLF H+   I+YNKDRVIEI +R+D  A
Sbjct  145  QQ------RYYLFNHILLNIYYNKDRVIEITSRSDTKA  176



>ref|XP_006661606.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=586

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            +    H+++ GDAVPLYANKVGPFHNPSETYRYFDLPFC  D VK+K EALGEVLNGDRL
Sbjct  21   ATADSHRFRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPDKVKDKIEALGEVLNGDRL  80

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            V APYKLDF  D D++ VC KKL++ +V +FR AVSKDYYFQMYYDDLP+WGF+G   K 
Sbjct  81   VDAPYKLDFRVDYDAKFVCSKKLTKDDVIKFRHAVSKDYYFQMYYDDLPLWGFIGT--KP  138

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTD  719
             K+D  + KYYL++HL F+I YN D VIEIN  TD
Sbjct  139  EKADGGD-KYYLYRHLIFDILYNNDHVIEINVHTD  172



>ref|XP_006364083.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=597

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 126/155 (81%), Gaps = 3/155 (2%)
 Frame = +3

Query  267  DHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVK--EKKEALGEVLNGDRLVS  440
            DH YK GD V L A+K+GPFHNPSE+YRY+DLPFC+ D VK  EKKE LGEVLN DRLVS
Sbjct  32   DHFYKHGDHVRLSASKIGPFHNPSESYRYYDLPFCIPDHVKLEEKKEDLGEVLNEDRLVS  91

Query  441  APYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV-DKDG  617
             PY+LDF+ DKDSE +C+KKL++ EVAQFR AV KDYYF+MYYD+LP+WG +G+V +++ 
Sbjct  92   GPYELDFLVDKDSEMLCRKKLTKDEVAQFRRAVDKDYYFEMYYDELPVWGLIGRVENREE  151

Query  618  KSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
              D   +KY+L+KH+HF+I YN DRVIEI AR DP
Sbjct  152  TEDTKYYKYFLYKHIHFDIHYNMDRVIEITARMDP  186



>ref|XP_007045412.1| Endomembrane protein 70 protein family isoform 2, partial [Theobroma 
cacao]
 gb|EOY01244.1| Endomembrane protein 70 protein family isoform 2, partial [Theobroma 
cacao]
Length=383

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +3

Query  330  NPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKKKLSQ  509
             P   YRYFDLPFC  D +KEKKEALGEVLNGDRLV+APYKL+F  ++DS  VCK KLS+
Sbjct  29   TPXXXYRYFDLPFCSPDHLKEKKEALGEVLNGDRLVNAPYKLNFREERDSYVVCKTKLSK  88

Query  510  KEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKYYLFKHLHFEIFYNKD  689
             EVA FR+AV KDYYFQMYYDDLPIWGF+GKVDK+GK+DPSE+KY+L+KH+ F+I YNKD
Sbjct  89   DEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVDKEGKADPSEYKYFLYKHIQFDILYNKD  148

Query  690  RVIEINARTDP  722
            RVIEI+AR DP
Sbjct  149  RVIEISARMDP  159



>gb|EPS73142.1| hypothetical protein M569_01612 [Genlisea aurea]
Length=540

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 3/130 (2%)
 Frame = +3

Query  339  ETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKKKLSQKEV  518
            ETYRYFDLPFC   DVK+K EALGEVLNGDRLVSAPYKL+F+ DKDSE +C KKLS+KEV
Sbjct  3    ETYRYFDLPFCSPGDVKDKSEALGEVLNGDRLVSAPYKLEFLVDKDSEVICTKKLSKKEV  62

Query  519  AQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKYYLFKHLHFEIFYNKDRVI  698
            ++FR AV+KDYYFQMYYDDLP+WGFLGKVD    +DP++ KYYLFKHLHFEI YNKDRVI
Sbjct  63   SEFRTAVAKDYYFQMYYDDLPVWGFLGKVD---TTDPADNKYYLFKHLHFEILYNKDRVI  119

Query  699  EINARTDPSA  728
            EI+A TDP+ 
Sbjct  120  EISAHTDPNV  129



>emb|CDP05443.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 118/159 (74%), Gaps = 3/159 (2%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD  DHKY  GD VPLY NKVGP+HNPSETY Y+D PFC  D  +EK+E+LGEVLNGD
Sbjct  21   VTSDAFDHKYNKGDPVPLYVNKVGPYHNPSETYPYYDFPFCPPDLWQEKEESLGEVLNGD  80

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
             LVSAPY L+F  D++S  VC++ L++KEVA FR AVSKDYY QMYYDDLPIW F+G   
Sbjct  81   HLVSAPYNLNFRLDRESHVVCRRNLTRKEVALFRTAVSKDYYLQMYYDDLPIWQFIGAAQ  140

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             +   D   F YYLF  +HF+IFY+ DRVIEIN  TD S
Sbjct  141  TN---DVDTFNYYLFTKVHFDIFYSGDRVIEINLLTDSS  176



>emb|CDP05446.1| unnamed protein product [Coffea canephora]
Length=585

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            +SD   HKY+ GD VPLYAN VGPFHNPSETY Y+ LPFC  D  +EKK   GEVLNGDR
Sbjct  22   KSDAFTHKYEKGDPVPLYANTVGPFHNPSETYPYYSLPFCPPDHWEEKKGTFGEVLNGDR  81

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LVSAPYKLDF  D++S+ +C+K L+++EV+QFR  +++DYY QMYYDDLP+W F+GK+  
Sbjct  82   LVSAPYKLDFRVDRESQVLCRKNLTREEVSQFRTVIAQDYYLQMYYDDLPMWAFIGKI--  139

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
                 P+  +Y+++  +HFEI+YN D +IEIN RTDPS
Sbjct  140  -ANGSPNGSRYFIYTKMHFEIYYNGDHIIEINHRTDPS  176



>ref|XP_002317710.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|EEE95930.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=594

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 6/158 (4%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            SD  DH+Y+ GD VP Y NKVGPFHNPSETYRYFDLP+CL D  KEK+ +LGEVLNGDRL
Sbjct  26   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDRAKEKRLSLGEVLNGDRL  85

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            VS P+ ++F+ ++ S  VCKKKLS+++VA+FR  V +DYY+QMY+DDLP W FLG VDK 
Sbjct  86   VSGPFPIEFLRERKSVPVCKKKLSKEDVAKFRAVVHEDYYYQMYFDDLPNWVFLGMVDKR  145

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +      +YYLF H+H  I+YNKDRVIEI + T  +A
Sbjct  146  QQ------RYYLFNHIHLNIYYNKDRVIEITSHTHTNA  177



>ref|XP_006376703.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|ERP54500.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=625

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 6/158 (4%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            SD  DH+Y+ GD VP Y NKVGPFHNPSETYRYFDLP+CL D  KEK+ +LGEVLNGDRL
Sbjct  57   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDRAKEKRLSLGEVLNGDRL  116

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
            VS P+ ++F+ ++ S  VCKKKLS+++VA+FR  V +DYY+QMY+DDLP W FLG VDK 
Sbjct  117  VSGPFPIEFLRERKSVPVCKKKLSKEDVAKFRAVVHEDYYYQMYFDDLPNWVFLGMVDKR  176

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
             +      +YYLF H+H  I+YNKDRVIEI + T  +A
Sbjct  177  QQ------RYYLFNHIHLNIYYNKDRVIEITSHTHTNA  208



>dbj|BAC57816.1| putative syntaxin SYP111 [Oryza sativa Japonica Group]
Length=589

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 128/159 (81%), Gaps = 5/159 (3%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDR  431
            R+DGSDH+YK GD VPLYANKVGPFHNPS  +  F+    + D  K+K+EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPS--FSVFNCSLVI-DHPKDKREALGEVLNGDR  81

Query  432  LVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  611
            LV APY+L+F  D++S+ +C+K LS+ EVA+ R+AV+KDYYFQMYYDDLP+WGFLGK+DK
Sbjct  82   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  141

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPSA  728
            D +   +  KY LFKH+HF+I YN DRVIEIN +TDP+ 
Sbjct  142  DKEQGNA--KYLLFKHIHFDIMYNGDRVIEINVQTDPNV  178



>ref|XP_006849484.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Amborella 
trichopoda]
 gb|ERN11065.1| hypothetical protein AMTR_s00024p00115000 [Amborella trichopoda]
Length=590

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V SD  D +YK GD VPLYA K+GP HNPSETYRY+D+PFC  + V EKKE  GE LNGD
Sbjct  22   VYSDAFDQRYKHGDFVPLYATKIGPSHNPSETYRYYDMPFCSPEHVTEKKETFGEFLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
             LV APYKL+F  +K+SE  C KKLS+ EVAQFR A+ KDYYFQMYYDDLPIW F G+ +
Sbjct  82   HLVDAPYKLEFRVNKESEIACGKKLSKGEVAQFRNAILKDYYFQMYYDDLPIWSFFGRTE  141

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
            +  ++D  EFKY L+K+++F+I YN +RVIEIN   + S
Sbjct  142  EGNRAD--EFKYLLYKNINFDILYNNNRVIEINVWINSS  178



>emb|CDY03085.1| BnaC07g21420D [Brassica napus]
Length=535

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 118/158 (75%), Gaps = 29/158 (18%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VRSD SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE+ CKKKLS++E                             V+
Sbjct  82   RLVSAPYKLNFRDEKDSETYCKKKLSREE-----------------------------VE  112

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K+GKSDP+EFKY+L+KH+ FEI YN DRVIEINAR DP
Sbjct  113  KEGKSDPTEFKYFLYKHIQFEILYNNDRVIEINARMDP  150



>ref|XP_001775546.1| predicted protein [Physcomitrella patens]
 gb|EDQ59629.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 125/159 (79%), Gaps = 5/159 (3%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCL-TDDVKEKKEALGEVLNG  425
            V + GS+HKY  GD VPLYANKVGPFHNPSETY+YFDLPFC    +V EK+EALGEVLNG
Sbjct  23   VDASGSNHKYATGDPVPLYANKVGPFHNPSETYKYFDLPFCHPVGEVTEKREALGEVLNG  82

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DR+V A Y+L F  DK+ +++C+K L++ ++ +F++AV  DY+F+MYYDDLPIWG++GK 
Sbjct  83   DRMVEALYELRFRVDKEMKTLCEKTLTKDDIKKFQDAVKNDYFFEMYYDDLPIWGYVGKK  142

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            +  G+    + KY+L+ H+HFEI YN+DRVIEIN   DP
Sbjct  143  EDSGQ----DVKYFLYTHVHFEILYNQDRVIEINVGFDP  177



>emb|CDY56297.1| BnaC09g52300D [Brassica napus]
Length=535

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 117/158 (74%), Gaps = 29/158 (18%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            VR D SDH+YK GD+VPLYANKVGPFHNPSETYRYFDLPFC+ + VK+KKEALGEVLNGD
Sbjct  22   VRPDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGD  81

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            RLVSAPYKL+F  +KDSE+ CKKKLS++E                             VD
Sbjct  82   RLVSAPYKLNFRDEKDSETYCKKKLSREE-----------------------------VD  112

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            KDGK DPS+FKY+L+KH+ FEI YN+DRVIEINAR DP
Sbjct  113  KDGKPDPSKFKYFLYKHIQFEILYNEDRVIEINARMDP  150



>emb|CDP05449.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGD  428
            V+SD S H+Y+ GD+VPLY NKV PFHNPSET+ Y+ LPFC  D + EK+E+L EVLNG 
Sbjct  23   VKSDASKHRYQQGDSVPLYGNKVAPFHNPSETHAYYSLPFCRPDPLIEKRESLIEVLNGY  82

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
             LVSAPYKLDF+     + +C+K L+++E  QFR A+ +DY+++MYYDDLP+WG +GKVD
Sbjct  83   HLVSAPYKLDFLIKSGLQVLCRKNLTREEAFQFRTALVQDYFWEMYYDDLPLWGSIGKVD  142

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEI  704
            ++GK+ P E+KY+++  +HF IF++ + VIEI
Sbjct  143  REGKASPEEYKYFIYTRIHFNIFFSGNHVIEI  174



>ref|XP_002892454.1| endomembrane protein 70 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68713.1| endomembrane protein 70 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=589

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 122/158 (77%), Gaps = 3/158 (2%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
             GS ++Y AGD VPL+ NKVGP HNPSETY+Y+DLPFC  + V EK+E LGEVLNGDRL+
Sbjct  23   SGSSNRYNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  82

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD-  614
            S+ Y+L F  DK    +C+K+L+  +VA+FR+ +++DYYFQMYYDDLP+WGF+GKV++D 
Sbjct  83   SSLYELKFREDKTHLVLCRKRLTSSDVARFRDTIAQDYYFQMYYDDLPLWGFVGKVERDY  142

Query  615  -GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             G+ +    KYY+F HL F + YN D VIEIN+ +DPS
Sbjct  143  FGQEEKHT-KYYIFSHLKFNVLYNADEVIEINSFSDPS  179



>gb|AAF22904.1|AC006932_21 T27G7.5 [Arabidopsis thaliana]
Length=536

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
             GS + Y AGD VPL+ NKVGP HNPSETY+Y+DLPFC    V EK+E LGEVLNGDRL+
Sbjct  23   SGSSNHYNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRRGPVIEKQETLGEVLNGDRLM  82

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD-  614
            S+ YKL F  DK    +C+K+L+  ++A+FR+ +++DYYFQMYYDDLP+WGF+GKV+ D 
Sbjct  83   SSLYKLKFREDKTHFVLCRKRLTSSDIARFRDIIAQDYYFQMYYDDLPLWGFVGKVEGDY  142

Query  615  -GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             G+ +    KYY+F HL F + YN D+VIEIN+ +DPS
Sbjct  143  FGQGEKHT-KYYIFSHLKFNVLYNADKVIEINSFSDPS  179



>ref|NP_001077489.1| endomembrane protein 70 [Arabidopsis thaliana]
 sp|F4HW17.1|TMN5_ARATH RecName: Full=Transmembrane 9 superfamily member 5; AltName: 
Full=Endomembrane protein 11; AltName: Full=Transmembrane nine 
protein 5; Short=AtTMN5; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28280.1| syntaxin of plant 111 [Arabidopsis thaliana]
Length=589

 Score =   201 bits (512),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
             GS + Y AGD VPL+ NKVGP HNPSETY+Y+DLPFC    V EK+E LGEVLNGDRL+
Sbjct  23   SGSSNHYNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRRGPVIEKQETLGEVLNGDRLM  82

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD-  614
            S+ YKL F  DK    +C+K+L+  ++A+FR+ +++DYYFQMYYDDLP+WGF+GKV+ D 
Sbjct  83   SSLYKLKFREDKTHFVLCRKRLTSSDIARFRDIIAQDYYFQMYYDDLPLWGFVGKVEGDY  142

Query  615  -GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             G+ +    KYY+F HL F + YN D+VIEIN+ +DPS
Sbjct  143  FGQGEKHT-KYYIFSHLKFNVLYNADKVIEINSFSDPS  179



>ref|XP_010261665.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=644

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  PSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKKKLSQK  512
            P ETYRY+DLPFC  + VKEK+E LGEVLNGDRLV APY+L+F  DK +E +CKK LS++
Sbjct  102  PPETYRYYDLPFCSPEHVKEKREDLGEVLNGDRLVDAPYELNFRVDKHNEILCKKTLSKE  161

Query  513  EVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKYYLFKHLHFEIFYNKDR  692
            EVAQ R AV KDYYFQMYYDDLP WGFLGKV++D K DPSE+KY LFKH+HF++ YN DR
Sbjct  162  EVAQLRTAVLKDYYFQMYYDDLPFWGFLGKVERDDKMDPSEYKYLLFKHIHFDVLYNNDR  221

Query  693  VIEINARTDPS  725
            VIEIN +TDP+
Sbjct  222  VIEINVQTDPN  232



>gb|EEC74833.1| hypothetical protein OsI_10676 [Oryza sativa Indica Group]
Length=1316

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  288  DAVPLYANK-VGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAPYKLDFM  464
            +A PL  +K +      SETYRYFDLPFC  + VKEK EALGEVLNGDRLV APYKLDF 
Sbjct  592  EAWPLQISKALSRCLRKSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDAPYKLDFR  651

Query  465  YDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGKSDPSEFKY  644
             D DS+ VC KKL+++EVA+FR AV+KDYYFQMYYDDLP+WGF+GKV+K GK+DP E+KY
Sbjct  652  VDYDSKPVCSKKLTKEEVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKTDPKEWKY  711

Query  645  YLFKHLHFEIFYNKDRVIEINARTDPSA  728
            YL++H+ F+I YN DRVIEIN  TD SA
Sbjct  712  YLYRHIIFDILYNNDRVIEINVHTDQSA  739



>ref|XP_010521657.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
Length=590

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 119/158 (75%), Gaps = 2/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            S  SDH+Y  GD VPL+ NKVGPFHNPSETY+Y+DLPFC  + V  K+E LGEVLNGDRL
Sbjct  23   SSPSDHRYNVGDHVPLFVNKVGPFHNPSETYQYYDLPFCHPEPVILKQETLGEVLNGDRL  82

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
             S+ Y+L F  +K   ++C K+ +  EVA+ R+A+++D+YFQMYYDDLP+WGFLGKV+ D
Sbjct  83   TSSLYELKFREEKSGAALCSKRFAPNEVAKLRDAIAQDFYFQMYYDDLPLWGFLGKVEGD  142

Query  615  --GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
              G+ +    KYYLFKHL F + Y++DRVI I + +DP
Sbjct  143  YLGRGEKKHDKYYLFKHLQFNVLYDRDRVIAIRSFSDP  180



>ref|XP_012077856.1| PREDICTED: transmembrane 9 superfamily member 5 isoform X2 [Jatropha 
curcas]
Length=396

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            S  +DH+Y   D VPL+ NK+GP HNPSETY+Y+DLPFC  D+V  KKE LGEVLNGDRL
Sbjct  21   SSPTDHRYNVRDNVPLFVNKIGPLHNPSETYQYYDLPFCRPDNVISKKETLGEVLNGDRL  80

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD  614
             S+ Y L F  DK   ++CKKKL + E+ +FR+A+  D+YFQMYYDDLP+WGF+GK ++ 
Sbjct  81   SSSLYDLKFREDKTGVTLCKKKLEKDELLRFRDAIINDFYFQMYYDDLPLWGFIGKFEEQ  140

Query  615  GKS-DPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
                   + KYYLFKH+HF++ YN +RVIE++A +DP+
Sbjct  141  SWILGEKKLKYYLFKHVHFDVLYNGNRVIEVSAFSDPN  178



>ref|XP_002523798.1| transporter, putative [Ricinus communis]
 gb|EEF38524.1| transporter, putative [Ricinus communis]
Length=499

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +3

Query  255  SDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRL  434
            S  ++H+Y  GD VPL+ NKVGP HNPSETY Y++ PFC  D+V  KKE LGEVLNGDRL
Sbjct  21   SSPANHRYNVGDHVPLFVNKVGPLHNPSETYPYYNFPFCCPDNVILKKETLGEVLNGDRL  80

Query  435  VSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV-DK  611
             S  Y+ +F  DK   ++CKKKL + EV +FR+A+  D+YFQMYYDDLP+WGF+GKV ++
Sbjct  81   SSTLYEANFREDKTGVTLCKKKLKRDEVLRFRDAIVNDFYFQMYYDDLPLWGFIGKVEEQ  140

Query  612  DGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
                   +F+YYLFKHL F++ YN DRVIE++A +DP+
Sbjct  141  SWVVGERKFRYYLFKHLQFDVLYNGDRVIEVSAFSDPN  178



>ref|XP_007512838.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17438.1| predicted protein [Bathycoccus prasinos]
Length=632

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 5/157 (3%)
 Frame = +3

Query  267  DHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDD--VKEKKEALGEVLNGDRLVS  440
            DH YK  + VPLYANK+GPFHNPSETY+++DLPFCL  D  +  K E LGEVL GDR+V 
Sbjct  63   DHSYKIHEKVPLYANKIGPFHNPSETYQHYDLPFCLPADNQIGYKSEDLGEVLEGDRMVG  122

Query  441  APYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDGK  620
             PY + F  D+D+ES+CKK L+ K++ +FR+AV  DYYFQMYYDDLPIWGF+GK++K  +
Sbjct  123  TPYDISFRVDRDNESLCKKTLNSKDLKKFRKAVKDDYYFQMYYDDLPIWGFIGKIEKILR  182

Query  621  ---SDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
                +  E +YYLF H+HF+I YN D++IEIN  TDP
Sbjct  183  HTHGNGPELRYYLFTHVHFDISYNGDKIIEINVSTDP  219



>ref|XP_001770691.1| predicted protein [Physcomitrella patens]
 gb|EDQ64515.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 5/155 (3%)
 Frame = +3

Query  249  VRSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCL-TDDVKEKKEALGEVLNG  425
            V    S+HKY AGD VPLYANKVGPFHNPSETY+YFDLPFC    +V EK+EALGEVLNG
Sbjct  23   VHGSSSNHKYGAGDPVPLYANKVGPFHNPSETYKYFDLPFCHPKGEVTEKREALGEVLNG  82

Query  426  DRLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV  605
            DR+V A Y+L F  DK+ E +C+K L++ ++ +FR+AV  DYYFQMYYDDLPIWGF+GK+
Sbjct  83   DRMVEALYELKFKQDKEMEILCEKPLTKNDIKKFRDAVKNDYYFQMYYDDLPIWGFVGKI  142

Query  606  DKDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINA  710
            +K G+    + KY L  H+HF+I YN +RVIEI+ 
Sbjct  143  EKSGQ----DVKYSLNTHVHFDIQYNDNRVIEISV  173



>emb|CDX93569.1| BnaA06g04790D [Brassica napus]
Length=608

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
             GS  +Y AGD VPL+ NKVGP HNPSETY+Y+DLPFC  + V EK+E LGEVLNGDRL+
Sbjct  41   SGSSTRYNAGDHVPLFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  100

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
            S+ Y+L F  DK    +C K+L+  E+A+FR+ +++D+YFQMYYDDLP+WGF+GKV++D 
Sbjct  101  SSLYELKFKEDKTHSVLCHKRLTSSEIARFRDTIAQDFYFQMYYDDLPLWGFVGKVERDY  160

Query  618  KSDPSE--FKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
                 E   KYY+F HL+F + +N D VIEI + +DPS
Sbjct  161  SVHGGEENAKYYIFSHLNFNVLHNADEVIEIQSLSDPS  198



>ref|XP_003059958.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55910.1| predicted protein [Micromonas pusilla CCMP1545]
Length=614

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +3

Query  252  RSDGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCL-TDDVKEKKEALGEVLNGD  428
            R   S H Y   D VPLYANKVGPFHNPSETY+Y+DLPFC   D    K+E LGEVL GD
Sbjct  44   RLLASSHSYLVRDDVPLYANKVGPFHNPSETYQYYDLPFCEPADGAVSKREDLGEVLEGD  103

Query  429  RLVSAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVD  608
            R+ S PY++ F  D+++ES+C++ LS  ++ +FR AV  DYYFQMYYDDLPIWGF+GK++
Sbjct  104  RMSSTPYQVPFRVDRENESLCERTLSANDLKKFRRAVKDDYYFQMYYDDLPIWGFVGKIE  163

Query  609  KDGKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDP  722
            K       E +YYLF H+HF++ YN D+VIEIN  TDP
Sbjct  164  KILNPGAPELRYYLFTHVHFDVAYNGDKVIEINVSTDP  201



>ref|XP_007208295.1| hypothetical protein PRUPE_ppa003325mg [Prunus persica]
 gb|EMJ09494.1| hypothetical protein PRUPE_ppa003325mg [Prunus persica]
Length=585

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  267  DHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLVSAP  446
            D  Y  GD VPL+ NKVGP +NPSETY+Y+DLPFC  D V +KKE++GEVLNGDRL +  
Sbjct  24   DRSYNVGDHVPLFVNKVGPLNNPSETYQYYDLPFCCPDPVIQKKESIGEVLNGDRLANTL  83

Query  447  YKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV-DKDGKS  623
            Y+L+F  DK+ ES+C+KKL   EVA+FR+A+  D+YFQMYYDDLP+WGF+GKV D+    
Sbjct  84   YQLNFRQDKNGESLCQKKLKVAEVAKFRDAIVNDFYFQMYYDDLPVWGFIGKVEDESWTI  143

Query  624  DPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
                 KYYLFKH+ F++FYN +++IEI A +DP+
Sbjct  144  SDKGTKYYLFKHVLFDVFYNGNQIIEIRAFSDPN  177



>ref|XP_006417702.1| hypothetical protein EUTSA_v10007170mg [Eutrema salsugineum]
 gb|ESQ36055.1| hypothetical protein EUTSA_v10007170mg [Eutrema salsugineum]
Length=586

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
             GS  ++  GD VPL+ NKVGP HNPSETY+Y+DLPFC  + V EK+E LGEVLNGDRL+
Sbjct  20   SGSSTRFNVGDHVPLFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  79

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKD-  614
            S  Y+L+F  DK    +C K+L+  E+A+FR+ +S+D+YFQMYYDDLP+WGF+GKV+ D 
Sbjct  80   SPLYELNFGEDKTHVMLCHKRLTPSEIARFRDTISQDFYFQMYYDDLPLWGFVGKVEADY  139

Query  615  GKSDPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
             +      KYY+F HL F + YN D VIEIN+ +DPS
Sbjct  140  SRHGEKNTKYYIFSHLKFNVLYNADEVIEINSFSDPS  176



>ref|XP_009148094.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Brassica 
rapa]
Length=584

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
             GS  +Y AGD VP + NKVGP HNPSETY+Y+DLPFC  + V EK+E LGEVLNGDRL+
Sbjct  18   SGSSTRYNAGDHVPFFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  77

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
            S+ Y+L F  DK    +C K+L+  E+A+FR+ +++D+YFQMYYDDLP+WGF+GKV++D 
Sbjct  78   SSLYELKFKEDKTHSVLCHKRLTSSEIARFRDTIAQDFYFQMYYDDLPLWGFVGKVERDY  137

Query  618  KSDPSE--FKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
                 E   KYYLF HL+F + +N D VIEI +  DPS
Sbjct  138  SVHGGEENAKYYLFSHLNFNVLHNADEVIEIQSLNDPS  175



>ref|XP_009148093.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Brassica 
rapa]
Length=585

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +3

Query  258  DGSDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKEKKEALGEVLNGDRLV  437
             GS  +Y AGD VP + NKVGP HNPSETY+Y+DLPFC  + V EK+E LGEVLNGDRL+
Sbjct  18   SGSSTRYNAGDHVPFFVNKVGPLHNPSETYQYYDLPFCRPEPVIEKQETLGEVLNGDRLM  77

Query  438  SAPYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDKDG  617
            S+ Y+L F  DK    +C K+L+  E+A+FR+ +++D+YFQMYYDDLP+WGF+GKV++D 
Sbjct  78   SSLYELKFKEDKTHSVLCHKRLTSSEIARFRDTIAQDFYFQMYYDDLPLWGFVGKVERDY  137

Query  618  KSDPSE--FKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
                 E   KYYLF HL+F + +N D VIEI +  DPS
Sbjct  138  SVHGGEENAKYYLFSHLNFNVLHNADEVIEIQSLNDPS  175



>ref|XP_005650990.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26446.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
Length=624

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 122/161 (76%), Gaps = 7/161 (4%)
 Frame = +3

Query  264  SDHKYKAGDAVPLYANKVGPFHNPSETYRYFDLPFCLTDDVKE-KKEALGEVLNGDRLVS  440
            SDH+Y   D + LYANKVGPF NPSETY+Y++LPFC  +  KE K E LGEVL GDRLV+
Sbjct  52   SDHRYDMHDPIKLYANKVGPFSNPSETYQYYNLPFCTPEGGKEYKTEGLGEVLEGDRLVN  111

Query  441  APYKLDFMYDKDSESVCKKKLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK---  611
             PY + F  DK++E +C ++L+ K++ +FR+AV KDYYFQM+YDDLPIWGF+GKV+K   
Sbjct  112  TPYSIKFRVDKENEILCSRELTAKDLKKFRKAVKKDYYFQMFYDDLPIWGFIGKVEKIMS  171

Query  612  --DGKS-DPSEFKYYLFKHLHFEIFYNKDRVIEINARTDPS  725
               GK+ +  + +YYLF H+HF+I YN DRVIE+N  TDPS
Sbjct  172  QPGGKTWEKHDLRYYLFTHIHFDILYNGDRVIEVNVSTDPS  212



>ref|XP_009784371.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +3

Query  324  FHNPSETYRYFDLPFCLTDDVK--EKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKK  497
            F   SE+YRY+DLPFC+ D VK  EKKEALGEVLNGDRLVS PY LDF+ +KD E +C+K
Sbjct  15   FMLISESYRYYDLPFCIPDKVKLEEKKEALGEVLNGDRLVSGPYALDFLVEKDMEILCRK  74

Query  498  KLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV-DKDGKSDPSEFKYYLFKHLHFEI  674
            KL+++EVAQFR AV KDYYF+MYYD+LPIWG +G+V +++   DP ++KYYL+KH+HF+I
Sbjct  75   KLTKEEVAQFRRAVDKDYYFEMYYDELPIWGLIGRVENREETDDPKDYKYYLYKHIHFDI  134

Query  675  FYNKDRVIEINARTDP  722
             YNKDRVIEI ARTDP
Sbjct  135  LYNKDRVIEITARTDP  150



>ref|XP_009784372.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
sylvestris]
Length=550

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 113/132 (86%), Gaps = 3/132 (2%)
 Frame = +3

Query  336  SETYRYFDLPFCLTDDVK--EKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKKKLSQ  509
            SE+YRY+DLPFC+ D VK  EKKEALGEVLNGDRLVS PY LDF+ +KD E +C+KKL++
Sbjct  7    SESYRYYDLPFCIPDKVKLEEKKEALGEVLNGDRLVSGPYALDFLVEKDMEILCRKKLTK  66

Query  510  KEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV-DKDGKSDPSEFKYYLFKHLHFEIFYNK  686
            +EVAQFR AV KDYYF+MYYD+LPIWG +G+V +++   DP ++KYYL+KH+HF+I YNK
Sbjct  67   EEVAQFRRAVDKDYYFEMYYDELPIWGLIGRVENREETDDPKDYKYYLYKHIHFDILYNK  126

Query  687  DRVIEINARTDP  722
            DRVIEI ARTDP
Sbjct  127  DRVIEITARTDP  138



>ref|XP_009615619.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 115/136 (85%), Gaps = 3/136 (2%)
 Frame = +3

Query  324  FHNPSETYRYFDLPFCLTDDVK--EKKEALGEVLNGDRLVSAPYKLDFMYDKDSESVCKK  497
            F   SE+YRY+DLPFC+ D VK  EKKEALGEVLNGDRLVS PY LDF+ +KDSE +C+K
Sbjct  16   FMLISESYRYYDLPFCIPDKVKLEEKKEALGEVLNGDRLVSGPYALDFLVEKDSEILCRK  75

Query  498  KLSQKEVAQFREAVSKDYYFQMYYDDLPIWGFLGKV-DKDGKSDPSEFKYYLFKHLHFEI  674
            KL+++EVAQFR+AV KDYYF+MYYDDLPIWG +G+V +K+   DP ++KY+++KH+HF+I
Sbjct  76   KLTKEEVAQFRKAVDKDYYFEMYYDDLPIWGLIGRVENKEETEDPKDYKYFMYKHIHFDI  135

Query  675  FYNKDRVIEINARTDP  722
             YNKD VIEI ARTDP
Sbjct  136  HYNKDHVIEITARTDP  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1344627596975