BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1345

Length=835
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB15314.1|  hypothetical protein B456_002G170500                    351   1e-117   Gossypium raimondii
gb|KJB15315.1|  hypothetical protein B456_002G170500                    351   1e-117   Gossypium raimondii
emb|CDP01680.1|  unnamed protein product                                359   1e-116   Coffea canephora [robusta coffee]
ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b         358   3e-116   Nicotiana sylvestris
ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b         358   4e-116   Nicotiana tomentosiformis
dbj|BAH20237.1|  AT2G01970                                              347   8e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004236681.1|  PREDICTED: putative phagocytic receptor 1b         357   8e-116   Solanum lycopersicum
ref|XP_006346764.1|  PREDICTED: putative phagocytic receptor 1b-like    357   9e-116   Solanum tuberosum [potatoes]
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b         357   1e-115   Nelumbo nucifera [Indian lotus]
emb|CDP01681.1|  unnamed protein product                                355   4e-115   Coffea canephora [robusta coffee]
gb|KJB15313.1|  hypothetical protein B456_002G170500                    354   4e-115   Gossypium raimondii
ref|XP_009631354.1|  PREDICTED: putative phagocytic receptor 1b         355   4e-115   Nicotiana tomentosiformis
ref|XP_009785097.1|  PREDICTED: putative phagocytic receptor 1b         355   5e-115   Nicotiana sylvestris
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b         355   5e-115   Nelumbo nucifera [Indian lotus]
ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3    355   7e-115   
ref|XP_009616336.1|  PREDICTED: putative phagocytic receptor 1b         354   8e-115   Nicotiana tomentosiformis
gb|AAF79217.1|AC006917_2  F10B6.3                                       346   8e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg             354   1e-114   Capsella rubella
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b         354   1e-114   Nicotiana sylvestris
gb|KJB60873.1|  hypothetical protein B456_009G329300                    352   1e-114   Gossypium raimondii
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg             352   1e-114   
gb|KJB15310.1|  hypothetical protein B456_002G170500                    354   2e-114   Gossypium raimondii
gb|KFK33411.1|  hypothetical protein AALP_AA5G009400                    353   2e-114   Arabis alpina [alpine rockcress]
ref|XP_012072398.1|  PREDICTED: transmembrane 9 superfamily membe...    353   2e-114   Jatropha curcas
ref|XP_010105529.1|  Putative phagocytic receptor 1b                    353   3e-114   Morus notabilis
gb|KHG04463.1|  Putative phagocytic receptor 1b                         354   3e-114   Gossypium arboreum [tree cotton]
ref|XP_010691703.1|  PREDICTED: transmembrane 9 superfamily member 2    353   4e-114   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG09925.1|  Putative phagocytic receptor 1b                         353   4e-114   Gossypium arboreum [tree cotton]
gb|KJB08470.1|  hypothetical protein B456_001G083100                    352   5e-114   Gossypium raimondii
emb|CDY52038.1|  BnaA08g31510D                                          349   5e-114   Brassica napus [oilseed rape]
emb|CDY03085.1|  BnaC07g21420D                                          350   6e-114   
gb|KJB60874.1|  hypothetical protein B456_009G329300                    352   7e-114   Gossypium raimondii
emb|CDY56297.1|  BnaC09g52300D                                          350   7e-114   Brassica napus [oilseed rape]
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...    352   7e-114   
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...    352   8e-114   
ref|XP_006448061.1|  hypothetical protein CICLE_v10014688mg             352   8e-114   Citrus clementina [clementine]
ref|XP_011038404.1|  PREDICTED: transmembrane 9 superfamily member 4    352   8e-114   Populus euphratica
gb|KHG03505.1|  Putative phagocytic receptor 1b                         352   1e-113   Gossypium arboreum [tree cotton]
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...    352   1e-113   Populus euphratica
ref|XP_006372421.1|  hypothetical protein POPTR_0017s01480g             351   1e-113   Populus trichocarpa [western balsam poplar]
ref|XP_009110524.1|  PREDICTED: putative phagocytic receptor 1b         351   1e-113   Brassica rapa
emb|CDX84018.1|  BnaC08g16270D                                          351   1e-113   
emb|CDY52035.1|  BnaA08g31480D                                          351   2e-113   Brassica napus [oilseed rape]
gb|KHN43674.1|  Putative phagocytic receptor 1b                         351   2e-113   Glycine soja [wild soybean]
ref|XP_002521898.1|  transporter, putative                              349   2e-113   
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b         351   2e-113   Prunus mume [ume]
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg             351   2e-113   Prunus persica
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like    351   2e-113   Citrus sinensis [apfelsine]
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg             351   2e-113   Citrus clementina [clementine]
gb|AFK33397.1|  unknown                                                 345   3e-113   Medicago truncatula
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like    350   3e-113   
ref|XP_003620064.1|  Transmembrane 9 superfamily protein member         350   3e-113   Medicago truncatula
gb|AAF63170.1|AC010657_6  T5E21.15                                      349   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515238.1|  PREDICTED: putative phagocytic receptor 1b-like    350   3e-113   Cicer arietinum [garbanzo]
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415             350   4e-113   Arabidopsis lyrata subsp. lyrata
emb|CDY15803.1|  BnaC02g34220D                                          350   5e-113   Brassica napus [oilseed rape]
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b         350   5e-113   Brassica rapa
ref|XP_006283389.1|  hypothetical protein CARUB_v10004434mg             350   5e-113   Capsella rubella
ref|XP_006372422.1|  endomembrane protein 70                            350   6e-113   Populus trichocarpa [western balsam poplar]
ref|NP_178306.1|  putative endomembrane protein 70                      350   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691704.1|  PREDICTED: transmembrane 9 superfamily membe...    350   6e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg             350   6e-113   Eutrema salsugineum [saltwater cress]
gb|AFK34316.1|  unknown                                                 343   6e-113   Medicago truncatula
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...    350   6e-113   Elaeis guineensis
gb|KHN24548.1|  Putative phagocytic receptor 1b                         349   7e-113   Glycine soja [wild soybean]
gb|KFK43715.1|  hypothetical protein AALP_AA1G163400                    349   7e-113   Arabis alpina [alpine rockcress]
emb|CDY41095.1|  BnaC05g10860D                                          349   7e-113   Brassica napus [oilseed rape]
ref|XP_006307070.1|  hypothetical protein CARUB_v10008657mg             349   8e-113   Capsella rubella
ref|XP_010476529.1|  PREDICTED: putative phagocytic receptor 1b         349   8e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b         349   8e-113   Eucalyptus grandis [rose gum]
ref|XP_010496367.1|  PREDICTED: putative phagocytic receptor 1b         349   8e-113   Camelina sativa [gold-of-pleasure]
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like    349   8e-113   Glycine max [soybeans]
ref|NP_172919.1|  putative endomembrane protein 70                      349   8e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036999.1|  PREDICTED: putative phagocytic receptor 1b         349   1e-112   Eucalyptus grandis [rose gum]
ref|XP_006416990.1|  hypothetical protein EUTSA_v10007150mg             349   1e-112   Eutrema salsugineum [saltwater cress]
ref|XP_010458976.1|  PREDICTED: putative phagocytic receptor 1b         349   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b         348   1e-112   Camelina sativa [gold-of-pleasure]
emb|CDX81659.1|  BnaC08g39420D                                          348   1e-112   
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like    349   2e-112   Glycine max [soybeans]
ref|XP_002305925.2|  endomembrane protein 70                            348   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b         348   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002521899.1|  transporter, putative                              348   2e-112   Ricinus communis
ref|XP_002285238.1|  PREDICTED: transmembrane 9 superfamily member 2    348   2e-112   Vitis vinifera
ref|XP_002521900.1|  transporter, putative                              348   2e-112   Ricinus communis
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g             348   2e-112   
gb|KHN28892.1|  Putative phagocytic receptor 1b                         348   2e-112   Glycine soja [wild soybean]
gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg                348   3e-112   Erythranthe guttata [common monkey flower]
ref|XP_006352389.1|  PREDICTED: putative phagocytic receptor 1b-l...    348   3e-112   Solanum tuberosum [potatoes]
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like    348   3e-112   Glycine max [soybeans]
ref|XP_010066537.1|  PREDICTED: putative phagocytic receptor 1b         348   3e-112   Eucalyptus grandis [rose gum]
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b         348   3e-112   Tarenaya hassleriana [spider flower]
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...    348   3e-112   Populus euphratica
ref|XP_008393472.1|  PREDICTED: putative phagocytic receptor 1b         348   3e-112   Malus domestica [apple tree]
ref|XP_004250237.1|  PREDICTED: putative phagocytic receptor 1b         348   3e-112   Solanum lycopersicum
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...    348   3e-112   Populus euphratica
ref|XP_009355975.1|  PREDICTED: putative phagocytic receptor 1b         348   3e-112   Pyrus x bretschneideri [bai li]
ref|XP_007031333.1|  Endomembrane protein 70 protein family             347   4e-112   
ref|XP_012072397.1|  PREDICTED: transmembrane 9 superfamily member 2    347   4e-112   Jatropha curcas
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b         347   4e-112   Camelina sativa [gold-of-pleasure]
ref|XP_008375035.1|  PREDICTED: putative phagocytic receptor 1b         348   4e-112   
ref|XP_007152616.1|  hypothetical protein PHAVU_004G145000g             347   5e-112   Phaseolus vulgaris [French bean]
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g             347   6e-112   Phaseolus vulgaris [French bean]
ref|XP_011463508.1|  PREDICTED: transmembrane 9 superfamily member 2    347   7e-112   Fragaria vesca subsp. vesca
ref|XP_007210263.1|  hypothetical protein PRUPE_ppa003204mg             347   7e-112   Prunus persica
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b         347   7e-112   Tarenaya hassleriana [spider flower]
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like    347   8e-112   Cicer arietinum [garbanzo]
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b         347   9e-112   Camelina sativa [gold-of-pleasure]
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b         347   9e-112   Phoenix dactylifera
gb|ADQ43185.1|  endomemebrane protein 70                                346   9e-112   Schrenkiella parvula
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b         347   1e-111   Solanum lycopersicum
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...    347   1e-111   Cucumis melo [Oriental melon]
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b         346   1e-111   Tarenaya hassleriana [spider flower]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...    346   2e-111   Cucumis melo [Oriental melon]
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b         346   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...    346   2e-111   Elaeis guineensis
ref|XP_004137376.1|  PREDICTED: transmembrane 9 superfamily member 3    345   2e-111   Cucumis sativus [cucumbers]
dbj|BAK08235.1|  predicted protein                                      338   2e-111   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002870515.1|  transporter                                        345   3e-111   Arabidopsis lyrata subsp. lyrata
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg                345   3e-111   Erythranthe guttata [common monkey flower]
ref|XP_004299493.1|  PREDICTED: transmembrane 9 superfamily membe...    345   3e-111   Fragaria vesca subsp. vesca
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...    345   4e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010261665.1|  PREDICTED: putative phagocytic receptor 1b         346   5e-111   Nelumbo nucifera [Indian lotus]
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg             344   7e-111   
emb|CDY47549.1|  BnaA08g07380D                                          344   7e-111   Brassica napus [oilseed rape]
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b         344   1e-110   Brassica rapa
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...    343   1e-110   Sesamum indicum [beniseed]
emb|CDY62621.1|  BnaC08g46810D                                          343   2e-110   Brassica napus [oilseed rape]
ref|NP_198547.3|  putative endomembrane protein 70                      343   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789222.1|  PREDICTED: putative phagocytic receptor 1b         343   2e-110   
ref|XP_010932502.1|  PREDICTED: transmembrane 9 superfamily membe...    343   2e-110   Elaeis guineensis
gb|ACR33947.1|  unknown                                                 339   2e-110   Zea mays [maize]
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b         342   3e-110   Phoenix dactylifera
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...    342   5e-110   Elaeis guineensis
ref|XP_008389133.1|  PREDICTED: putative phagocytic receptor 1b         342   6e-110   
ref|XP_009387842.1|  PREDICTED: putative phagocytic receptor 1b         342   7e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b         341   8e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854108.2|  PREDICTED: transmembrane 9 superfamily member 2    342   8e-110   Amborella trichopoda
ref|XP_008466877.1|  PREDICTED: putative phagocytic receptor 1b         342   8e-110   Cucumis melo [Oriental melon]
ref|XP_011654527.1|  PREDICTED: transmembrane 9 superfamily member 2    341   9e-110   Cucumis sativus [cucumbers]
gb|ERN11066.1|  hypothetical protein AMTR_s00024p00115620               341   9e-110   Amborella trichopoda
ref|XP_006649701.1|  PREDICTED: putative phagocytic receptor 1b-like    337   1e-109   
ref|XP_006849485.2|  PREDICTED: transmembrane 9 superfamily member 2    341   1e-109   Amborella trichopoda
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b         341   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHA84153.1|  phagocytic receptor 1b                                  341   1e-109   Phaseolus vulgaris [French bean]
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b         341   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|ERN15575.1|  hypothetical protein AMTR_s00048p00146310               342   2e-109   Amborella trichopoda
gb|EMS68537.1|  Putative phagocytic receptor 1b                         339   2e-109   Triticum urartu
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...    340   2e-109   Zea mays [maize]
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b         340   3e-109   Brachypodium distachyon [annual false brome]
gb|ABK24901.1|  unknown                                                 339   5e-109   Picea sitchensis
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b         340   5e-109   Malus domestica [apple tree]
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...    339   5e-109   
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b         339   5e-109   Phoenix dactylifera
ref|NP_001148980.1|  LOC100282600 precursor                             339   5e-109   Zea mays [maize]
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...    339   6e-109   Zea mays [maize]
gb|AGT15903.1|  transmembrane 9 superfamily protein                     339   6e-109   Saccharum hybrid cultivar R570
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...    339   7e-109   Zea mays [maize]
ref|XP_009351612.1|  PREDICTED: putative phagocytic receptor 1b         339   8e-109   Pyrus x bretschneideri [bai li]
gb|ABR16201.1|  unknown                                                 338   9e-109   Picea sitchensis
dbj|BAJ89640.1|  predicted protein                                      339   9e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like    339   9e-109   Setaria italica
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650          339   9e-109   Sorghum bicolor [broomcorn]
dbj|BAC57816.1|  putative syntaxin SYP111                               338   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049492.1|  Os03g0237000                                       338   2e-108   
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b         337   3e-108   Nelumbo nucifera [Indian lotus]
gb|EPS73142.1|  hypothetical protein M569_01612                         336   3e-108   Genlisea aurea
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...    337   4e-108   Setaria italica
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b         337   4e-108   Brachypodium distachyon [annual false brome]
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like    337   4e-108   Oryza brachyantha
gb|EEC82941.1|  hypothetical protein OsI_27915                          337   4e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...    337   4e-108   Elaeis guineensis
ref|XP_010523530.1|  PREDICTED: putative phagocytic receptor 1b         327   4e-108   Tarenaya hassleriana [spider flower]
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b         337   5e-108   Phoenix dactylifera
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...    337   5e-108   Phoenix dactylifera
gb|AES99151.2|  transmembrane 9 family protein                          337   5e-108   Medicago truncatula
gb|EMS60954.1|  Putative phagocytic receptor 1b                         336   8e-108   Triticum urartu
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b         336   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b         336   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT19161.1|  Putative phagocytic receptor 1b                         335   2e-107   
ref|XP_010099693.1|  Putative phagocytic receptor 1b                    337   2e-107   
gb|KHN39489.1|  Putative phagocytic receptor 1b                         334   2e-107   Glycine soja [wild soybean]
dbj|BAJ89513.1|  predicted protein                                      334   5e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007141945.1|  hypothetical protein PHAVU_008G239300g             333   2e-106   Phaseolus vulgaris [French bean]
emb|CDP05457.1|  unnamed protein product                                332   6e-106   Coffea canephora [robusta coffee]
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...    336   9e-106   
gb|KHN41041.1|  Putative phagocytic receptor 1b                         330   2e-105   Glycine soja [wild soybean]
ref|XP_003518365.2|  PREDICTED: putative phagocytic receptor 1b-l...    330   3e-105   Glycine max [soybeans]
ref|XP_006575472.1|  PREDICTED: putative phagocytic receptor 1b-l...    330   3e-105   Glycine max [soybeans]
gb|EEE68090.1|  hypothetical protein OsJ_26137                          335   1e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004490795.1|  PREDICTED: putative phagocytic receptor 1b-like    328   2e-104   Cicer arietinum [garbanzo]
gb|KJB43178.1|  hypothetical protein B456_007G188200                    325   3e-104   Gossypium raimondii
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like    326   5e-104   Oryza brachyantha
ref|XP_009388099.1|  PREDICTED: putative phagocytic receptor 1b         326   8e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001775546.1|  predicted protein                                  326   1e-103   
gb|KHG20583.1|  Putative phagocytic receptor 1b                         325   1e-103   Gossypium arboreum [tree cotton]
gb|KJB43179.1|  hypothetical protein B456_007G188200                    325   2e-103   Gossypium raimondii
ref|XP_001770691.1|  predicted protein                                  325   2e-103   
ref|NP_001064040.1|  Os10g0112600                                       322   2e-102   
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...    320   2e-102   Nicotiana sylvestris
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...    320   6e-102   Nicotiana sylvestris
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...    320   8e-102   Nicotiana sylvestris
ref|XP_010037000.1|  PREDICTED: putative phagocytic receptor 1b         320   1e-101   Eucalyptus grandis [rose gum]
ref|XP_009615620.1|  PREDICTED: putative phagocytic receptor 1b i...    319   2e-101   
ref|XP_009615619.1|  PREDICTED: putative phagocytic receptor 1b i...    318   3e-101   Nicotiana tomentosiformis
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...    320   3e-101   Nicotiana sylvestris
ref|XP_009615618.1|  PREDICTED: putative phagocytic receptor 1b i...    318   6e-101   
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...    318   9e-101   Nicotiana tomentosiformis
gb|EEC66468.1|  hypothetical protein OsI_32547                          319   1e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645             317   4e-100   
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118             316   5e-100   
gb|KCW48636.1|  hypothetical protein EUGRSUZ_K02294                     313   1e-99    Eucalyptus grandis [rose gum]
gb|AAK52585.1|AC079685_16  Putative endosomal protein                   315   3e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003059958.1|  predicted protein                                  314   9e-99    Micromonas pusilla CCMP1545
ref|XP_001699211.1|  EMP/nonaspanin domain family protein               313   1e-98    Chlamydomonas reinhardtii
ref|XP_010039016.1|  PREDICTED: putative phagocytic receptor 1b         315   1e-98    Eucalyptus grandis [rose gum]
ref|XP_002505642.1|  predicted protein                                  308   2e-98    Micromonas commoda
ref|XP_002952428.1|  hypothetical protein VOLCADRAFT_75353              311   2e-98    Volvox carteri f. nagariensis
ref|XP_003616193.1|  Transmembrane 9 superfamily protein member         313   5e-98    
ref|XP_003544357.1|  PREDICTED: putative phagocytic receptor 1b-like    311   7e-98    Glycine max [soybeans]
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022             310   1e-97    Volvox carteri f. nagariensis
ref|XP_001689987.1|  EMP/nonaspanin domain family protein               310   2e-97    Chlamydomonas reinhardtii
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like    310   2e-97    Solanum tuberosum [potatoes]
ref|XP_005650801.1|  putative endosomal protein                         309   3e-97    Coccomyxa subellipsoidea C-169
gb|EEC74833.1|  hypothetical protein OsI_10676                          321   6e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_007512838.1|  predicted protein                                  305   2e-95    Bathycoccus prasinos
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709              301   5e-94    Chlorella variabilis
ref|XP_005650990.1|  EMP/nonaspanin domain family protein               301   5e-94    Coccomyxa subellipsoidea C-169
ref|XP_002969094.1|  hypothetical protein SELMODRAFT_170330             299   2e-93    Selaginella moellendorffii
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941             299   2e-93    Selaginella moellendorffii
gb|EPS73381.1|  hypothetical protein M569_01372                         290   8e-90    Genlisea aurea
ref|XP_001422764.1|  predicted protein                                  290   9e-90    Ostreococcus lucimarinus CCE9901
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    288   3e-89    Auxenochlorella protothecoides
ref|XP_004228944.1|  PREDICTED: putative phagocytic receptor 1b         285   4e-88    Solanum lycopersicum
gb|KDD75073.1|  endomembrane protein 70                                 283   2e-87    Helicosporidium sp. ATCC 50920
ref|XP_001783681.1|  predicted protein                                  282   8e-87    
ref|XP_010523531.1|  PREDICTED: putative phagocytic receptor 1b         281   1e-86    Tarenaya hassleriana [spider flower]
ref|XP_001755694.1|  predicted protein                                  280   6e-86    
emb|CEG02174.1|  Nonaspanin (TM9SF)                                     280   1e-85    Ostreococcus tauri
gb|KHG00678.1|  Putative phagocytic receptor 1b                         276   2e-85    Gossypium arboreum [tree cotton]
ref|XP_011003771.1|  PREDICTED: transmembrane 9 superfamily membe...    276   8e-85    Populus euphratica
ref|XP_002317710.2|  hypothetical protein POPTR_0012s03920g             277   8e-85    
ref|XP_006376703.1|  hypothetical protein POPTR_0012s03920g             277   2e-84    
ref|XP_011003770.1|  PREDICTED: transmembrane 9 superfamily membe...    275   3e-84    Populus euphratica
ref|XP_002890068.1|  predicted protein                                  273   4e-84    
ref|XP_010322125.1|  PREDICTED: putative phagocytic receptor 1b i...    271   6e-83    
ref|XP_008787888.1|  PREDICTED: putative phagocytic receptor 1b i...    271   6e-83    Phoenix dactylifera
ref|XP_004240860.1|  PREDICTED: putative phagocytic receptor 1b i...    271   2e-82    
ref|XP_011625258.1|  PREDICTED: transmembrane 9 superfamily membe...    268   6e-82    
ref|XP_006849484.1|  PREDICTED: transmembrane 9 superfamily membe...    268   2e-81    Amborella trichopoda
gb|ABR26036.1|  transmembrane 9 superfamily protein member 1 prec...    248   1e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_006358745.1|  PREDICTED: putative phagocytic receptor 1b-like    256   5e-77    
ref|XP_003083100.1|  putative syntaxin SYP111 (ISS)                     253   1e-76    
emb|CDP05446.1|  unnamed protein product                                254   2e-76    Coffea canephora [robusta coffee]
ref|XP_006448059.1|  hypothetical protein CICLE_v10017699mg             247   7e-76    
ref|XP_009782694.1|  PREDICTED: putative phagocytic receptor 1b i...    251   2e-75    Nicotiana sylvestris
ref|XP_009628018.1|  PREDICTED: putative phagocytic receptor 1b i...    251   3e-75    Nicotiana tomentosiformis
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...    251   4e-75    Nicotiana sylvestris
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088             251   7e-75    Guillardia theta CCMP2712
ref|XP_009628015.1|  PREDICTED: putative phagocytic receptor 1b i...    250   1e-74    Nicotiana tomentosiformis
emb|CDP05450.1|  unnamed protein product                                241   5e-74    Coffea canephora [robusta coffee]
emb|CDY04104.1|  BnaA09g18820D                                          240   4e-73    
emb|CDP05443.1|  unnamed protein product                                244   3e-72    Coffea canephora [robusta coffee]
emb|CDP05453.1|  unnamed protein product                                240   8e-71    Coffea canephora [robusta coffee]
gb|KHG11801.1|  Putative phagocytic receptor 1b                         239   2e-70    Gossypium arboreum [tree cotton]
gb|KJB55630.1|  hypothetical protein B456_009G086000                    239   3e-70    Gossypium raimondii
gb|EPS59962.1|  hypothetical protein M569_14842                         236   3e-70    Genlisea aurea
gb|KJB08471.1|  hypothetical protein B456_001G083100                    234   7e-69    Gossypium raimondii
ref|XP_006448060.1|  hypothetical protein CICLE_v10014688mg             232   3e-68    
ref|XP_006431398.1|  hypothetical protein CICLE_v10000657mg             232   4e-68    
gb|KJB15311.1|  hypothetical protein B456_002G170500                    232   4e-68    Gossypium raimondii
gb|KJB08472.1|  hypothetical protein B456_001G083100                    233   5e-68    Gossypium raimondii
gb|KJB60875.1|  hypothetical protein B456_009G329300                    231   6e-68    Gossypium raimondii
emb|CBN73993.1|  conserved unknown protein                              233   1e-67    Ectocarpus siliculosus
ref|XP_010271661.1|  PREDICTED: putative phagocytic receptor 1b         231   1e-67    Nelumbo nucifera [Indian lotus]
gb|KJB10378.1|  hypothetical protein B456_001G198000                    229   2e-67    Gossypium raimondii
ref|XP_011011376.1|  PREDICTED: transmembrane 9 superfamily membe...    229   3e-67    Populus euphratica
ref|XP_006372420.1|  hypothetical protein POPTR_0017s01480g             229   3e-67    
ref|XP_005824782.1|  hypothetical protein GUITHDRAFT_158562             230   3e-67    Guillardia theta CCMP2712
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5    229   1e-66    Vitis vinifera
emb|CBI28324.3|  unnamed protein product                                229   2e-66    
ref|XP_008382598.1|  PREDICTED: putative phagocytic receptor 1b         227   4e-66    
ref|XP_009350847.1|  PREDICTED: putative phagocytic receptor 1b         227   8e-66    
ref|XP_009343744.1|  PREDICTED: putative phagocytic receptor 1b         226   9e-66    
tpg|DAA44289.1|  TPA: hypothetical protein ZEAMMB73_547933              224   2e-65    
ref|XP_010920044.1|  PREDICTED: transmembrane 9 superfamily membe...    223   4e-65    
ref|XP_008228600.1|  PREDICTED: putative phagocytic receptor 1b         224   6e-65    
ref|XP_007208295.1|  hypothetical protein PRUPE_ppa003325mg             224   6e-65    
ref|XP_009043049.1|  hypothetical protein AURANDRAFT_39530              219   7e-65    
ref|XP_010066535.1|  PREDICTED: putative phagocytic receptor 1b i...    223   1e-64    
ref|XP_010920043.1|  PREDICTED: transmembrane 9 superfamily membe...    221   2e-64    
ref|XP_010920042.1|  PREDICTED: transmembrane 9 superfamily membe...    222   5e-64    
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                     222   5e-64    
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...    222   6e-64    
dbj|GAM27660.1|  hypothetical protein SAMD00019534_108360               222   6e-64    
ref|XP_007015827.1|  Endomembrane protein 70 protein family isofo...    221   1e-63    
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...    221   1e-63    
gb|KGN64925.1|  hypothetical protein Csa_1G162610                       213   4e-63    
ref|XP_008898687.1|  hypothetical protein PPTG_06513                    219   5e-63    
gb|ETL78232.1|  hypothetical protein L917_20933                         219   6e-63    
gb|EWM25418.1|  Nonaspanin (TM9SF)                                      216   1e-62    
ref|XP_001638325.1|  predicted protein                                  215   1e-62    
gb|ETL25017.1|  hypothetical protein L916_21077                         218   2e-62    
ref|XP_002906883.1|  endomembrane protein 70-like protein, putative     218   2e-62    
gb|ETM31493.1|  hypothetical protein L914_20950                         218   2e-62    
ref|XP_010089827.1|  Putative phagocytic receptor 1b                    218   2e-62    
ref|XP_004293072.1|  PREDICTED: transmembrane 9 superfamily member 5    217   6e-62    
ref|XP_009516022.1|  hypothetical protein PHYSODRAFT_552451             217   6e-62    
ref|XP_009388310.1|  PREDICTED: putative phagocytic receptor 1b         211   9e-62    
ref|XP_003294418.1|  hypothetical protein DICPUDRAFT_59030              216   1e-61    
ref|XP_004341571.1|  Endomembrane protein 70 subfamily                  215   2e-61    
ref|NP_563812.1|  endomembrane protein 70                               213   3e-61    
gb|KDO58074.1|  hypothetical protein CISIN_1g036992mg                   213   4e-61    
emb|CAN67239.1|  hypothetical protein VITISV_004804                     218   4e-61    
gb|AAK74038.1|  At1g08350/T27G7_4                                       212   5e-61    
ref|XP_011654422.1|  PREDICTED: transmembrane 9 superfamily membe...    211   6e-61    
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg             214   8e-61    
ref|XP_011654417.1|  PREDICTED: transmembrane 9 superfamily membe...    212   8e-61    
gb|ELT97180.1|  hypothetical protein CAPTEDRAFT_172435                  211   1e-60    
ref|XP_008617593.1|  hypothetical protein SDRG_13291                    213   2e-60    
gb|EJK56326.1|  hypothetical protein THAOC_23816                        216   2e-60    
ref|NP_001077489.1|  endomembrane protein 70                            212   2e-60    
ref|XP_642757.1|  TM9 protein B                                         208   3e-60    
ref|XP_004139482.1|  PREDICTED: transmembrane 9 superfamily membe...    212   3e-60    
ref|XP_003606114.1|  Transmembrane 9 superfamily member                 211   4e-60    
gb|KDO18538.1|  hypothetical protein SPRG_16087                         212   5e-60    
ref|XP_012077855.1|  PREDICTED: transmembrane 9 superfamily membe...    211   5e-60    
gb|KDO24186.1|  hypothetical protein SPRG_10614                         212   7e-60    
ref|XP_004997982.1|  transmembrane 9 superfamily member 1               211   7e-60    
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like    211   8e-60    
ref|XP_003385405.1|  PREDICTED: transmembrane 9 superfamily membe...    211   1e-59    
ref|XP_006487944.1|  PREDICTED: putative phagocytic receptor 1b-l...    209   1e-59    
gb|AAQ95660.1|  Phg1B                                                   210   1e-59    
ref|XP_642756.1|  TM9 protein B                                         210   2e-59    
ref|XP_006487943.1|  PREDICTED: putative phagocytic receptor 1b-l...    209   4e-59    
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg             209   5e-59    
ref|XP_005109383.1|  PREDICTED: transmembrane 9 superfamily membe...    208   8e-59    
ref|XP_011088889.1|  PREDICTED: transmembrane 9 superfamily membe...    204   9e-59    
ref|XP_009831493.1|  hypothetical protein H257_07606                    209   1e-58    
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...    208   1e-58    
gb|EFX74144.1|  hypothetical protein DAPPUDRAFT_324641                  207   2e-58    
ref|XP_002125091.1|  PREDICTED: transmembrane 9 superfamily member 1    207   2e-58    
ref|XP_008878196.1|  hypothetical protein, variant                      207   4e-58    
ref|XP_008878197.1|  hypothetical protein H310_12781                    207   6e-58    
emb|CDX95066.1|  BnaC05g06050D                                          206   8e-58    
ref|XP_011088888.1|  PREDICTED: transmembrane 9 superfamily membe...    204   1e-57    
ref|XP_002892454.1|  endomembrane protein 70 family protein             205   1e-57    
ref|XP_003726766.1|  PREDICTED: transmembrane 9 superfamily member 1    196   1e-57    
ref|XP_009041654.1|  hypothetical protein AURANDRAFT_55500              205   1e-57    
ref|XP_010475630.1|  PREDICTED: putative phagocytic receptor 1b i...    203   2e-57    
ref|XP_011088887.1|  PREDICTED: transmembrane 9 superfamily membe...    204   2e-57    
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg             204   2e-57    
ref|XP_009779343.1|  PREDICTED: putative phagocytic receptor 1b         204   3e-57    
ref|XP_010475629.1|  PREDICTED: putative phagocytic receptor 1b i...    203   3e-57    
ref|XP_008461510.1|  PREDICTED: putative phagocytic receptor 1b i...    202   4e-57    
ref|XP_010488760.1|  PREDICTED: putative phagocytic receptor 1b i...    202   5e-57    
ref|XP_008461501.1|  PREDICTED: putative phagocytic receptor 1b i...    202   5e-57    
ref|XP_002667966.1|  syntaxin SYP111                                    193   7e-57    
ref|XP_004506179.1|  PREDICTED: putative phagocytic receptor 1b-like    203   8e-57    
ref|XP_008461519.1|  PREDICTED: putative phagocytic receptor 1b i...    201   9e-57    
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...    202   1e-56    
ref|XP_009592973.1|  PREDICTED: putative phagocytic receptor 1b         202   2e-56    
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...    202   2e-56    
ref|XP_009052622.1|  hypothetical protein LOTGIDRAFT_174735             200   3e-56    
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...    201   3e-56    
emb|CDX93569.1|  BnaA06g04790D                                          201   4e-56    
gb|EYU26707.1|  hypothetical protein MIMGU_mgv1a002565mg                202   5e-56    
ref|XP_009148093.1|  PREDICTED: putative phagocytic receptor 1b i...    201   5e-56    
ref|XP_009148094.1|  PREDICTED: putative phagocytic receptor 1b i...    201   6e-56    
ref|XP_002181450.1|  predicted protein                                  200   6e-56    
ref|XP_004363702.2|  transmembrane 9 superfamily member 1               201   6e-56    
emb|CAD47840.1|  putative phagocytic receptor 1b                        200   1e-55    
ref|XP_007132435.1|  hypothetical protein PHAVU_011G094100g             200   1e-55    
ref|XP_010105528.1|  Putative phagocytic receptor 1b                    200   2e-55    
ref|XP_003540797.1|  PREDICTED: putative phagocytic receptor 1b-like    198   3e-55    
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1    198   5e-55    
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1    198   5e-55    
ref|XP_002167759.2|  PREDICTED: transmembrane 9 superfamily membe...    197   1e-54    
ref|XP_006008362.1|  PREDICTED: transmembrane 9 superfamily member 1    195   2e-54    
ref|XP_010521658.1|  PREDICTED: putative phagocytic receptor 1b i...    196   2e-54    
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1    196   2e-54    
ref|XP_011007160.1|  PREDICTED: transmembrane 9 superfamily member 5    196   3e-54    
ref|XP_006384818.1|  hypothetical protein POPTR_0004s21340g             196   3e-54    
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...    195   5e-54    
emb|CBY36864.1|  unnamed protein product                                193   1e-53    
dbj|BAD94118.1|  putative endosomal protein                             182   1e-53    
ref|XP_004352299.1|  TM9 protein B                                      195   3e-53    
ref|XP_002114082.1|  hypothetical protein TRIADDRAFT_37943              191   1e-52    
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1    192   1e-52    
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1    194   1e-52    
emb|CDQ70386.1|  unnamed protein product                                191   1e-52    
gb|KJB55631.1|  hypothetical protein B456_009G086000                    191   1e-52    
emb|CDP06928.1|  unnamed protein product                                191   2e-52    
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...    191   2e-52    
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1    191   2e-52    
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1    191   3e-52    
ref|XP_010271660.1|  PREDICTED: putative phagocytic receptor 1b         191   3e-52    
ref|XP_009024297.1|  hypothetical protein HELRODRAFT_157541             190   4e-52    
ref|XP_007255923.1|  PREDICTED: transmembrane 9 superfamily member 1    190   5e-52    
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1    190   6e-52    
ref|XP_008305730.1|  PREDICTED: transmembrane 9 superfamily member 1    190   7e-52    
gb|ERG78947.1|  transmembrane 9 superfamily member 1                    189   1e-51    
ref|XP_010739918.1|  PREDICTED: transmembrane 9 superfamily membe...    187   1e-51    
gb|KDO36860.1|  hypothetical protein CISIN_1g029473mg                   179   1e-51    
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                   188   2e-51    
ref|XP_002893816.1|  predicted protein                                  175   3e-51    
ref|XP_003967994.1|  PREDICTED: transmembrane 9 superfamily member 1    187   5e-51    
ref|XP_010739917.1|  PREDICTED: transmembrane 9 superfamily membe...    187   8e-51    
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...    186   1e-50    
gb|KFM65197.1|  Transmembrane 9 superfamily member 1                    177   3e-50    
ref|XP_002401275.1|  endosomal membrane protein EMP70, putative         184   3e-50    
ref|NP_001003550.1|  transmembrane 9 superfamily member 1               185   4e-50    
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1    184   5e-50    
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...    184   5e-50    
ref|XP_011420426.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    184   6e-50    
emb|CBY22138.1|  unnamed protein product                                184   6e-50    
ref|XP_007065454.1|  PREDICTED: transmembrane 9 superfamily member 1    183   7e-50    
ref|XP_005290178.1|  PREDICTED: transmembrane 9 superfamily member 1    183   7e-50    
ref|XP_006739630.1|  PREDICTED: transmembrane 9 superfamily membe...    182   8e-50    
ref|XP_004421248.1|  PREDICTED: transmembrane 9 superfamily membe...    182   8e-50    
gb|EAW66074.1|  transmembrane 9 superfamily member 1, isoform CRA_b     181   1e-49    
ref|XP_007444445.1|  PREDICTED: transmembrane 9 superfamily member 1    182   1e-49    
ref|XP_006883245.1|  PREDICTED: transmembrane 9 superfamily membe...    182   1e-49    
ref|XP_007947408.1|  PREDICTED: transmembrane 9 superfamily membe...    182   1e-49    
ref|XP_001380199.1|  PREDICTED: transmembrane 9 superfamily membe...    183   2e-49    
ref|XP_012036327.1|  PREDICTED: transmembrane 9 superfamily membe...    184   2e-49    
ref|XP_004055038.1|  PREDICTED: transmembrane 9 superfamily membe...    182   2e-49    
ref|XP_007984500.1|  PREDICTED: transmembrane 9 superfamily membe...    181   2e-49    
ref|NP_001275935.1|  transmembrane 9 superfamily member 1 isoform c     181   2e-49    
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1    183   2e-49    
dbj|BAG65421.1|  unnamed protein product                                181   2e-49    
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1    182   3e-49    
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1    182   3e-49    
gb|AAH07187.1|  Tm9sf1 protein                                          181   3e-49    
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...    182   3e-49    
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...    182   3e-49    
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...    182   3e-49    
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1    182   4e-49    
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...    182   4e-49    
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...    182   4e-49    
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...    182   5e-49    
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1    182   5e-49    
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...    181   5e-49    
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor     182   5e-49    
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1    182   5e-49    
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...    182   5e-49    
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...    182   5e-49    
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1    182   5e-49    
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...    182   5e-49    
ref|XP_007447941.1|  PREDICTED: transmembrane 9 superfamily membe...    182   6e-49    
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...    182   6e-49    
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...    182   6e-49    
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...    182   6e-49    
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1    182   6e-49    
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...    182   6e-49    
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1    182   6e-49    
ref|XP_006739629.1|  PREDICTED: transmembrane 9 superfamily membe...    181   6e-49    
ref|XP_001490063.1|  PREDICTED: transmembrane 9 superfamily member 1    181   6e-49    
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...    181   6e-49    
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...    181   7e-49    
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1    181   7e-49    
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...    181   7e-49    
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...    182   7e-49    
ref|XP_006809561.1|  PREDICTED: transmembrane 9 superfamily membe...    181   7e-49    
gb|KDO42648.1|  hypothetical protein CISIN_1g040008mg                   173   7e-49    
ref|XP_007947407.1|  PREDICTED: transmembrane 9 superfamily membe...    181   8e-49    
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...    181   8e-49    
ref|NP_001121353.1|  transmembrane 9 superfamily member 1               181   8e-49    
ref|XP_006779604.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    180   8e-49    
ref|XP_003457937.2|  PREDICTED: transmembrane 9 superfamily membe...    181   8e-49    
ref|XP_004575210.1|  PREDICTED: transmembrane 9 superfamily membe...    181   8e-49    
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...    181   8e-49    
ref|XP_005754693.1|  PREDICTED: transmembrane 9 superfamily membe...    181   9e-49    
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...    180   9e-49    
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...    181   1e-48    
emb|CCI39563.1|  unnamed protein product                                180   1e-48    
emb|CCA19624.1|  endomembrane protein 70like protein putative           181   1e-48    
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...    182   1e-48    
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor     181   1e-48    
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1    181   1e-48    
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...    180   2e-48    
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...    181   2e-48    
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1    181   2e-48    
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1    181   2e-48    
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...    181   2e-48    
ref|XP_005370493.1|  PREDICTED: transmembrane 9 superfamily membe...    181   2e-48    
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...    181   2e-48    
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor     180   2e-48    
ref|XP_003502106.1|  PREDICTED: transmembrane 9 superfamily member 1    180   2e-48    
ref|XP_008156682.1|  PREDICTED: transmembrane 9 superfamily membe...    180   2e-48    
gb|ETO29447.1|  EMP/nonaspanin domain family protein                    174   2e-48    
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...    182   2e-48    
ref|XP_004661882.1|  PREDICTED: transmembrane 9 superfamily member 1    180   2e-48    
ref|XP_005085662.1|  PREDICTED: transmembrane 9 superfamily member 1    180   2e-48    
ref|XP_005859645.1|  PREDICTED: transmembrane 9 superfamily membe...    180   2e-48    
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...    181   2e-48    
ref|XP_006102307.1|  PREDICTED: transmembrane 9 superfamily membe...    180   2e-48    
ref|XP_006835460.1|  PREDICTED: charged multivesicular body prote...    179   2e-48    
ref|XP_006988599.1|  PREDICTED: transmembrane 9 superfamily membe...    180   2e-48    
ref|XP_004647518.1|  PREDICTED: transmembrane 9 superfamily member 1    180   2e-48    
ref|NP_083056.2|  transmembrane 9 superfamily member 1 precursor        180   2e-48    



>gb|KJB15314.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=281

 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  70   NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  129

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  130  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  189

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  190  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  249

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFL+LGTVGFRASLFFVRHIYRSIKCE
Sbjct  250  CICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  281



>gb|KJB15315.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=290

 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  79   NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  138

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  139  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  198

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  199  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  258

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFL+LGTVGFRASLFFVRHIYRSIKCE
Sbjct  259  CICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  290



>emb|CDP01680.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 207/212 (98%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  383  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  443  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  503  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CY FFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  563  CVCYAFFLMLGTVGFRAALFFVRHIYRSIKCE  594



>ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 210/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  382  NSVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  442  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  593



>ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=594

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 210/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  383  NSVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  443  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  503  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  563  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  594



>dbj|BAH20237.1| AT2G01970 [Arabidopsis thaliana]
Length=311

 Score =   347 bits (891),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  100  NTVAIAYSATAALPFGTIIVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  159

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  160  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  219

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  220  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  279

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  280  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  311



>ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=598

 Score =   357 bits (917),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 210/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  387  NSVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  446

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  447  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  506

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  507  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  566

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  567  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  598



>ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=598

 Score =   357 bits (916),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 210/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  387  NSVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  446

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  447  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  506

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  507  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  566

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  567  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  598



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 207/212 (98%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>emb|CDP01681.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  384  NTVAIAYRATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  444  PPLPWYRSTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  504  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  564  CVCYGFFLMLGTVGFRAALFFVRHIYRSIKCE  595



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score =   354 bits (909),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  349  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  408

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  409  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  468

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  469  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  528

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFL+LGTVGFRASLFFVRHIYRSIKCE
Sbjct  529  CICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  560



>ref|XP_009631354.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
 ref|XP_009631355.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=596

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  385  NTVAIAYHATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  445  PQLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  505  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  565  CICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>ref|XP_009785097.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=596

 Score =   355 bits (911),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  385  NTVAIAYHATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  445  PQLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  505  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  565  CICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   355 bits (910),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
Length=592

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYHATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CY FFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  561  CVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  592



>ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=593

 Score =   354 bits (909),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAI YSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  382  NSVAIGYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  442  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILVIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGNVGFRAALFFVRHIYRSIKCE  593



>gb|AAF79217.1|AC006917_2 F10B6.3 [Arabidopsis thaliana]
Length=336

 Score =   346 bits (887),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  125  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  184

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  185  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  244

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  245  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  304

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  305  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  336



>ref|XP_006292411.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
 gb|EOA25309.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
Length=592

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVIFLIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIFLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAVGFRAALLFVRHIYRSIKCE  592



>ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAI YSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  382  NSVAIGYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+LFFVRHIYRS+KCE
Sbjct  562  CICYGFFLMLGNVGFRAALFFVRHIYRSVKCE  593



>gb|KJB60873.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=537

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  326  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  385

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  386  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  445

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  446  ITVALTYFQLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  505

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  506  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  537



>ref|XP_006448062.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61302.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=531

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  320  NTVAIAYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  379

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  380  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  439

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  440  ITVALTYFQLAAEDHEWWWRSFLCGGSTGAFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  499

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  500  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  531



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  383  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  443  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  503  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFL+LGTVGFRASLFFVRHIYRSIKCE
Sbjct  563  CICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  594



>gb|KFK33411.1| hypothetical protein AALP_AA5G009400 [Arabis alpina]
Length=592

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_012072398.1| PREDICTED: transmembrane 9 superfamily member 2-like [Jatropha 
curcas]
 gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 207/212 (98%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  380  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR ALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PQLPWYRSALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE
Sbjct  560  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  591



>ref|XP_010105529.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXC05024.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=591

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  380  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  560  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  591



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  418  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  477

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  478  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  537

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSF+CGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  538  ITVALTYFQLAAEDHEWWWRSFVCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  597

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE
Sbjct  598  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  629



>ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYTATAALPFGTIVVILLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>gb|KHG09925.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYKATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRKTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYY ARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYNARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAIGFRASLLFVRHIYRSIKCE  592



>gb|KJB08470.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   352 bits (904),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYKATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRKTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY ARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYTYCLYYYNARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAIGFRASLLFVRHIYRSIKCE  592



>emb|CDY52038.1| BnaA08g31510D [Brassica napus]
Length=480

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  269  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  328

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  329  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  388

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  389  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  448

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  449  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  480



>emb|CDY03085.1| BnaC07g21420D [Brassica napus]
Length=535

 Score =   350 bits (899),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  324  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  383

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  384  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  443

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  444  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  503

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  504  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  535



>gb|KJB60874.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=594

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  383  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  443  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  503  ITVALTYFQLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  563  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  594



>emb|CDY56297.1| BnaC09g52300D [Brassica napus]
Length=535

 Score =   350 bits (898),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  324  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  383

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  384  PQLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  443

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  444  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  503

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE
Sbjct  504  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  535



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  383  NTVAIAYRATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  443  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  503  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  563  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  594



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score =   352 bits (903),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 206/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  383  NTVAIAYRATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  443  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  503  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  563  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  594



>ref|XP_006448061.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 ref|XP_006492286.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492287.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR61301.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=593

 Score =   352 bits (903),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  382  NTVAIAYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGAFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  593



>ref|XP_011038404.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
 ref|XP_011038405.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
Length=592

 Score =   352 bits (903),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PQLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGT+GFRASLFFVRHIYRSIKCE
Sbjct  561  CVCYGFFLMLGTIGFRASLFFVRHIYRSIKCE  592



>gb|KHG03505.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN+KAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYKATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNTKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  LPQMAMAGFLPFSAIYIELYYIF+SVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRQTLPQMAMAGFLPFSAIYIELYYIFSSVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVA+TYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYY ARSDMSGFMQTSFFFGYMA
Sbjct  501  VTVAMTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYNARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GFRASLFFVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAIGFRASLFFVRHIYRSIKCE  592



>ref|XP_011038406.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=592

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PQLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG++GFRASLFFVRHIYRSIKCE
Sbjct  561  CVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_006372421.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50218.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=592

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PQLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG++GFRASLFFVRHIYRSIKCE
Sbjct  561  CVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_009110524.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  378  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  438  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>emb|CDX84018.1| BnaC08g16270D [Brassica napus]
Length=589

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  378  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  438  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>emb|CDY52035.1| BnaA08g31480D [Brassica napus]
Length=589

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  378  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  438  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>gb|KHN43674.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  377  NTVAIAYKATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  437  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  557  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  588



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  314  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  373

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  374  PQLPWYRSTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  433

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  434  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  493

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  494  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  525



>ref|XP_008220963.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=591

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  380  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PPLPWYRTTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY+SIKCE
Sbjct  560  CICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  591



>ref|XP_007225615.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
 gb|EMJ26814.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
Length=591

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  380  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PPLPWYRTTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY+SIKCE
Sbjct  560  CICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  591



>ref|XP_006470811.1| PREDICTED: putative phagocytic receptor 1b-like [Citrus sinensis]
Length=593

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  382  NTVAIAYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIY+SIKCE
Sbjct  562  CVCYGFFLMLGTVGFRASLLFVRHIYKSIKCE  593



>ref|XP_006431397.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44637.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=593

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  382  NTVAIAYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIY+SIKCE
Sbjct  562  CVCYGFFLMLGTVGFRASLLFVRHIYKSIKCE  593



>gb|AFK33397.1| unknown [Medicago truncatula]
Length=419

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  208  NTVAIVYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  267

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRGA+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  268  PPLPWYRGAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  327

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL AEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQT FFFGYMA
Sbjct  328  ITVALTYFQLVAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTPFFFGYMA  387

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CIC+GFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  388  CICFGFFLMLGTVGFRAALFFVRHIYRSIKCE  419



>ref|XP_006365862.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=588

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 200/212 (94%), Positives = 209/212 (99%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAI+Y+ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  377  NSVAISYTATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP PWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  437  PPSPWYRGTMPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRA+LFFVRHIYRSIKCE
Sbjct  557  CICYGFFLMLGSVGFRAALFFVRHIYRSIKCE  588



>ref|XP_003620064.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES76282.1| transmembrane 9 family protein [Medicago truncatula]
Length=588

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  377  NTVAIVYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRGA+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  437  PPLPWYRGAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CIC+GFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  557  CICFGFFLMLGTVGFRAALFFVRHIYRSIKCE  588



>gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana]
Length=546

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  335  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  394

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  395  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  454

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  455  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  514

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  515  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  546



>ref|XP_004515238.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIVYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  592



>ref|XP_002876790.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53049.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>emb|CDY15803.1| BnaC02g34220D [Brassica napus]
Length=592

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_009110529.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 208/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  378  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMA+AGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  438  PPLPWYRSAIPQMAIAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>ref|XP_006283389.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 ref|XP_006283390.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16287.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16288.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
Length=590

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  379  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL +VF+IL+IVTAF
Sbjct  439  PPLRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSVVFLILVIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  499  ITIALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GFRASL FVRHIYRSIKCE
Sbjct  559  CICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  590



>ref|XP_006372422.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP50219.1| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAITYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PQLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG++GFRASLFFVRHIYRSIKCE
Sbjct  561  CVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9ZPS7.1|TMN3_ARATH RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=Endomembrane protein 9; AltName: Full=Transmembrane nine 
protein 3; Short=AtTMN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana]
 dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIIVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y ATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  382  NTVAIVYHATAALPFGTIMVILLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  442  PSLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  593



>ref|XP_006395825.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
 gb|ACQ90591.1| putative transmembrane transporter [Eutrema halophilum]
 gb|ESQ33111.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
Length=592

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>gb|AFK34316.1| unknown [Medicago truncatula]
Length=381

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVTSPLLVLGGIAGKNSK EFQAP RTTKYPREI
Sbjct  170  NTVAIAYSATAALPFGTICVIVLIWTLVTSPLLVLGGIAGKNSKTEFQAPVRTTKYPREI  229

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL IVTAF
Sbjct  230  PPLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILSIVTAF  289

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  290  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  349

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFF MLG+VGFRASL FVRHIYRSIKCE
Sbjct  350  CICYGFFFMLGSVGFRASLLFVRHIYRSIKCE  381



>ref|XP_010917284.1| PREDICTED: transmembrane 9 superfamily member 2-like [Elaeis 
guineensis]
Length=596

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  385  NTVAIIYSATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  445  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  505  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGT+GFRA+L FVRHIYRSIKCE
Sbjct  565  CVCYGFFLMLGTIGFRAALLFVRHIYRSIKCE  596



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVI LIW+LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  375  NTVAIAYKATAALPFGTIVVIVLIWSLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  434

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  435  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  494

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  495  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  554

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  555  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  586



>gb|KFK43715.1| hypothetical protein AALP_AA1G163400 [Arabis alpina]
Length=592

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>emb|CDY41095.1| BnaC05g10860D [Brassica napus]
Length=589

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK+EFQAPCRTTKYPRE+
Sbjct  378  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKSEFQAPCRTTKYPREV  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR ALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  438  PPLPWYRSALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  589



>ref|XP_006307070.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
 gb|EOA39968.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
Length=592

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010476529.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  379  NTVAIVYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  439  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  499  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  559  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  590



>ref|XP_010496367.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVI LIW+LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  376  NTVAIAYKATAALPFGTIVVIVLIWSLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  435

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  436  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  495

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  496  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYTYCLYYYYARSDMSGFMQTSFFFGYMA  555

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  556  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  587



>ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q940S0.1|TMN2_ARATH RecName: Full=Transmembrane 9 superfamily member 2; AltName: 
Full=Endomembrane protein 8; AltName: Full=Transmembrane nine 
protein 2; Short=AtTMN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana]
 gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana]
 gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010036999.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48635.1| hypothetical protein EUGRSUZ_K02293 [Eucalyptus grandis]
Length=592

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTI+VI LIW LVTSPLL+LGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYTATAALPFGTILVIVLIWTLVTSPLLILGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILF+VFIILLIVTAF
Sbjct  441  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFVVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L F+RHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFIRHIYRSIKCE  592



>ref|XP_006416990.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
 gb|ESQ35343.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
Length=592

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010458976.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTIGFRAALLFVRHIYRSIKCE  592



>ref|XP_010502204.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTS+FFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSYFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFR+SL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAVGFRSSLLFVRHIYRSIKCE  592



>emb|CDX81659.1| BnaC08g39420D [Brassica napus]
Length=589

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  378  NTVAITYTATAALPFGTIVVIALIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  438  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHQWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  589



>ref|XP_003524839.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
 gb|KHN25962.1| Putative phagocytic receptor 1b [Glycine soja]
Length=601

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAP RTTKYPREI
Sbjct  390  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKTEFQAPVRTTKYPREI  449

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  450  PPLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  509

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  510  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  569

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRASL FVRHIYRSIKCE
Sbjct  570  CICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  601



>ref|XP_002305925.2| endomembrane protein 70 [Populus trichocarpa]
 gb|EEE86436.2| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PLLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG++GFRASLFFVRHIY SIKCE
Sbjct  561  CVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_010513951.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
 ref|XP_010424990.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTS+FFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGVFIYAYCLYYYYARSDMSGFMQTSYFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFR+SL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAVGFRSSLLFVRHIYRSIKCE  592



>ref|XP_002521899.1| transporter, putative [Ricinus communis]
 gb|EEF40535.1| transporter, putative [Ricinus communis]
Length=592

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLL+LGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLILGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR ALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  441  PQLPWYRSALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILVIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYY+ARS+MSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYHARSEMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASLFFVRHIY+SIKCE
Sbjct  561  CICYGFFLMLGTVGFRASLFFVRHIYKSIKCE  592



>ref|XP_002285238.1| PREDICTED: transmembrane 9 superfamily member 2 [Vitis vinifera]
 emb|CBI26762.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  380  NTVAIIYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PALPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  560  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  591



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPRE+
Sbjct  377  NTVAIIYSATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREV  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR ALPQM MAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  437  PQLPWYRSALPQMGMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  557  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  588



>ref|XP_006384123.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
 gb|ERP61920.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
Length=592

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PLLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG++GFRASLFFVRHIY SIKCE
Sbjct  561  CVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE  592



>gb|KHN28892.1| Putative phagocytic receptor 1b [Glycine soja]
Length=604

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAP RTTKYPREI
Sbjct  393  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKTEFQAPVRTTKYPREI  452

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  453  PPLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  512

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  513  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  572

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRASL FVRHIYRSIKCE
Sbjct  573  CICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  604



>gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata]
Length=592

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYHATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY+YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYSYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CY FFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  561  CVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  592



>ref|XP_006352389.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352390.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAI Y ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  385  NSVAIGYHATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPTRTTKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  445  PQLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSF+CGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  505  ITVALTYFQLAAEDHEWWWRSFVCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  565  CICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>ref|XP_003531127.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=604

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAP RTTKYPREI
Sbjct  393  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKTEFQAPVRTTKYPREI  452

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  453  PPLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  512

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  513  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  572

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRASL FVRHIYRSIKCE
Sbjct  573  CICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  604



>ref|XP_010066537.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW64446.1| hypothetical protein EUGRSUZ_G02064 [Eucalyptus grandis]
Length=598

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY++TAALPFGTIVVIFLIW LVT+PLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  387  NTVAIAYNSTAALPFGTIVVIFLIWTLVTAPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  446

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  447  PPLPWYRSTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  506

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  507  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  566

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRASL FVRHIY+SIKCE
Sbjct  567  CICYGFFLMLGMVGFRASLLFVRHIYKSIKCE  598



>ref|XP_010554368.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=592

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PLLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_011005913.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005914.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PLLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG++GFRASLFFVRHIY SIKCE
Sbjct  561  CVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_008393472.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=593

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  382  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRATIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYTYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>ref|XP_004250237.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
 ref|XP_010312729.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=596

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAI Y ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  385  NSVAIGYHATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPTRTTKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  445  PQLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSF+CGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  505  ITVALTYFQLAAEDHEWWWRSFVCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  565  CICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>ref|XP_011005915.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005916.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVIFLIWALVT+PLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAITYSATAALPFGTIVVIFLIWALVTTPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PLLPWYRKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGF QTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFRQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG++GFRASLFFVRHIYRSIKCE
Sbjct  561  CVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_009355975.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=593

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  382  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRATIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>ref|XP_007031333.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY02259.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=561

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY  TAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  350  NTVAIAYKTTAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  409

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWY   LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIV IILLIVTAF
Sbjct  410  PPLPWYCKTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVVIILLIVTAF  469

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLY Y ARSDMSGFMQTSFFFG MA
Sbjct  470  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYSYNARSDMSGFMQTSFFFGCMA  529

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GFRASLFFVRHIYRSIKCE
Sbjct  530  CICYGFFLMLGAIGFRASLFFVRHIYRSIKCE  561



>ref|XP_012072397.1| PREDICTED: transmembrane 9 superfamily member 2 [Jatropha curcas]
 gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas]
Length=591

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 204/212 (96%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  380  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR ALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PQLPWYRSALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHGWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  560  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  591



>ref|XP_010435562.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=589

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  378  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  438  PPLRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG++GFRASL FVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGSIGFRASLLFVRHIYRSIKCE  589



>ref|XP_008375035.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=611

 Score =   348 bits (893),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  400  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  459

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  460  PPLPWYRATIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  519

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  520  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  579

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  580  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  611



>ref|XP_007152616.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
 gb|ESW24610.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
Length=594

 Score =   347 bits (891),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAP RTTKYPREI
Sbjct  383  NTVAIAYKATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKVEFQAPVRTTKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  443  PPLPWYRGPIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  503  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  563  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  594



>ref|XP_007158822.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
 gb|ESW30816.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
Length=592

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSK+EFQAP RTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTILVIVLIWTLVTSPLLVLGGIAGKNSKSEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  592



>ref|XP_011463508.1| PREDICTED: transmembrane 9 superfamily member 2 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   347 bits (890),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 200/212 (94%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVT+PLLVLGGIAGKNSKAEF APCRTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIVVIVLIWTLVTAPLLVLGGIAGKNSKAEFHAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVF+ILLIVTAF
Sbjct  441  PTLPWYRTTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFLILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIY+SIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALFFVRHIYKSIKCE  592



>ref|XP_007210263.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
 ref|XP_008240392.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
 gb|EMJ11462.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
Length=593

 Score =   347 bits (890),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  382  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRATIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>ref|XP_010523409.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
 ref|XP_010523411.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523412.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523413.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Tarenaya 
hassleriana]
Length=592

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYNATAALPFGTIMVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIY YC+YYYY RSDM+GFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGMFIYGYCVYYYYGRSDMTGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG++GFR+SL FVRHIY+SIKCE
Sbjct  561  CICYGFFLMLGSIGFRSSLLFVRHIYKSIKCE  592



>ref|XP_004504610.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   347 bits (889),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSK EFQAP RTTKYPREI
Sbjct  381  NTVAIAYSATAALPFGTILVIVLIWTLVTSPLLVLGGIAGKNSKTEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  592



>ref|XP_010450487.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=593

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  442  PPLRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG++GFRASL FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGSIGFRASLLFVRHIYRSIKCE  593



>ref|XP_008791844.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=596

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  385  NTVAIVYSATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  445  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  505  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYHARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFL+LG +GFRA+L FVRHIYRSIKCE
Sbjct  565  CICYGFFLLLGAIGFRAALLFVRHIYRSIKCE  596



>gb|ADQ43185.1| endomemebrane protein 70 [Schrenkiella parvula]
Length=587

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 205/212 (97%), Positives = 207/212 (98%), Gaps = 1/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  377  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  437  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWW SFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAAEDHEWWW-SFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  555

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  556  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  587



>ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=597

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 207/212 (98%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAI Y+ATAALPFGTI+VIFLIWALVTSPLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  386  NSVAIGYTATAALPFGTIMVIFLIWALVTSPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  445

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP PWYRG L QMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  446  PPSPWYRGTLSQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  505

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  506  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMA  565

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRA+LFFVRHIYRSIKCE
Sbjct  566  CICYGFFLMLGSVGFRAALFFVRHIYRSIKCE  597



>ref|XP_008462539.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Cucumis 
melo]
Length=601

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  390  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  449

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  450  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  509

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  510  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  569

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG +GFRA+L FVRHIYRSIKCE
Sbjct  570  CVCYGFFLMLGAIGFRAALLFVRHIYRSIKCE  601



>ref|XP_010527833.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=593

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PQLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSF+CGGSTG+FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFVCGGSTGVFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis 
melo]
Length=591

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  380  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG +GFRA+L FVRHIYRSIKCE
Sbjct  560  CVCYGFFLMLGAIGFRAALLFVRHIYRSIKCE  591



>ref|XP_010528590.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=595

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 205/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  384  NTVAIAYKATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNSKAEFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  444  PPLHWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILVIVTAF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  504  ITIALTYFQLAAEDHEWWWRSFLCGGSTGLFIYVYCLYYYHARSDMSGFMQTSFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GFRASL FVRHIY SIKCE
Sbjct  564  CICYGFFLMLGTIGFRASLVFVRHIYGSIKCE  595



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVT+PLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTIVVIALIWTLVTAPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILL+VTAF
Sbjct  441  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLVVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITIALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_004137376.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis sativus]
 gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus]
Length=591

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  380  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG +GFRA+L FVRHIYRSIKCE
Sbjct  560  CVCYGFFLMLGAIGFRAALLFVRHIYRSIKCE  591



>dbj|BAK08235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  170  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  229

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  230  PPLPWYRTTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  289

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  290  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  349

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  350  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  381



>ref|XP_002870515.1| transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46774.1| transporter [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP+ WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  442  PPMRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GFRASL FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGAIGFRASLLFVRHIYRSIKCE  593



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIAYHATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +CY FFLMLG VGFRASLFFVRHIYRSIKCE
Sbjct  561  SVCYAFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_004299493.1| PREDICTED: transmembrane 9 superfamily member 3-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 206/212 (97%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  388  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  447

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  448  PPLPWYRATVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  507

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  508  ITVALTYFQLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  567

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRA+L FVRHIYRSIKCE
Sbjct  568  CICYGFFLMLGSVGFRAALLFVRHIYRSIKCE  599



>ref|XP_010440841.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Camelina 
sativa]
Length=587

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  376  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  435

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  436  PPLRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  495

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVAL YFQLAAEDHEWWWRS LCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  496  ITVALAYFQLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  555

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG++GFRASL FVRHIYRSIKCE
Sbjct  556  CICYGFFLMLGSIGFRASLLFVRHIYRSIKCE  587



>ref|XP_010261665.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=644

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKN+K EFQAPCRTTKYPREI
Sbjct  433  NTVAIVYSATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNNKTEFQAPCRTTKYPREI  492

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  493  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  552

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDHEWWWRS LCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  553  ITVALTYFQLAVEDHEWWWRSVLCGGSTGVFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  612

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  613  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  644



>ref|XP_006405901.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 ref|XP_006405902.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47354.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47355.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
Length=595

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K EFQAPCRTTKYPREI
Sbjct  384  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKPEFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  444  PPLRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA+EDHEWWWRS LCGGSTGLFIYAYCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  504  ITVALTYFQLASEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMTGFMQTSFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GFRASLFFVRHIYRSIKCE
Sbjct  564  CICYGFFLMLGAIGFRASLFFVRHIYRSIKCE  595



>emb|CDY47549.1| BnaA08g07380D [Brassica napus]
Length=592

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  381  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP+ WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  441  PPMRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTG+F+YAYCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSLLCGGSTGVFVYAYCLYYYYARSDMTGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRASLFFVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_009108077.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=592

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  381  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP+ WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  441  PPMRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTG+F+YAYCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSLLCGGSTGVFVYAYCLYYYYARSDMTGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRASLFFVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_011085893.1| PREDICTED: transmembrane 9 superfamily member 2-like [Sesamum 
indicum]
Length=587

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKNSK EF APCRTTKYPRE+
Sbjct  376  NTVAIAYHATAALPFGTIVVIFLIWALVTSPLLLLGGIAGKNSKVEFHAPCRTTKYPREV  435

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  436  PTLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  495

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL AEDHEWWWRSFLCGGSTG+FIY+YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  496  ITVALTYFQLVAEDHEWWWRSFLCGGSTGIFIYSYCLYYYYARSDMSGFMQTSFFFGYMA  555

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY SIKCE
Sbjct  556  CICYGFFLMLGTVGFRAALLFVRHIYHSIKCE  587



>emb|CDY62621.1| BnaC08g46810D [Brassica napus]
Length=592

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  381  NTVAIVYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP+ WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  441  PPMRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTG+F+YAYCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHEWWWRSLLCGGSTGVFVYAYCLYYYYARSDMTGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRASLFFVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>ref|NP_198547.3| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9FHT4.1|TMN4_ARATH RecName: Full=Transmembrane 9 superfamily member 4; AltName: 
Full=Endomembrane protein 10; AltName: Full=Transmembrane nine 
protein 4; Short=AtTMN4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09103.1| endosomal protein-like [Arabidopsis thaliana]
 dbj|BAE99006.1| multispanning membrane protein - like [Arabidopsis thaliana]
 gb|AED94164.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=593

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTIVVIFLIWALVTSPLL+LGGIAGKN K+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYQATAALPFGTIVVIFLIWALVTSPLLILGGIAGKNRKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP+ WYR  LPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSIL IVF+IL+IVTAF
Sbjct  442  PPMRWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILSIVFLILVIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSLLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GF ASL FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGTIGFCASLLFVRHIYRSIKCE  593



>ref|XP_008789222.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789223.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789224.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789225.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789226.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=595

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVT PLLVLGG+AGKN K EFQAPCRTTKYPREI
Sbjct  384  NTVAIIYSATAALPFGTILVILLIWMLVTFPLLVLGGVAGKNGKVEFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFAS+WGHRIYTIYSILFIVFIILLIVTAF
Sbjct  444  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASIWGHRIYTIYSILFIVFIILLIVTAF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  504  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GFRASL FVRHIYRSIKCE
Sbjct  564  CICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  595



>ref|XP_010932502.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
 ref|XP_010932503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=597

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVT PLLVLGG+AGKNSK EFQAPCRTTKYPREI
Sbjct  386  NTVAIIYSATAALPFGTILVILLIWMLVTFPLLVLGGVAGKNSKVEFQAPCRTTKYPREI  445

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGHRIYTIYSILFIVFIILLIVTAF
Sbjct  446  PPLPWYRATIPQMAMAGFLPFSAIYIELYYIFASIWGHRIYTIYSILFIVFIILLIVTAF  505

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWR+FLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  506  ITVALTYFQLAAEDHEWWWRAFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  565

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GFRASL FVRHIYRSIKCE
Sbjct  566  CICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  597



>gb|ACR33947.1| unknown [Zea mays]
Length=467

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  256  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  315

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  316  PPLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  375

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  376  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  435

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  436  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  467



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVT+PLLVLGGIAGKNS+ EFQAPCRTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTIVVIALIWTLVTAPLLVLGGIAGKNSRTEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVF+ILLIVTAF
Sbjct  441  PPLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFLILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYY+ARSDMSGF+QTSFFFGYMA
Sbjct  501  ITIALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYHARSDMSGFLQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVT+PLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  398  NTVAIVYSATAALPFGTIIVIVLIWTLVTAPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  457

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILF+VFIILLIVTAF
Sbjct  458  PPLPWYRETIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFVVFIILLIVTAF  517

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLF+Y YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  518  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFVYGYCLYYYHARSDMSGFMQTSFFFGYMA  577

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  578  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  609



>ref|XP_008389133.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=591

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 200/212 (94%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  380  NTVAIAYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  440  PPLPWYRTTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHWWWWRSFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY+SIKCE
Sbjct  560  CICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  591



>ref|XP_009387842.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=597

 Score =   342 bits (877),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  386  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKIEFQAPCRTTKYPREI  445

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR A+PQM MAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIIL+IVTAF
Sbjct  446  PELPWYRQAIPQMIMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILIIVTAF  505

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLF+Y YC YYYYARSDMSGFMQTSFFFGYMA
Sbjct  506  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFVYGYCWYYYYARSDMSGFMQTSFFFGYMA  565

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  566  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  597



>ref|XP_009404153.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   341 bits (875),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+ YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKN+K EFQAPCRTTK+PREI
Sbjct  376  NTVAVVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNNKTEFQAPCRTTKFPREI  435

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPW+R  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIY IY ILF+VFIILL+V AF
Sbjct  436  PPLPWFRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYIIYGILFVVFIILLVVAAF  495

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLAAEDHEWWWRSFLCGGSTGLF+Y YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  496  VTVALTYFQLAAEDHEWWWRSFLCGGSTGLFVYGYCLYYYFARSDMSGFMQTSFFFGYMA  555

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGF A+LFFVRHIYRSIKCE
Sbjct  556  CICYGFFLMLGTVGFHAALFFVRHIYRSIKCE  587



>ref|XP_006854108.2| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011626941.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
Length=592

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  441  PPLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDHEWWWRS LCGGSTG+FI  YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAVEDHEWWWRSVLCGGSTGVFILGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>ref|XP_008466877.1| PREDICTED: putative phagocytic receptor 1b [Cucumis melo]
Length=602

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS+ EFQAPCRTTKYPREI
Sbjct  391  NTVAIVYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSRIEFQAPCRTTKYPREI  450

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  451  PQLPWYRSTVPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILLIVTAF  510

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL AEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  511  ITVALTYFQLTAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  570

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  571  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  602



>ref|XP_011654527.1| PREDICTED: transmembrane 9 superfamily member 2 [Cucumis sativus]
 gb|KGN49739.1| hypothetical protein Csa_5G096460 [Cucumis sativus]
Length=589

 Score =   341 bits (875),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS+ EFQAPCRTTKYPREI
Sbjct  378  NTVAIVYNATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSRIEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  438  PQLPWYRSTVPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILLIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL AEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDM+GFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLTAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMTGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+LFFVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score =   341 bits (875),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW+LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  380  NTVAIVYSATAALPFGTIVVIVLIWSLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIEL+YIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  440  PPLPWYRGTIPQMAMAGFLPFSAIYIELHYIFASVWGHKIYTIYSILFIVFIILIIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS L GGSTG FI+ YCLYYYY RSDMSGFMQTSFFFGYMA
Sbjct  500  ITVALTYFQLAAEDHEWWWRSLLYGGSTGFFIFGYCLYYYYVRSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  560  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  591



>ref|XP_006649701.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=467

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  256  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  315

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  316  PPLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  375

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  376  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  435

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG +GFRA+LFFVRHIY+SIKCE
Sbjct  436  CICYAFFLMLGMIGFRAALFFVRHIYKSIKCE  467



>ref|XP_006849485.2| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011625259.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011625260.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
Length=595

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW+LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  384  NTVAIVYSATAALPFGTIVVIVLIWSLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIEL+YIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  444  PPLPWYRGTIPQMAMAGFLPFSAIYIELHYIFASVWGHKIYTIYSILFIVFIILIIVTAF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS L GGSTG FI+ YCLYYYY RSDMSGFMQTSFFFGYMA
Sbjct  504  ITVALTYFQLAAEDHEWWWRSLLYGGSTGFFIFGYCLYYYYVRSDMSGFMQTSFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  564  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  595



>ref|XP_009419338.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=593

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAPCRT K+PREI
Sbjct  382  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKNEFQAPCRTKKFPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG LPQMAMAGFLPFSAIYIELYYIFASVWGH IYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRGTLPQMAMAGFLPFSAIYIELYYIFASVWGHSIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLAAEDHEWWWRSFLCGGSTG+F+YAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITIALTYFQLAAEDHEWWWRSFLCGGSTGVFVYAYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  562  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  593



>gb|AHA84153.1| phagocytic receptor 1b [Phaseolus vulgaris]
Length=588

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 202/212 (95%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY  TAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAP RTTKYPREI
Sbjct  377  NTVAIAYKGTAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKVEFQAPVRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  437  PPLPWYRGPIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIYRSIKCE
Sbjct  557  CICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  588



>ref|XP_009389646.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=599

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKA+FQAPCRT KYPREI
Sbjct  388  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKADFQAPCRTAKYPREI  447

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQM MAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  448  PPLPWYRQTIPQMIMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  507

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTGLF+Y YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  508  ITVALTYFQLAAEDHEWWWRSFLCGGSTGLFVYGYCLYYYHARSDMSGFMQTSFFFGYMA  567

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  568  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  599



>gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  420  NTVAIVYSATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  479

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  480  PPLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  539

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDHEWWWRS LCGGSTG+FI  YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  540  ITVALTYFQLAVEDHEWWWRSVLCGGSTGVFILGYCLYYYYARSDMSGFMQTSFFFGYMA  599

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  600  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  631



>gb|EMS68537.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=540

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  329  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  388

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  389  PPLPWYRTTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  448

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  449  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  508

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  509  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  540



>ref|NP_001151315.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN28721.1| unknown [Zea mays]
 gb|AFW89069.1| transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRASLFFVRHIY+SIKCE
Sbjct  562  CICYAFFLMLGMVGFRASLFFVRHIYKSIKCE  593



>ref|XP_003558407.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=593

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRTTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  562  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>gb|ABK24901.1| unknown [Picea sitchensis]
Length=585

 Score =   339 bits (870),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  374  NTVAIAYNATAALPFGTIVVILLIWTLVTSPLLVLGGIAGKNSKVEFQAPCRTTKYPREI  433

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  434  PTLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  493

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWRS LCGGSTG+FI+ YCLYYY+ARSDM+GFMQTSFFFGYM 
Sbjct  494  ITIALTYFQLAVEDHEWWWRSVLCGGSTGVFIFGYCLYYYFARSDMNGFMQTSFFFGYMT  553

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  554  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  585



>ref|XP_008340538.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=592

 Score =   340 bits (871),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAP RTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PTLPWYRTTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHGWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY+SIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  592



>ref|XP_010920041.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=588

 Score =   339 bits (870),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  377  NTVAIAYNATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  437  PQLPWYRGTVPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDHEWWWRS LCGGSTG+FI+ YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAVEDHEWWWRSVLCGGSTGIFIFFYCLYYYHARSDMSGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FV+HIYRSIKCE
Sbjct  557  CICYGFFLMLGTVGFRASLLFVQHIYRSIKCE  588



>ref|XP_008788644.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008788651.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=588

 Score =   339 bits (870),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY ATAALPFGTI+VI LIW LVTSPLLVLGGI+GKNSK EFQAPCRTTKYPREI
Sbjct  377  NTVAIAYKATAALPFGTILVIILIWMLVTSPLLVLGGISGKNSKTEFQAPCRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  437  PQLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDHEWWWRS LCGGSTG+FI+ YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  497  ITVALTYFQLAVEDHEWWWRSVLCGGSTGIFIFFYCLYYYHARSDMSGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  557  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  588



>ref|NP_001148980.1| LOC100282600 precursor [Zea mays]
 gb|ACG33705.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 tpg|DAA44288.1| TPA: transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   339 bits (870),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  562  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>gb|ACG42357.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
Length=593

 Score =   339 bits (870),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYS+TAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSSTAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRASLFFVRHIY+SIKCE
Sbjct  562  CICYAFFLMLGMVGFRASLFFVRHIYKSIKCE  593



>gb|AGT15903.1| transmembrane 9 superfamily protein [Saccharum hybrid cultivar 
R570]
Length=593

 Score =   339 bits (870),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRKTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  562  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>ref|NP_001148367.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACG31130.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN29105.1| unknown [Zea mays]
 gb|AFW57246.1| putative Transmembrane 9 family protein member 1 [Zea mays]
Length=589

 Score =   339 bits (869),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  378  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSDTEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  438  PQLPWYRSTVPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  498  VTVALTYFQLAVEDHQWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASLFFVRHIYRSIKCE
Sbjct  558  CVCYGFFLMLGTVGFRASLFFVRHIYRSIKCE  589



>ref|XP_009351612.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=592

 Score =   339 bits (869),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKN+KAEFQAP RTTKYPREI
Sbjct  381  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNTKAEFQAPVRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PTLPWYRTTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  501  ITVALTYFQLAAEDHGWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY+SIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  592



>gb|ABR16201.1| unknown [Picea sitchensis]
Length=585

 Score =   338 bits (868),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNS+AEFQAPCRTTKYPREI
Sbjct  374  NTVAIAYNATAALPFGTILVILLIWTLVTSPLLVLGGIAGKNSRAEFQAPCRTTKYPREI  433

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  434  PPLPWYRGTVPQMAMAGFLPFSAIYIELYYIFASLWGHKIYTIYSILFIVFIILIIVTAF  493

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDM+GFMQTSFFFGYM 
Sbjct  494  ITIALTYFQLAVEDHQWWWRSVLCGGSTGVFIFGYCVYYYFARSDMTGFMQTSFFFGYMT  553

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  554  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  585



>dbj|BAJ89640.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32275.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=593

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRTTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  562  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_004985073.1| PREDICTED: putative phagocytic receptor 1b-like [Setaria italica]
Length=593

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  382  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  442  PPLPWYRQTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  502  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  562  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_002468203.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
 gb|EER95201.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
Length=595

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK+EFQAPCRTTKYPREI
Sbjct  384  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKSEFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  444  PPLPWYRRTVPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  504  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  564  CICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  595



>dbj|BAC57816.1| putative syntaxin SYP111 [Oryza sativa Japonica Group]
Length=589

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCR+TKYPREI
Sbjct  378  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRSTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  438  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  498  VTVALTYFQLAVEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  558  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  589



>ref|NP_001049492.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|AAO06970.1| Putative endosomal protein [Oryza sativa Japonica Group]
 gb|ABF94848.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11406.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|EAZ26202.1| hypothetical protein OsJ_10070 [Oryza sativa Japonica Group]
 dbj|BAG89207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTKYPREI
Sbjct  384  NTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKTEFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  444  PPLPWYRQTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  504  ITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG +GFRA+LFFVRHIY+SIKCE
Sbjct  564  CICYAFFLMLGMIGFRAALFFVRHIYKSIKCE  595



>ref|XP_010276746.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=590

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVT+PLLVLGGIAGKNS  EFQAPC TTKYPREI
Sbjct  379  NTVAIVYSATAALPFGTILVILLIWTLVTTPLLVLGGIAGKNSSTEFQAPCHTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  439  PPLPWYRGTIPQMVMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDHEWWWRS LCGGSTG+FIY YC++YY+ARSDMSGFMQTSFFFGYMA
Sbjct  499  ITVALTYFQLAVEDHEWWWRSVLCGGSTGVFIYGYCIFYYFARSDMSGFMQTSFFFGYMA  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  559  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>gb|EPS73142.1| hypothetical protein M569_01612 [Genlisea aurea]
Length=540

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY +TAALPFGTIVVIFLIWALVTSPL VLGGIAGK+SKAEFQAPCRTTKYPREI
Sbjct  329  NTVAIAYRSTAALPFGTIVVIFLIWALVTSPLFVLGGIAGKSSKAEFQAPCRTTKYPREI  388

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILF+VFIILLIVTAF
Sbjct  389  PSLPWYRRTLPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFVVFIILLIVTAF  448

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLFIY YC+YYYYARSDMSGFMQTSFFFGYMA
Sbjct  449  ITVALTYFQLAAEDHGWWWRSFLCGGSTGLFIYGYCIYYYYARSDMSGFMQTSFFFGYMA  508

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +CYGFFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  509  SVCYGFFLMLGGVGFRAALFFVRHIYRSIKCE  540



>ref|XP_004972769.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Setaria 
italica]
Length=589

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  378  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  438  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  498  VTVALTYFQLAVEDHQWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLML TVGFRASLFFVRHIYRSIKCE
Sbjct  558  CVCYGFFLMLSTVGFRASLFFVRHIYRSIKCE  589



>ref|XP_003573450.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=588

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  377  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRTTKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  437  PELPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  497  VTVALTYFQLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  557  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  588



>ref|XP_006659860.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=590

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  379  NTVAIAYSATAALPFGTIVVIILIWVLVTSPLLVLGGIAGKNSNTEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  439  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  499  VTVALTYFQLAVEDHEWWWRSILCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  559  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>gb|EEC82941.1| hypothetical protein OsI_27915 [Oryza sativa Indica Group]
Length=592

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCR+TKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRSTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  441  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  501  VTVALTYFQLAVEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  561  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>ref|XP_010910473.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=590

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NT+AI YSATAALPFGTI+VI LIWALVT PLLVLGGIAGKNS+ EFQAPCRTTKYPREI
Sbjct  379  NTIAIVYSATAALPFGTILVIILIWALVTLPLLVLGGIAGKNSRTEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  439  PQLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVA+TYFQLAAEDHEWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  499  ITVAMTYFQLAAEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  559  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_010523530.1| PREDICTED: putative phagocytic receptor 1b, partial [Tarenaya 
hassleriana]
Length=277

 Score =   327 bits (837),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 202/210 (96%), Gaps = 1/210 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  61   NTVAIAYNATAALPFGTIMVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  120

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  121  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  180

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIY YC+YYYY RSDM+GFMQTSFFFGYMA
Sbjct  181  ITVALTYFQLAAEDHEWWWRSFLCGGSTGMFIYGYCVYYYYGRSDMTGFMQTSFFFGYMA  240

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIK  204
            CICYGFFLMLG++GFR+SL FVR I+ SIK
Sbjct  241  CICYGFFLMLGSIGFRSSLLFVR-IFFSIK  269



>ref|XP_008813153.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=590

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NT+AI YSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNSK EFQA CRTTKYPREI
Sbjct  379  NTIAIVYSATAALPFGTILVIILIWALVTSPLLVLGGIAGKNSKTEFQASCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  439  PQLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVA+TYFQLA EDHEWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  499  ITVAMTYFQLAVEDHEWWWRSILCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  559  CICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVT+PLLVLGGI+GKNSK EFQAPCRTTKYPREI
Sbjct  381  NTVAIIYSATAALPFGTIIVIALIWTLVTAPLLVLGGISGKNSKTEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILF+VFIILLIVTAF
Sbjct  441  PPLPWYRETIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFVVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVAL YFQLAAEDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFF YMA
Sbjct  501  ITVALIYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFRYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  561  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  592



>gb|AES99151.2| transmembrane 9 family protein [Medicago truncatula]
Length=591

 Score =   337 bits (863),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY++TAALPFGTIVVIFLIW LVTSPLLVLGGIAGKNS++EFQAPCRT KYPREI
Sbjct  380  NTVAVAYNSTAALPFGTIVVIFLIWTLVTSPLLVLGGIAGKNSQSEFQAPCRTNKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  L QMAMAGFLPFSAI+IELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  440  PKLPWYRKTLAQMAMAGFLPFSAIFIELYYIFASVWGHQIYTIYSILFIVFIILLIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
              VALTYFQLAAEDHEWWWRSFLCGGSTGLFIY YC+++Y+ARSDMSGFMQTSFFFGYMA
Sbjct  500  GNVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCMFFYHARSDMSGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTV FRASL FVRHIYRS+KCE
Sbjct  560  CICYGFFLMLGTVSFRASLIFVRHIYRSLKCE  591



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score =   336 bits (862),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  379  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  439  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  499  VTVALTYFQLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  559  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_009380058.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTIVVI LIW LVTSPLLVLGGIAGKN K EFQAPCRTTKYPREI
Sbjct  376  NTVAIVYSATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNGKTEFQAPCRTTKYPREI  435

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIY IYSILFIVFIILLIVTAF
Sbjct  436  PLLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYIIYSILFIVFIILLIVTAF  495

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA+EDHEWWWRS+LCGGSTGLF+Y YC YYY+ARSDMSGFMQTSFFFGYMA
Sbjct  496  ITVALTYFQLASEDHEWWWRSYLCGGSTGLFVYGYCFYYYFARSDMSGFMQTSFFFGYMA  555

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  556  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  587



>ref|XP_009408099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=589

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS+ EF APCRTTKYPREI
Sbjct  378  NTVAIVYSATAALPFGTILVILLIWALVTSPLLVLGGIAGKNSQTEFHAPCRTTKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR A+PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  438  PQLPWYRSAIPQMMMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTG+FI+ YC+YYY ARSDMSGFMQTSFFFGYM 
Sbjct  498  ITVALTYFQLAAEDHEWWWRSVLCGGSTGIFIFFYCIYYYQARSDMSGFMQTSFFFGYMT  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIY+SIKCE
Sbjct  558  CICYGFFLMLGTVGFRASLLFVRHIYQSIKCE  589



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  379  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P +PWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  439  PQMPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  499  VTVALTYFQLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  559  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_010099693.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXB80270.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=637

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 206/228 (90%), Gaps = 16/228 (7%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKN KAEFQAPCRTTKYPREI
Sbjct  379  NTVAIAYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNGKAEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  439  PSLPWYRGTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  498

Query  473  itVALTYFQLAAEDHEWWW----------------RSFLCGGSTGLFIyayclyyyyARS  342
            ITVALTYFQLAAEDHEWWW                RSFLCGGSTG+FIYAYCLYYYYARS
Sbjct  499  ITVALTYFQLAAEDHEWWWRIGHRLVVLNDVSYVGRSFLCGGSTGIFIYAYCLYYYYARS  558

Query  341  DMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            DMSGFMQTSFFFGYMACICYGFFLMLGTVGFRA+L FVRHIYRSIKC+
Sbjct  559  DMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCD  606



>gb|KHN39489.1| Putative phagocytic receptor 1b [Glycine soja]
Length=561

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY+ATAALPFGTIVVIFLIW LVTSPLLVLGGIAGKNS++ FQAPCRT KYPREI
Sbjct  350  NTVALAYNATAALPFGTIVVIFLIWTLVTSPLLVLGGIAGKNSQSGFQAPCRTNKYPREI  409

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  L QMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  410  PKLPWYRTTLAQMAMAGFLPFSAIYIELYYIFASVWGHQIYTIYSILFIVFIILLIVTAF  469

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  470  VTVALTYFQLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  529

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRA+L FVRHIY SIKCE
Sbjct  530  CVCYGFFLMLGTVGFRAALIFVRHIYHSIKCE  561



>dbj|BAJ89513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   334 bits (857),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLG IAGKNS  EFQAPCRTTKYPREI
Sbjct  379  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGAIAGKNSNTEFQAPCRTTKYPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  439  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  499  VTVALTYFQLAVEDHKWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  559  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_007141945.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
 gb|ESW13939.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
Length=596

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY+ TAALPFGTIVVIFLIW LVTSPLLVLGGIAGKNS++ FQAPCRT KYPREI
Sbjct  385  NTVALAYNTTAALPFGTIVVIFLIWTLVTSPLLVLGGIAGKNSQSGFQAPCRTNKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  L QMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  445  PQLPWYRTTLSQMAMAGFLPFSAIYIELYYIFASVWGHQIYTIYSILFIVFIILLIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  505  VTVALTYFQLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY SIKCE
Sbjct  565  CICYGFFLMLGTVGFRAALIFVRHIYHSIKCE  596



>emb|CDP05457.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   332 bits (851),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 192/212 (91%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+ AIAYSATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  396  NSTAIAYSATAALPFGTIIVIILIWTLVTSPLLVLGGIAGKNSGTEFQAPCRTTKYPREI  455

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  456  PELPWYRYTIPQMAMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILLIVTAF  515

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLAAEDH WWWRSFLCGGSTG+FIY+YCLYYY+ARSDMSGFMQTSFFFGYMA
Sbjct  516  VTVALTYFQLAAEDHNWWWRSFLCGGSTGIFIYSYCLYYYHARSDMSGFMQTSFFFGYMA  575

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  576  CICYGFFLMLGAVGFRAALVFVRHIYRSIKCE  607



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score =   336 bits (861),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCRTTKYPREI
Sbjct  557  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRTTKYPREI  616

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  617  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  676

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDH+WWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  677  VTVALTYFQLAVEDHQWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  736

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLML TVGFRASLFFVRHIYRSIKCE
Sbjct  737  CVCYGFFLMLSTVGFRASLFFVRHIYRSIKCE  768



>gb|KHN41041.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY+ATAALP GTIVVIFLIW LVTSPLLVLGGIAGKNS++ FQAPCRT KYPREI
Sbjct  377  NTVALAYNATAALPLGTIVVIFLIWTLVTSPLLVLGGIAGKNSQSGFQAPCRTNKYPREI  436

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P +PWYR  L QMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  437  PQVPWYRTTLAQMAMAGFLPFSAIYIELYYIFASVWGHQIYTIYSILFIVFIILLIVTAF  496

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  497  VTVALTYFQLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  556

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVGFRA+L FVRHIY SIKCE
Sbjct  557  CVCYGFFLMLGTVGFRAALIFVRHIYLSIKCE  588



>ref|XP_003518365.2| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Glycine 
max]
Length=592

 Score =   330 bits (846),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY+ATAALP GTIVVIFLIW LVTSPLLVLGGIAGKNS++ FQAPCRT KYPREI
Sbjct  381  NTVALAYNATAALPLGTIVVIFLIWTLVTSPLLVLGGIAGKNSQSGFQAPCRTNKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P +PWYR  L QMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  441  PQVPWYRTTLAQMAMAGFLPFSAIYIELYYIFASVWGHQIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQT+FFFGYMA
Sbjct  501  VTVALTYFQLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTTFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY SIKCE
Sbjct  561  CICYGFFLMLGTVGFRAALIFVRHIYLSIKCE  592



>ref|XP_006575472.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Glycine 
max]
Length=594

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY+ATAALP GTIVVIFLIW LVTSPLLVLGGIAGKNS++ FQAPCRT KYPREI
Sbjct  383  NTVALAYNATAALPLGTIVVIFLIWTLVTSPLLVLGGIAGKNSQSGFQAPCRTNKYPREI  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P +PWYR  L QMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  443  PQVPWYRTTLAQMAMAGFLPFSAIYIELYYIFASVWGHQIYTIYSILFIVFIILLIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQT+FFFGYMA
Sbjct  503  VTVALTYFQLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTTFFFGYMA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRA+L FVRHIY SIKCE
Sbjct  563  CICYGFFLMLGTVGFRAALIFVRHIYLSIKCE  594



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 191/233 (82%), Positives = 207/233 (89%), Gaps = 0/233 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAYSATAALPFGTI+VI LIWALVTSPLLVLGGIAGKNS  EFQAPCR+TKYPREI
Sbjct  381  NTVAIAYSATAALPFGTIIVIILIWALVTSPLLVLGGIAGKNSNTEFQAPCRSTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  441  PQLPWYRSTIPQMAMAGFLPFSAIYIELYYIFASIWGHKIYTIYSILFIVFIILIIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVALTYFQLA EDHEWWWRS LCGGSTG+FI+ YC+YYY+ARSDMSGFMQTSFFFGYM 
Sbjct  501  VTVALTYFQLAVEDHEWWWRSVLCGGSTGIFIFFYCIYYYHARSDMSGFMQTSFFFGYMT  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE**V*VGGLRLLHTAPPANLVG  135
            C+CYGFFLMLGTVGFRASL FVRHIYRSIK         +R +  AP  ++ G
Sbjct  561  CVCYGFFLMLGTVGFRASLLFVRHIYRSIKLREMFAARSIRFVSLAPGLDIPG  613



>ref|XP_004490795.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=593

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY++TAALPFGTIVVIFLIW LVTSPLLVLGGIAGKNS++EFQAPCRT KYPR I
Sbjct  382  NTVAVAYNSTAALPFGTIVVIFLIWTLVTSPLLVLGGIAGKNSRSEFQAPCRTNKYPRHI  441

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR    QMAMAGFLPFSAIYIELYYIF+SVWGH+IYTIYSILFI+FIILLIVTAF
Sbjct  442  PQLPWYRKTPAQMAMAGFLPFSAIYIELYYIFSSVWGHQIYTIYSILFIIFIILLIVTAF  501

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            + VALTYFQLAAEDH+WW RSFLCGGSTGLFIY YC+++Y ARSDMSGFMQTSFFFGYMA
Sbjct  502  VNVALTYFQLAAEDHDWWGRSFLCGGSTGLFIYGYCMFFYNARSDMSGFMQTSFFFGYMA  561

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFRASL FVRHIY SIKCE
Sbjct  562  CICYGFFLMLGTVGFRASLIFVRHIYHSIKCE  593



>gb|KJB43178.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=541

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY  TAALPFGTIVVIFLIWALV+SP LVLGGI GK+SKAEFQAPCRTTK PR+I
Sbjct  330  NTVAVAYKVTAALPFGTIVVIFLIWALVSSPFLVLGGIGGKDSKAEFQAPCRTTKCPRDI  389

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  LPQ+AMAG LPFSAIYIE+YY+FASVWGHRIYT Y ILFIVFIILLI+TAF
Sbjct  390  PPLPWYRKTLPQIAMAGLLPFSAIYIEIYYLFASVWGHRIYTTYVILFIVFIILLIITAF  449

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLF+YAYC YYY A+SDMSGFMQTSFFFGYMA
Sbjct  450  ITVALTYFQLAAEDHGWWWRSFLCGGSTGLFMYAYCFYYYSAQSDMSGFMQTSFFFGYMA  509

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GF ASLFFVRHIYRSIKCE
Sbjct  510  CICYGFFLMLGAIGFCASLFFVRHIYRSIKCE  541



>ref|XP_006661606.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=586

 Score =   326 bits (836),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY++TAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTK+PRE+
Sbjct  375  NTVAIAYNSTAALPFGTICVIMLIWTLVTFPLLVLGGIAGKNSKNEFQAPCRTTKFPREV  434

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGHRIYTIYSILFIVFIILLIVTAF
Sbjct  435  PPLAWYRRTIPQMAMAGFLPFSAIYIELYYIFASIWGHRIYTIYSILFIVFIILLIVTAF  494

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL +EDHEWWWRSFLCGGSTG F++ YCLYYY+ RSDMSGFMQTSFFFGYMA
Sbjct  495  ITVALTYFQLTSEDHEWWWRSFLCGGSTGFFVFGYCLYYYHERSDMSGFMQTSFFFGYMA  554

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRASL FVRHIY+SIKCE
Sbjct  555  CICYAFFLMLGMVGFRASLLFVRHIYKSIKCE  586



>ref|XP_009388099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388100.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=586

 Score =   326 bits (835),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIWALVTSPLLVLG +AGKNS  EFQAPCRT KYPREI
Sbjct  375  NTVAIVYSATAALPFGTILVILLIWALVTSPLLVLGSVAGKNSTTEFQAPCRTAKYPREI  434

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYRG +PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  435  PQLPWYRGTIPQMVMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  494

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDHEWWWRS LCGGSTG+FI  YC+YYY ARSDMSGFMQTSFFFGYM+
Sbjct  495  ITVALTYFQLAAEDHEWWWRSVLCGGSTGIFILFYCIYYYRARSDMSGFMQTSFFFGYMS  554

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GF ASL FVRHIY+ IKCE
Sbjct  555  CICYGFFLMLGTIGFCASLLFVRHIYQLIKCE  586



>ref|XP_001775546.1| predicted protein [Physcomitrella patens]
 gb|EDQ59629.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTI VIFLIW L+T+PLLVLGGIAGKNSKAEFQAP RTTK+PREI
Sbjct  379  NTVAIFYNATAALPFGTICVIFLIWTLITAPLLVLGGIAGKNSKAEFQAPTRTTKFPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVFIIL+IVTAF
Sbjct  439  PPLPWYRYTVPQMAMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWR+ LCGGSTG+FIY YC YYYYARSDMSGFMQTSFFFGYMA
Sbjct  499  ITIALTYFQLAVEDHEWWWRAVLCGGSTGVFIYGYCFYYYYARSDMSGFMQTSFFFGYMA  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CIC+GFFLMLG+VGFRAS  FVRHIY+SIKCE
Sbjct  559  CICFGFFLMLGSVGFRASHLFVRHIYQSIKCE  590



>gb|KHG20583.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=589

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY  TAALPFGTIVVIFLIWALV++PLLVLGGIAGK+SKAEFQAPCRTTK PR+I
Sbjct  378  NTVAVAYKVTAALPFGTIVVIFLIWALVSTPLLVLGGIAGKDSKAEFQAPCRTTKCPRDI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWY+  LPQMAMAG LPFSAIYIE+YY+FASVWGHRIYT Y ILFIVFIILLI+TAF
Sbjct  438  PPLPWYQKTLPQMAMAGLLPFSAIYIEIYYLFASVWGHRIYTTYVILFIVFIILLIITAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLF+YAYC Y+Y A+SDMSG MQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHGWWWRSFLCGGSTGLFMYAYCFYFYSAQSDMSGLMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GF ASLFFVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGAIGFCASLFFVRHIYRSIKCE  589



>gb|KJB43179.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
 gb|KJB43180.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=589

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY  TAALPFGTIVVIFLIWALV+SP LVLGGI GK+SKAEFQAPCRTTK PR+I
Sbjct  378  NTVAVAYKVTAALPFGTIVVIFLIWALVSSPFLVLGGIGGKDSKAEFQAPCRTTKCPRDI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  LPQ+AMAG LPFSAIYIE+YY+FASVWGHRIYT Y ILFIVFIILLI+TAF
Sbjct  438  PPLPWYRKTLPQIAMAGLLPFSAIYIEIYYLFASVWGHRIYTTYVILFIVFIILLIITAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFLCGGSTGLF+YAYC YYY A+SDMSGFMQTSFFFGYMA
Sbjct  498  ITVALTYFQLAAEDHGWWWRSFLCGGSTGLFMYAYCFYYYSAQSDMSGFMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG +GF ASLFFVRHIYRSIKCE
Sbjct  558  CICYGFFLMLGAIGFCASLFFVRHIYRSIKCE  589



>ref|XP_001770691.1| predicted protein [Physcomitrella patens]
 gb|EDQ64515.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTI VI LIW L+T+PLLVLGGIAGKNSK EFQAPCRT+K+PRE+
Sbjct  379  NTVAIFYNATAALPFGTICVIILIWTLITAPLLVLGGIAGKNSKIEFQAPCRTSKFPREV  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVFIIL+IVTAF
Sbjct  439  PPLPWYRHTVPQMAMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFIILIIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWR+ LCGGSTG+FI+ YC YYYYARSDMSGFMQTSFFFGYMA
Sbjct  499  ITIALTYFQLAVEDHEWWWRAVLCGGSTGVFIFGYCFYYYYARSDMSGFMQTSFFFGYMA  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG+VGFRAS  FVRHIY+SIKCE
Sbjct  559  CICYGFFLMLGSVGFRASHLFVRHIYQSIKCE  590



>ref|NP_001064040.1| Os10g0112600 [Oryza sativa Japonica Group]
 gb|AAP51848.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25954.1| Os10g0112600 [Oryza sativa Japonica Group]
 dbj|BAG94270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY++TAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTK+ RE+
Sbjct  374  NTVAIAYNSTAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKNEFQAPCRTTKFLREV  433

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGHRIYTIYSILFIVFIILLIVTAF
Sbjct  434  PPLAWYRRTIPQMAMAGFLPFSAIYIELYYIFASIWGHRIYTIYSILFIVFIILLIVTAF  493

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL AEDHEWWWRSFLCGGSTG F++AYCLYYY  RSDMSGFMQTSFFFGYMA
Sbjct  494  ITVALTYFQLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDMSGFMQTSFFFGYMA  553

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICY FFLMLG VGFRA+L FVRHIY+SIKCE
Sbjct  554  CICYAFFLMLGMVGFRAALLFVRHIYKSIKCE  585



>ref|XP_009784373.1| PREDICTED: putative phagocytic receptor 1b isoform X4 [Nicotiana 
sylvestris]
Length=495

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  284  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTSFQAPCRTTKYPREI  343

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIYSILFIVFI+LLIVT+F
Sbjct  344  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYSILFIVFILLLIVTSF  403

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSF+CGGST +FIY+YCLYYYY RSDMSGFMQ SFFFGYMA
Sbjct  404  ITVALTYFQLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMA  463

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+S+ FVRHIYRSIKCE
Sbjct  464  CICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  495



>ref|XP_009784372.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
sylvestris]
Length=550

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  339  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTSFQAPCRTTKYPREI  398

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIYSILFIVFI+LLIVT+F
Sbjct  399  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYSILFIVFILLLIVTSF  458

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSF+CGGST +FIY+YCLYYYY RSDMSGFMQ SFFFGYMA
Sbjct  459  ITVALTYFQLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMA  518

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+S+ FVRHIYRSIKCE
Sbjct  519  CICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  550



>ref|XP_009784371.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   320 bits (820),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  351  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTSFQAPCRTTKYPREI  410

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIYSILFIVFI+LLIVT+F
Sbjct  411  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYSILFIVFILLLIVTSF  470

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSF+CGGST +FIY+YCLYYYY RSDMSGFMQ SFFFGYMA
Sbjct  471  ITVALTYFQLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMA  530

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+S+ FVRHIYRSIKCE
Sbjct  531  CICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  562



>ref|XP_010037000.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48638.1| hypothetical protein EUGRSUZ_K02296 [Eucalyptus grandis]
Length=592

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+V + Y+ATAALPFGTI+VI LIW LV+SPLLVLGGIAGKNSKAEFQAPCRTT+YPREI
Sbjct  381  NSVGVVYTATAALPFGTILVIVLIWTLVSSPLLVLGGIAGKNSKAEFQAPCRTTEYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRG +PQMAMAGFLPF  IYIELYYIFASVWGHRIYTIY+ILFIVFIILLIVTAF
Sbjct  441  PPLPWYRGTIPQMAMAGFLPFIVIYIELYYIFASVWGHRIYTIYNILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTY QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDM GFMQTSFFFGYMA
Sbjct  501  ITVALTYLQLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMDGFMQTSFFFGYMA  560

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYG FL+LGTVGF A+L F+R IY SIKCE
Sbjct  561  CICYGVFLVLGTVGFCAALLFIRRIYGSIKCE  592



>ref|XP_009615620.1| PREDICTED: putative phagocytic receptor 1b isoform X4 [Nicotiana 
tomentosiformis]
Length=557

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  346  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTGFQAPCRTTKYPREI  405

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIY+ILFIVFI+LLIVTAF
Sbjct  406  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYTILFIVFILLLIVTAF  465

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFL GGST +FIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  466  ITVALTYFQLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  525

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+SL FVRHIYRSIKCE
Sbjct  526  CICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  557



>ref|XP_009615619.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  352  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTGFQAPCRTTKYPREI  411

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIY+ILFIVFI+LLIVTAF
Sbjct  412  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYTILFIVFILLLIVTAF  471

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFL GGST +FIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  472  ITVALTYFQLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  531

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+SL FVRHIYRSIKCE
Sbjct  532  CICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  563



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  384  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTSFQAPCRTTKYPREI  443

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIYSILFIVFI+LLIVT+F
Sbjct  444  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYSILFIVFILLLIVTSF  503

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSF+CGGST +FIY+YCLYYYY RSDMSGFMQ SFFFGYMA
Sbjct  504  ITVALTYFQLAAEDHKWWWRSFICGGSTSIFIYSYCLYYYYTRSDMSGFMQISFFFGYMA  563

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+S+ FVRHIYRSIKCE
Sbjct  564  CICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  595



>ref|XP_009615618.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
tomentosiformis]
Length=575

 Score =   318 bits (815),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  364  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTGFQAPCRTTKYPREI  423

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIY+ILFIVFI+LLIVTAF
Sbjct  424  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYTILFIVFILLLIVTAF  483

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFL GGST +FIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  484  ITVALTYFQLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  543

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+SL FVRHIYRSIKCE
Sbjct  544  CICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  575



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score =   318 bits (816),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPFGTI+VI L+W  +TSPLLVLGGIAGKNS+  FQAPCRTTKYPREI
Sbjct  385  NSVAVSYSSTAALPFGTIMVIVLMWTFMTSPLLVLGGIAGKNSRTGFQAPCRTTKYPREI  444

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYRG +PQMAMAGFLPFSAIYIELYYIF SVWG +IYTIY+ILFIVFI+LLIVTAF
Sbjct  445  PLLAWYRGTVPQMAMAGFLPFSAIYIELYYIFESVWGQKIYTIYTILFIVFILLLIVTAF  504

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH+WWWRSFL GGST +FIY YCLYYYYARSDMSGFMQTSFFFGYMA
Sbjct  505  ITVALTYFQLAAEDHKWWWRSFLYGGSTSIFIYGYCLYYYYARSDMSGFMQTSFFFGYMA  564

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGTVGFR+SL FVRHIYRSIKCE
Sbjct  565  CICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  596



>gb|EEC66468.1| hypothetical protein OsI_32547 [Oryza sativa Indica Group]
Length=631

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY++TAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTK+PRE+
Sbjct  375  NTVAIAYNSTAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKNEFQAPCRTTKFPREV  434

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGHRIYTIYSILFIVFIILLIVTAF
Sbjct  435  PPLAWYRRTIPQMAMAGFLPFSAIYIELYYIFASIWGHRIYTIYSILFIVFIILLIVTAF  494

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL AEDHEWWWRSFLCGGSTG F++AYCLYYY  RSDMSGFMQTSFFFGYMA
Sbjct  495  ITVALTYFQLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDMSGFMQTSFFFGYMA  554

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSI  207
            CICY FFLMLG VGFRA+L FVRHIY+SI
Sbjct  555  CICYAFFLMLGMVGFRAALLFVRHIYKSI  583



>ref|XP_002974646.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
 gb|EFJ24166.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
Length=589

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI+Y +TAALPFGTIV+IF+IWALVT PL VLGGIAGKN+K EF APCRT K+PREI
Sbjct  378  NTVAISYRSTAALPFGTIVIIFIIWALVTFPLTVLGGIAGKNNKNEFYAPCRTKKFPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  438  PALPWYRKTIPQMCMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWRS  CGGSTGLF+Y YC YYY+ARSDM+G MQTSFFFGYMA
Sbjct  498  ITIALTYFQLAIEDHEWWWRSVFCGGSTGLFVYGYCYYYYFARSDMTGLMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG+VG+RASL FVRHIYR+IKCE
Sbjct  558  CVCYGFFLMLGSVGYRASLLFVRHIYRAIKCE  589



>ref|XP_002963357.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
 gb|EFJ35228.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
Length=589

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI+Y +TAALPFGTIV+IF+IWALVT PL VLGGIAGKN+K EF APCRT K+PREI
Sbjct  378  NTVAISYRSTAALPFGTIVIIFIIWALVTFPLTVLGGIAGKNNKNEFYAPCRTKKFPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  438  PALPWYRKTIPQMCMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWRS  CGGSTGLF+Y YC YYY+ARSDM+G MQTSFFFGYMA
Sbjct  498  ITIALTYFQLAIEDHEWWWRSVFCGGSTGLFVYGYCYYYYFARSDMTGLMQTSFFFGYMA  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG+VG+RASL FVRHIYR+IKCE
Sbjct  558  CVCYGFFLMLGSVGYRASLLFVRHIYRAIKCE  589



>gb|KCW48636.1| hypothetical protein EUGRSUZ_K02294, partial [Eucalyptus grandis]
Length=526

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA+ Y+ATAALPFG I+VI LIW LV+SPLLVLGGIAGKNSKAEFQAPCRTT+YPREI
Sbjct  315  NSVAVVYTATAALPFGMILVIVLIWTLVSSPLLVLGGIAGKNSKAEFQAPCRTTEYPREI  374

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRGA+PQMA+AGFLPF   YIELYYIF SVWGHRIYTIY+ILFIVFIILLIVTAF
Sbjct  375  PPLPWYRGAVPQMALAGFLPFIVTYIELYYIFGSVWGHRIYTIYNILFIVFIILLIVTAF  434

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTY QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDM GFMQTSFFFGYMA
Sbjct  435  ITVALTYLQLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMDGFMQTSFFFGYMA  494

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYG  L+LGTVGF A+L F+R IY SIKCE
Sbjct  495  CICYGVSLVLGTVGFCAALLFIRRIYGSIKCE  526



>gb|AAK52585.1|AC079685_16 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|AAM44876.1|AC098694_15 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|EAZ15105.1| hypothetical protein OsJ_30519 [Oryza sativa Japonica Group]
Length=627

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY++TAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTK+ RE+
Sbjct  371  NTVAIAYNSTAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKNEFQAPCRTTKFLREV  430

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPL WYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGHRIYTIYSILFIVFIILLIVTAF
Sbjct  431  PPLAWYRRTIPQMAMAGFLPFSAIYIELYYIFASIWGHRIYTIYSILFIVFIILLIVTAF  490

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQL AEDHEWWWRSFLCGGSTG F++AYCLYYY  RSDMSGFMQTSFFFGYMA
Sbjct  491  ITVALTYFQLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDMSGFMQTSFFFGYMA  550

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSI  207
            CICY FFLMLG VGFRA+L FVRHIY+SI
Sbjct  551  CICYAFFLMLGMVGFRAALLFVRHIYKSI  579



>ref|XP_003059958.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55910.1| predicted protein [Micromonas pusilla CCMP1545]
Length=614

 Score =   314 bits (804),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY +TAALPFGTI VIF+IWALVT PL VLGGIAGKN ++EF+APCRTTKYPREI
Sbjct  403  NTVAIAYRSTAALPFGTICVIFVIWALVTFPLTVLGGIAGKNGRSEFKAPCRTTKYPREI  462

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR A+PQM MAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVFIIL++VTAF
Sbjct  463  PLLPWYRAAIPQMCMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFIILVVVTAF  522

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDH+WWWRS LCGGSTG+FIYAYC YYYYARSDM+GFMQTSFFFGYM+
Sbjct  523  ITIALTYFQLAVEDHQWWWRSVLCGGSTGVFIYAYCFYYYYARSDMTGFMQTSFFFGYMS  582

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             ICYGFFL+LG +GFRAS  FVRHIY++IKCE
Sbjct  583  VICYGFFLLLGNIGFRASSLFVRHIYKAIKCE  614



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +TAALPFGTIV+I L+WAL+T PL VLGGIA KNSK EF APCRTTK+PR++
Sbjct  383  NTVAIFYRSTAALPFGTIVIIILLWALITFPLTVLGGIAAKNSKVEFNAPCRTTKFPRDV  442

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQM MAGFLPFSAIYIELYYIFAS+WGH++YTIYSILFIVFIIL+IVTAF
Sbjct  443  PPLPWYRTTVPQMLMAGFLPFSAIYIELYYIFASIWGHKVYTIYSILFIVFIILIIVTAF  502

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDH WWWRSFLCGGSTGLF+Y YC YYYYARSDMSGFMQTSFFFGY A
Sbjct  503  ITVALTYFQLAVEDHRWWWRSFLCGGSTGLFVYGYCFYYYYARSDMSGFMQTSFFFGYNA  562

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +CY FFLMLG VGFRASL FVRHIYR+IKCE
Sbjct  563  VVCYAFFLMLGAVGFRASLLFVRHIYRAIKCE  594



>ref|XP_010039016.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
Length=682

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA+ Y+ATAALPFG I+VI LIW LV+SPLLVLGGIAGKNSKAEFQAPCRTT+YPREI
Sbjct  471  NSVAVVYTATAALPFGMILVIVLIWTLVSSPLLVLGGIAGKNSKAEFQAPCRTTEYPREI  530

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYRGA+PQMA+AGFLPF   YIELYYIF SVWGHRIYTIY+ILFIVFIILLIVTAF
Sbjct  531  PPLPWYRGAVPQMALAGFLPFIVTYIELYYIFGSVWGHRIYTIYNILFIVFIILLIVTAF  590

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTY QLAAEDH+WWWRSFLCGGSTGLFIY YCLYYYYARSDM GFMQTSFFFGYMA
Sbjct  591  ITVALTYLQLAAEDHKWWWRSFLCGGSTGLFIYGYCLYYYYARSDMDGFMQTSFFFGYMA  650

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYG  L+LGTVGF A+L F+R IY SIKCE
Sbjct  651  CICYGVSLVLGTVGFCAALLFIRRIYGSIKCE  682



>ref|XP_002505642.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66900.1| predicted protein [Micromonas sp. RCC299]
Length=468

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY +TAALPFGTI VI +IWALVT PL VLGGIAGKN+K EF APCRTTKYPREI
Sbjct  257  NTVAIAYRSTAALPFGTICVIIVIWALVTFPLTVLGGIAGKNAKGEFNAPCRTTKYPREI  316

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM MAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVFIIL+IVTAF
Sbjct  317  PQLPWYRSTIPQMVMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFIILVIVTAF  376

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWR+ LCGGSTG FIY YC YYYYARSDMSGFMQTSFFFGYM 
Sbjct  377  ITIALTYFQLAVEDHEWWWRAVLCGGSTGCFIYGYCFYYYYARSDMSGFMQTSFFFGYMW  436

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             ICYGFFLMLG +GFRAS  FV HIY++IKCE
Sbjct  437  TICYGFFLMLGNIGFRASKLFVMHIYKAIKCE  468



>ref|XP_002952428.1| hypothetical protein VOLCADRAFT_75353 [Volvox carteri f. nagariensis]
 gb|EFJ46571.1| hypothetical protein VOLCADRAFT_75353 [Volvox carteri f. nagariensis]
Length=554

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +TAALPFGTIV+I LIWAL+T PL VLGGIA KNSK EF APCRTTK+PR+I
Sbjct  343  NTVAIFYRSTAALPFGTIVIIILIWALITFPLTVLGGIAAKNSKVEFNAPCRTTKFPRDI  402

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQM MAGFLPFSAIYIELYYIFAS+WGH++YTIYSILFIVFIIL+IVTAF
Sbjct  403  PPLPWYRTTMPQMLMAGFLPFSAIYIELYYIFASIWGHKVYTIYSILFIVFIILIIVTAF  462

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDH WWWRSFLCGGSTG+F+Y YC YYYY RSDMSGFMQTSFFFGY A
Sbjct  463  ITVALTYFQLAVEDHRWWWRSFLCGGSTGIFVYGYCFYYYYVRSDMSGFMQTSFFFGYNA  522

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +CY FFLMLGTVGFRASL FVRHIYR+IKCE
Sbjct  523  VVCYAFFLMLGTVGFRASLLFVRHIYRAIKCE  554



>ref|XP_003616193.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=682

 Score =   313 bits (803),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 201/263 (76%), Gaps = 51/263 (19%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA+AY++TAALPFGTIVVIFLIW LVTSPLLVLGGIAGKNS++EFQAPCRT KYPREI
Sbjct  420  NTVAVAYNSTAALPFGTIVVIFLIWTLVTSPLLVLGGIAGKNSQSEFQAPCRTNKYPREI  479

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  L QMAMAGFLPFSAI+IELYYIFASVWGH+IYTIYSILFIVFIILLIVTAF
Sbjct  480  PKLPWYRKTLAQMAMAGFLPFSAIFIELYYIFASVWGHQIYTIYSILFIVFIILLIVTAF  539

Query  473  itVALTYFQLAAEDHEWWWR----------------------------------------  414
              VALTYFQLAAEDHEWWWR                                        
Sbjct  540  GNVALTYFQLAAEDHEWWWRYVLCNTECPLYFLCLFIRNSTMKKTNQCYGNTHSFHSNTV  599

Query  413  -----------SFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMACICYGFFLM  267
                       SFLCGGSTGLFIY YC+++Y+ARSDMSGFMQTSFFFGYMACICYGFFLM
Sbjct  600  TLACRRGSKLTSFLCGGSTGLFIYGYCMFFYHARSDMSGFMQTSFFFGYMACICYGFFLM  659

Query  266  LGTVGFRASLFFVRHIYRSIKCE  198
            LGTV FRASL FVRHIYRS+KCE
Sbjct  660  LGTVSFRASLIFVRHIYRSLKCE  682



>ref|XP_003544357.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=593

 Score =   311 bits (796),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 194/213 (91%), Gaps = 1/213 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLG-GIAGKNSKAEFQAPCRTTKYPRE  657
            NTVA+AY+ATAALPFGTIVVIFLIW LVTSPLLVLG     + +   FQAPCRT KYPRE
Sbjct  381  NTVALAYNATAALPFGTIVVIFLIWTLVTSPLLVLGWDCWVRIANPGFQAPCRTNKYPRE  440

Query  656  IPPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivta  477
            IP LPWYR  L QMAMAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIILLIVTA
Sbjct  441  IPKLPWYRTTLAQMAMAGFLPFSAIYIELYYIFASVWGHQIYTIYSILFIVFIILLIVTA  500

Query  476  fitVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYM  297
            F+TVALTYFQLA EDHEWWWRSFLCGGSTGLFIY YCLYYYYARSDMSGFMQTSFFFGYM
Sbjct  501  FVTVALTYFQLATEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYM  560

Query  296  ACICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            AC+CYGFFLMLGTVGFRA+L FVRHIY SIKCE
Sbjct  561  ACVCYGFFLMLGTVGFRAALIFVRHIYHSIKCE  593



>ref|XP_002956625.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
 gb|EFJ42227.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
Length=605

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +TAALPFGTIV++ LIW+LVT PL V GGIAGKN++AEF APCRT KYPREI
Sbjct  394  NTVAIVYRSTAALPFGTIVIMCLIWSLVTIPLTVFGGIAGKNNRAEFFAPCRTNKYPREI  453

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  LPQM MAGFLPFSAIY+ELYYIFASVWGH++Y I+SIL IV++IL+IVTAF
Sbjct  454  PQLPWYRTTLPQMIMAGFLPFSAIYVELYYIFASVWGHKVYIIWSILAIVYVILIIVTAF  513

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDH+WWWRSFLCGGSTG+F+Y YC YYYYARSDMSGFMQTSFFFGYM 
Sbjct  514  ITIALTYFQLAVEDHQWWWRSFLCGGSTGIFVYGYCFYYYYARSDMSGFMQTSFFFGYML  573

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +CYGFFLMLGTVG+RASL FVRHIYR+IKCE
Sbjct  574  MVCYGFFLMLGTVGWRASLMFVRHIYRAIKCE  605



>ref|XP_001689987.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDP09725.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=605

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +TAALPFGTIV++ LIW LVT PL V GGIAGKN++AEF APCRT KYPREI
Sbjct  394  NTVAIVYRSTAALPFGTIVIMILIWTLVTIPLTVFGGIAGKNNRAEFFAPCRTNKYPREI  453

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM MAGFLPFSAIY+ELYYIFASVWGH++Y I+SIL IV+IIL++VTAF
Sbjct  454  PQLPWYRTTVPQMVMAGFLPFSAIYVELYYIFASVWGHKVYIIWSILAIVYIILIVVTAF  513

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDH+WWWRSFLCGGSTG+F+Y YC YYYYARSDMSGFMQT+FFFGYMA
Sbjct  514  ITIALTYFQLAVEDHQWWWRSFLCGGSTGIFVYGYCFYYYYARSDMSGFMQTTFFFGYMA  573

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +C+GFFLMLGTVG+RASL FVRHIYR+IKCE
Sbjct  574  MVCFGFFLMLGTVGWRASLMFVRHIYRAIKCE  605



>ref|XP_006364083.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=597

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VA++YS+TAALPF TI++I LI  LVTSPLLVLGGIA KNS+  FQAPCRTTKYPREI
Sbjct  387  NSVAVSYSSTAALPFSTIMLIVLILTLVTSPLLVLGGIAAKNSRTGFQAPCRTTKYPREI  446

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQMAM GFLPFSAIY+ELYYIF SVWG +IYTIYS+LFIVF++LLIVTAF
Sbjct  447  PVLPWYRSTIPQMAMTGFLPFSAIYVELYYIFESVWGQKIYTIYSMLFIVFVLLLIVTAF  506

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TVA TYFQLAAEDH+WWWRSFLCGGSTGLFI      YYYARS MSGFMQTSFFFGYMA
Sbjct  507  VTVASTYFQLAAEDHKWWWRSFLCGGSTGLFI-YTYCLYYYARSGMSGFMQTSFFFGYMA  565

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLGT+GFRASL FVRHIYRSIKCE
Sbjct  566  CICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  597



>ref|XP_005650801.1| putative endosomal protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26257.1| putative endosomal protein [Coccomyxa subellipsoidea C-169]
Length=607

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +TAALPFGTIV+I LIWAL+T PL +LGGI GKN++ EF+APCRT KYPREI
Sbjct  396  NTVAIVYRSTAALPFGTIVIITLIWALITIPLTILGGIIGKNTRTEFKAPCRTNKYPREI  455

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR A+PQM MAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVF+ILL+VTAF
Sbjct  456  PELPWYRNAIPQMVMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFLILLVVTAF  515

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLA EDH WWWRSF+CGGSTGLFIY YC YYY ARSDM G+MQTSFFFGYMA
Sbjct  516  ITVALTYFQLALEDHRWWWRSFMCGGSTGLFIYGYCFYYYLARSDMGGWMQTSFFFGYMA  575

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+C  FF+MLGT+G+RASL FVRHIYR+IKCE
Sbjct  576  CVCLAFFIMLGTIGWRASLLFVRHIYRAIKCE  607



>gb|EEC74833.1| hypothetical protein OsI_10676 [Oryza sativa Indica Group]
Length=1316

 Score =   321 bits (822),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  812   SATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREIPPLPWYR  633
             +ATAALPFGTI VI LIW LVT PLLVLGGIAGKNSK EFQAPCRTTKYPREIPPLPWYR
Sbjct  818   NATAALPFGTICVIVLIWTLVTFPLLVLGGIAGKNSKTEFQAPCRTTKYPREIPPLPWYR  877

Query  632   GALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtafitVALTY  453
               +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAFITVALTY
Sbjct  878   QTIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAFITVALTY  937

Query  452   FQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMACICYGFF  273
             FQLAAEDHEWWWRSFLCGGSTG F+Y YCLYYYYARSDMSGFMQTSFFFGYMACICY FF
Sbjct  938   FQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFF  997

Query  272   LMLGTVGFRASLFFVRHIYRSIK  204
             LMLG +GFRA+LFFVRHIY+SIK
Sbjct  998   LMLGMIGFRAALFFVRHIYKSIK  1020



>ref|XP_007512838.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17438.1| predicted protein [Bathycoccus prasinos]
Length=632

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY +TAALPFGTI +I +IWALVT PL VLGGIAGKNSK+EF APCRTTKYPREI
Sbjct  421  NTVAIAYRSTAALPFGTICIIVVIWALVTFPLTVLGGIAGKNSKSEFDAPCRTTKYPREI  480

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPW+R A+PQM MAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVFIIL+IVTAF
Sbjct  481  PKLPWFREAIPQMMMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFIILIIVTAF  540

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            I VALTYFQLAAEDH WWWRS  CGGSTG+FI  YC YYY ARSDMSGFMQTSFFFGYM+
Sbjct  541  ICVALTYFQLAAEDHAWWWRSVFCGGSTGIFILGYCFYYYEARSDMSGFMQTSFFFGYMS  600

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             ICYGFFLMLG VGFRAS  FV+HIY++IK +
Sbjct  601  IICYGFFLMLGNVGFRASSLFVKHIYKAIKSD  632



>ref|XP_005850808.1| hypothetical protein CHLNCDRAFT_29709 [Chlorella variabilis]
 gb|EFN58706.1| hypothetical protein CHLNCDRAFT_29709 [Chlorella variabilis]
Length=599

 Score =   301 bits (770),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA  Y  TAALPFGTIV+I +IWALVT PL V+GGI GKN+KAEF APCRTTKYPREI
Sbjct  388  NTVAWVYGTTAALPFGTIVIIVVIWALVTFPLTVVGGIMGKNTKAEFNAPCRTTKYPREI  447

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQM MAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVFIIL+IVTAF
Sbjct  448  PPLPWYRQTVPQMLMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFIILIIVTAF  507

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDH WWWRS +CGGST LFIYAYC YY+YARSDM+G MQ SF+FGYM 
Sbjct  508  ITIALTYFQLAVEDHSWWWRSVMCGGSTALFIYAYCFYYWYARSDMNGLMQASFYFGYML  567

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +CYGFFLMLG+VGFRASL FVRHIY++IKCE
Sbjct  568  MVCYGFFLMLGSVGFRASLGFVRHIYKAIKCE  599



>ref|XP_005650990.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26446.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
Length=624

 Score =   301 bits (772),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NT+AI Y +TAALPFGTI +I +IWAL+T PL VLGGIAGKNSKAEF AP RTTKYPREI
Sbjct  413  NTIAIVYRSTAALPFGTICIILVIWALITFPLTVLGGIAGKNSKAEFNAPVRTTKYPREI  472

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A PQM MAGFLPFSAIYIELYYIFASVWGH++YTIYSIL IVFIIL+IVTAF
Sbjct  473  PPLPWYRRAFPQMLMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILCIVFIILVIVTAF  532

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDH WWWRSFLCGGSTGLFI+AYC YYY+ARSDMSGFMQTSFFF YM 
Sbjct  533  ITIALTYFQLAVEDHRWWWRSFLCGGSTGLFIFAYCFYYYFARSDMSGFMQTSFFFCYMG  592

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             ICY FFLMLG VG+RASL FVRHIY +IK +
Sbjct  593  MICYAFFLMLGAVGYRASLTFVRHIYSAIKSD  624



>ref|XP_002969094.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
 gb|EFJ30210.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
Length=591

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAIAY+ATAALP GTI+VI +IWALVT PL VLGGI GKNSK EF APCRT K+PRE+
Sbjct  380  NSVAIAYNATAALPIGTILVITIIWALVTLPLTVLGGIVGKNSKEEFYAPCRTNKFPREV  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPW+R  +PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILF+VFIIL+IVTAF
Sbjct  440  PSLPWFRRTIPQMCMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFVVFIILIIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT++LTYFQLA EDH WWWRS  CGGST  F+Y YC YYY+ARSDM+G MQTSF+FGYMA
Sbjct  500  ITISLTYFQLAMEDHTWWWRSIFCGGSTAFFVYGYCFYYYFARSDMTGLMQTSFYFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVG++ASL FVRHIY++IKCE
Sbjct  560  CVCYGFFLMLGTVGYQASLLFVRHIYKAIKCE  591



>ref|XP_002973969.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
 gb|EFJ24924.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
Length=591

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAIAY+ATAALP GTI+VI +IWALVT PL VLGGI GKNSK EF APCRT K+PRE+
Sbjct  380  NSVAIAYNATAALPIGTILVITIIWALVTLPLTVLGGIVGKNSKEEFYAPCRTNKFPREV  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPW+R  +PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILF+VFIIL+IVTAF
Sbjct  440  PSLPWFRRTIPQMCMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFVVFIILIIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT++LTYFQLA EDH WWWRS  CGGST  F+Y YC YYY+ARSDM+G MQTSF+FGYMA
Sbjct  500  ITISLTYFQLAMEDHTWWWRSIFCGGSTAFFVYGYCFYYYFARSDMTGLMQTSFYFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLGTVG++ASL FVRHIY++IKCE
Sbjct  560  CVCYGFFLMLGTVGYQASLLFVRHIYKAIKCE  591



>gb|EPS73381.1| hypothetical protein M569_01372, partial [Genlisea aurea]
Length=584

 Score =   290 bits (741),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N+VAIAY++TAALPFGTI++IFLIWALVT PLL LGG+AGKNS  EFQAPCRT+K PR+I
Sbjct  373  NSVAIAYNSTAALPFGTIMLIFLIWALVTLPLLGLGGVAGKNSSREFQAPCRTSKNPRDI  432

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L +Y+GALPQMAMAGFLPF AIY+EL+Y+FASVWGH IYTI SILFIVFIIL+IVTAF
Sbjct  433  PDLAFYQGALPQMAMAGFLPFCAIYVELHYVFASVWGHSIYTISSILFIVFIILIIVTAF  492

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +TV+LTYFQL AED+ WWWR+FL GGSTG FIY YC YYY++ S+MSGFMQ SFFFGYM+
Sbjct  493  VTVSLTYFQLVAEDYHWWWRAFLYGGSTGAFIYVYCFYYYHSLSNMSGFMQASFFFGYMS  552

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             ICYGFFLMLG VGFRA+L FVRHIYR+IKCE
Sbjct  553  AICYGFFLMLGMVGFRAALVFVRHIYRAIKCE  584



>ref|XP_001422764.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01081.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=624

 Score =   290 bits (743),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY +TAALPFGTIV+I L+WA+VT PL ++GGIAGKN+KAEF AP RTTKYPR+I
Sbjct  413  NTVAIAYRSTAALPFGTIVLIVLLWAIVTIPLTIVGGIAGKNAKAEFNAPVRTTKYPRDI  472

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM +A FLPFSAIYIEL+YIFASVWGH++YTIYS+LF+VF+IL++VTAF
Sbjct  473  PALPWYRATIPQMCIASFLPFSAIYIELFYIFASVWGHKVYTIYSVLFVVFVILILVTAF  532

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +T++LTYFQL AEDHEWWWRS LCGGST + I+ Y  YYY+ RSDM+GF+Q++++FGYMA
Sbjct  533  MTISLTYFQLTAEDHEWWWRSVLCGGSTAIAIFGYAFYYYHLRSDMTGFLQSTYYFGYMA  592

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             ICYG+FL+LGTVG +ASL FVRHIYR+IKC+
Sbjct  593  IICYGWFLLLGTVGHKASLLFVRHIYRAIKCD  624



>ref|XP_011399711.1| Putative phagocytic receptor 1b [Auxenochlorella protothecoides]
 gb|KFM26763.1| Putative phagocytic receptor 1b [Auxenochlorella protothecoides]
Length=589

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY +TAALPFGTIV+I L+WALVT PL ++GG+ GKN++ EF APCRT KYPREI
Sbjct  378  NTVAIAYGSTAALPFGTIVIILLLWALVTVPLTIVGGVLGKNTRTEFAAPCRTNKYPREI  437

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM MAGFLPFSAIYIELYYIFASVWGH++YTIYSILFIVF IL +VTAF
Sbjct  438  PELPWYRSVMPQMVMAGFLPFSAIYIELYYIFASVWGHKVYTIYSILFIVFCILCVVTAF  497

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVALTYFQLAAEDH WWWRSFL GGSTG+F+YAYC YYY ARSDM+G MQ +F+FGY  
Sbjct  498  ITVALTYFQLAAEDHRWWWRSFLAGGSTGIFVYAYCFYYYLARSDMNGLMQATFYFGYNL  557

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +C GFFL+LG +G+R+SL FVR IYR+IKCE
Sbjct  558  MVCLGFFLLLGYIGWRSSLLFVRRIYRAIKCE  589



>ref|XP_004228944.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=594

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 175/200 (88%), Gaps = 1/200 (1%)
 Frame = -3

Query  797  LPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREIPPLPWYRGALPQ  618
            LPF TI++I L+  LVTSPLLVLGGIAGKNS+  FQAPCRTTKYPREIP LPWY   +PQ
Sbjct  396  LPFNTIMLIVLMLTLVTSPLLVLGGIAGKNSRTNFQAPCRTTKYPREIPVLPWYCSTIPQ  455

Query  617  MAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtafitVALTYFQLAA  438
            MAM GFLPFSAIY+ELYYIF SVWG +IYTIYS+LFIVF++LLIVT F+TVA TYFQLAA
Sbjct  456  MAMTGFLPFSAIYVELYYIFESVWGQKIYTIYSMLFIVFVLLLIVTVFVTVASTYFQLAA  515

Query  437  EDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMACICYGFFLMLGT  258
            EDH+WWWRSFLCGGSTGLFI      YYYARS MSGFMQTS FFGYMACICYGFFLM GT
Sbjct  516  EDHKWWWRSFLCGGSTGLFI-YTYCLYYYARSGMSGFMQTSCFFGYMACICYGFFLMFGT  574

Query  257  VGFRASLFFVRHIYRSIKCE  198
            +GFRASL FVRHIYRSIKCE
Sbjct  575  IGFRASLLFVRHIYRSIKCE  594



>gb|KDD75073.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=558

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +TAALPFGTIV+I L+W LVT PL VLGG+ GKN++A+F APCRT KYPRE+
Sbjct  347  NTVAIFYRSTAALPFGTIVIILLMWTLVTIPLTVLGGVLGKNTRADFAAPCRTNKYPREV  406

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR    QM MAGFLPFSAIYIEL+YIFASVWGH++YTIYSILF+VF IL +VTAF
Sbjct  407  PDLPWYRSTPVQMFMAGFLPFSAIYIELFYIFASVWGHKVYTIYSILFVVFCILCVVTAF  466

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLAAEDH WWWRSFLCGGSTG+F+Y Y  YYY ARSDMSGFMQ +F+FGY A
Sbjct  467  ITIALTYFQLAAEDHRWWWRSFLCGGSTGIFVYGYSFYYYLARSDMSGFMQATFYFGYNA  526

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             +C  FFL+LG VG+RASL FVR IYR+IKCE
Sbjct  527  MVCLAFFLILGYVGWRASLAFVRRIYRAIKCE  558



>ref|XP_001783681.1| predicted protein [Physcomitrella patens]
 gb|EDQ51511.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   282 bits (721),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +T ALPFGTIVVI +IW +VT PL VLGGIAGKN+KAEF APCRT KYPREI
Sbjct  375  NTVAIGYQSTQALPFGTIVVIAIIWIVVTFPLTVLGGIAGKNNKAEFYAPCRTNKYPREI  434

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM MAGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  435  PALPWYRRTVPQMCMAGFLPFSAIYIELYYIFASVWGHKIYTIYSILFIVFIILIIVTAF  494

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWRS  CGGSTG+FIY YC YYY+ RS M G MQ SFF+GYM 
Sbjct  495  ITIALTYFQLAVEDHEWWWRSVFCGGSTGMFIYGYCFYYYHIRSGMVGLMQASFFYGYMG  554

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFLMLG+VG+RASL FVR+IYR+IKCE
Sbjct  555  CVCYGFFLMLGSVGYRASLLFVRNIYRAIKCE  586



>ref|XP_010523531.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=584

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAIAY+ATAALPFGTI+VI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  381  NTVAIAYNATAALPFGTIMVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF
Sbjct  441  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGY  300
            ITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIY YC+YYYY RSDM+GFMQTSFFFGY
Sbjct  501  ITVALTYFQLAAEDHEWWWRSFLCGGSTGMFIYGYCVYYYYGRSDMTGFMQTSFFFGY  558



>ref|XP_001755694.1| predicted protein [Physcomitrella patens]
 gb|EDQ79367.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +T ALPFGTIVVI +IW +VT PL VLGGIAGKN+K+EF APCRT KYPREI
Sbjct  380  NTVAIGYRSTQALPFGTIVVIAIIWIVVTFPLTVLGGIAGKNNKSEFYAPCRTNKYPREI  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P L WYR  +PQM +AGFLPFSAIYIELYYIFASVWGH+IYTIYSILFIVFIIL+IVTAF
Sbjct  440  PALRWYRRTVPQMCLAGFLPFSAIYIELYYIFASVWGHQIYTIYSILFIVFIILIIVTAF  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            IT+ALTYFQLA EDHEWWWRS  CGGSTGLFIY YC YY+  RS M+G MQTSFF+GYM 
Sbjct  500  ITIALTYFQLAIEDHEWWWRSVFCGGSTGLFIYGYCFYYHRFRSGMAGLMQTSFFYGYMG  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+CYGFFL+LG+VG+RASL FVRHIYR+IKCE
Sbjct  560  CVCYGFFLLLGSVGYRASLLFVRHIYRAIKCE  591



>emb|CEG02174.1| Nonaspanin (TM9SF) [Ostreococcus tauri]
Length=606

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y +TAALPFGTIV   L+WA+VT P  + GGIAGKN+ A+F AP RTTKYPREI
Sbjct  395  NTVAIFYRSTAALPFGTIVSFILLWAVVTIPSTIFGGIAGKNAPADFNAPVRTTKYPREI  454

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            P LPWYR  +PQM +A FLPFSAIYIELYYIFASVWGH++YTIYS+LF+VF+IL++VTAF
Sbjct  455  PVLPWYRSTIPQMCIASFLPFSAIYIELYYIFASVWGHKVYTIYSVLFVVFVILILVTAF  514

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +T++LTYFQLAAEDHEWWWRS +CGGST + ++ Y  YY++ RSDM+GFMQ+S++FGYM 
Sbjct  515  MTISLTYFQLAAEDHEWWWRSLVCGGSTAIAVFGYSFYYFHVRSDMTGFMQSSYYFGYMG  574

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
             ICYG+FL+LGTVG +ASL FVRHIY+++KC+
Sbjct  575  IICYGWFLLLGTVGHKASLLFVRHIYKAVKCD  606



>gb|KHG00678.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=528

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  710  NSKAEFQAPCRTTKYPREIPPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIY  531
            N+ AEFQAPCRTTKYPREIPPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIY
Sbjct  358  NNWAEFQAPCRTTKYPREIPPLPWYRSAVPQMAMAGFLPFSAIYIELYYIFASVWGHRIY  417

Query  530  tiysilfivfiillivtafitVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyy  351
            TIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTG+FIYAYCLYYYY
Sbjct  418  TIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGIFIYAYCLYYYY  477

Query  350  ARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            ARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASL FVRHIYRSIKCE
Sbjct  478  ARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  528



>ref|XP_011003771.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Populus euphratica]
Length=547

 Score =   276 bits (705),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = -3

Query  797  LPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREIPPLPWYRGALPQ  618
            LP GTIVVI LIW LV+SPLLVLGGI GKNSKAEFQAPCRT +YPREIPPL WYR  +PQ
Sbjct  348  LPVGTIVVIALIWTLVSSPLLVLGGIIGKNSKAEFQAPCRTAEYPREIPPLRWYRQTIPQ  407

Query  617  MAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtafitVALTYFQLAA  438
            MA+AGFLPF  I  ELYYIFASVWGHRIYT YS LFI+FI LLIVTA IT  LT+ QLAA
Sbjct  408  MAIAGFLPFILIQTELYYIFASVWGHRIYTFYSFLFIIFISLLIVTALITATLTHLQLAA  467

Query  437  EDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMACICYGFFLMLGT  258
            EDH WWWRSFLCGGSTGLFIYAYC +YYYAR++MSGFMQTSF FGYMAC+ +G FLMLGT
Sbjct  468  EDHSWWWRSFLCGGSTGLFIYAYCFHYYYARTEMSGFMQTSFMFGYMACVSFGCFLMLGT  527

Query  257  VGFRASLFFVRHIYRSIKCE  198
            VG+ A+L FVRH+Y SIKCE
Sbjct  528  VGYLAALRFVRHVYGSIKCE  547



>ref|XP_002317710.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|EEE95930.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=594

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -3

Query  797  LPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREIPPLPWYRGALPQ  618
            LP GTIVVI LIW LV+SPLLVLGGI GKNSKAEFQAPCRT +YPREIPPL WYR  +PQ
Sbjct  388  LPLGTIVVIALIWTLVSSPLLVLGGIIGKNSKAEFQAPCRTAEYPREIPPLRWYRQTIPQ  447

Query  617  MAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtafitVALTYFQLAA  438
            MA+AGFLPF  I  ELYYIFASVWGHRIYT YS LFI+FI LLIVTA IT  LT+ QLAA
Sbjct  448  MAIAGFLPFILIQTELYYIFASVWGHRIYTFYSFLFIIFITLLIVTALITATLTHLQLAA  507

Query  437  EDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMACICYGFFLMLGT  258
            EDH WWWRSFLCGGSTGLFIYAYC YYYYA SDMSGFMQTSF FGYMACI +G FLMLGT
Sbjct  508  EDHRWWWRSFLCGGSTGLFIYAYCFYYYYALSDMSGFMQTSFIFGYMACISFGCFLMLGT  567

Query  257  VGFRASLFFVRHIYRSIKCE  198
            VG+ A+L FVRH+Y SIKCE
Sbjct  568  VGYLAALRFVRHVYGSIKCE  587



>ref|XP_006376703.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|ERP54500.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=625

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -3

Query  797  LPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREIPPLPWYRGALPQ  618
            LP GTIVVI LIW LV+SPLLVLGGI GKNSKAEFQAPCRT +YPREIPPL WYR  +PQ
Sbjct  419  LPLGTIVVIALIWTLVSSPLLVLGGIIGKNSKAEFQAPCRTAEYPREIPPLRWYRQTIPQ  478

Query  617  MAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtafitVALTYFQLAA  438
            MA+AGFLPF  I  ELYYIFASVWGHRIYT YS LFI+FI LLIVTA IT  LT+ QLAA
Sbjct  479  MAIAGFLPFILIQTELYYIFASVWGHRIYTFYSFLFIIFITLLIVTALITATLTHLQLAA  538

Query  437  EDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMACICYGFFLMLGT  258
            EDH WWWRSFLCGGSTGLFIYAYC YYYYA SDMSGFMQTSF FGYMACI +G FLMLGT
Sbjct  539  EDHRWWWRSFLCGGSTGLFIYAYCFYYYYALSDMSGFMQTSFIFGYMACISFGCFLMLGT  598

Query  257  VGFRASLFFVRHIYRSIKCE  198
            VG+ A+L FVRH+Y SIKCE
Sbjct  599  VGYLAALRFVRHVYGSIKCE  618



>ref|XP_011003770.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Populus euphratica]
Length=586

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = -3

Query  797  LPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREIPPLPWYRGALPQ  618
            LP GTIVVI LIW LV+SPLLVLGGI GKNSKAEFQAPCRT +YPREIPPL WYR  +PQ
Sbjct  387  LPVGTIVVIALIWTLVSSPLLVLGGIIGKNSKAEFQAPCRTAEYPREIPPLRWYRQTIPQ  446

Query  617  MAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtafitVALTYFQLAA  438
            MA+AGFLPF  I  ELYYIFASVWGHRIYT YS LFI+FI LLIVTA IT  LT+ QLAA
Sbjct  447  MAIAGFLPFILIQTELYYIFASVWGHRIYTFYSFLFIIFISLLIVTALITATLTHLQLAA  506

Query  437  EDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMACICYGFFLMLGT  258
            EDH WWWRSFLCGGSTGLFIYAYC +YYYAR++MSGFMQTSF FGYMAC+ +G FLMLGT
Sbjct  507  EDHSWWWRSFLCGGSTGLFIYAYCFHYYYARTEMSGFMQTSFMFGYMACVSFGCFLMLGT  566

Query  257  VGFRASLFFVRHIYRSIKCE  198
            VG+ A+L FVRH+Y SIKCE
Sbjct  567  VGYLAALRFVRHVYGSIKCE  586



>ref|XP_002890068.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66327.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI Y+ATAALPFGTIVVI LIW LVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI
Sbjct  298  NTVAITYTATAALPFGTIVVIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  357

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR A+PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIY ILFIVFIIL+IVTAF
Sbjct  358  PPLPWYRSAIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYIILFIVFIILIIVTAF  417

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFF  306
            ITVALTYFQLAAEDH+WWWRSF+CGGSTGLFIYAYCLYYYYARSDMSGFMQTSFF 
Sbjct  418  ITVALTYFQLAAEDHQWWWRSFICGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFL  473



>ref|XP_010322125.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Solanum 
lycopersicum]
Length=560

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA  Y +TAALP GTIVVI L+W  +  P LVLG I+GK  ++EFQAPC TTK PRE+
Sbjct  349  NTVAFNYGSTAALPLGTIVVILLLWVFLALPSLVLGAISGKRIRSEFQAPCHTTKCPREV  408

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP  WYR  + QMAMAG LPF  IYI+LYYIFASVWG+RIYTIY ILF+VFI+LLI TA 
Sbjct  409  PPQRWYRRVITQMAMAGLLPFGVIYIQLYYIFASVWGYRIYTIYGILFVVFILLLITTAL  468

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +++A+TY QLAAEDHEWWWRSFLCGGSTGL+++ Y +YYY++RSDM+GFMQTSFFFGYMA
Sbjct  469  VSIAMTYIQLAAEDHEWWWRSFLCGGSTGLYLFGYSMYYYFSRSDMNGFMQTSFFFGYMA  528

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+ YG FLMLGTVGF A L FVR +Y  IKCE
Sbjct  529  CVSYGVFLMLGTVGFHACLLFVRLLYGCIKCE  560



>ref|XP_008787888.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Phoenix 
dactylifera]
Length=555

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 166/212 (78%), Gaps = 37/212 (17%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVAI YSATAALPFGTI+VI LIW LVT+PLLVLGGI+GKNSK EFQAPCRTTKYPREI
Sbjct  381  NTVAIIYSATAALPFGTIIVIALIWTLVTAPLLVLGGISGKNSKTEFQAPCRTTKYPREI  440

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWYR  +PQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILF+VFIILLIVTAF
Sbjct  441  PPLPWYRETIPQMAMAGFLPFSAIYIELYYIFASVWGHRIYTIYSILFVVFIILLIVTAF  500

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            ITVAL YFQLAAEDHEWWWR                                     YMA
Sbjct  501  ITVALIYFQLAAEDHEWWWR-------------------------------------YMA  523

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYGFFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  524  CICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  555



>ref|XP_004240860.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322124.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=591

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            NTVA  Y +TAALP GTIVVI L+W  +  P LVLG I+GK  ++EFQAPC TTK PRE+
Sbjct  380  NTVAFNYGSTAALPLGTIVVILLLWVFLALPSLVLGAISGKRIRSEFQAPCHTTKCPREV  439

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PP  WYR  + QMAMAG LPF  IYI+LYYIFASVWG+RIYTIY ILF+VFI+LLI TA 
Sbjct  440  PPQRWYRRVITQMAMAGLLPFGVIYIQLYYIFASVWGYRIYTIYGILFVVFILLLITTAL  499

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            +++A+TY QLAAEDHEWWWRSFLCGGSTGL+++ Y +YYY++RSDM+GFMQTSFFFGYMA
Sbjct  500  VSIAMTYIQLAAEDHEWWWRSFLCGGSTGLYLFGYSMYYYFSRSDMNGFMQTSFFFGYMA  559

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            C+ YG FLMLGTVGF A L FVR +Y  IKCE
Sbjct  560  CVSYGVFLMLGTVGFHACLLFVRLLYGCIKCE  591



>ref|XP_011625258.1| PREDICTED: transmembrane 9 superfamily member 2 isoform X2 [Amborella 
trichopoda]
Length=537

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N VA+ Y+   ALPF  IV I L+W+ V SPLLVLGGIAGKN+K EFQAPCRTTK PREI
Sbjct  326  NNVALVYNFATALPFSAIVAIVLMWSFVMSPLLVLGGIAGKNNKTEFQAPCRTTKCPREI  385

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWY+  +PQM +AG LPF AIY+EL+ + AS+WGH+IY  Y +LF+VF++L+IVTAF
Sbjct  386  PPLPWYQKTIPQMVIAGVLPFIAIYMELFLVLASMWGHKIYYTYGVLFMVFVVLVIVTAF  445

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            + +AL YFQLAAEDHEWWWRS L GGST LFI+  CLYYY+AR+DMSG MQTS FFGYMA
Sbjct  446  VAIALVYFQLAAEDHEWWWRSVLRGGSTSLFIFGQCLYYYFARTDMSGLMQTSSFFGYMA  505

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYG FL+LGTVGF  SL  VR++Y SIKCE
Sbjct  506  CICYGIFLLLGTVGFYISLVLVRYLYGSIKCE  537



>ref|XP_006849484.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Amborella 
trichopoda]
 gb|ERN11065.1| hypothetical protein AMTR_s00024p00115000 [Amborella trichopoda]
Length=590

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -3

Query  833  NTVAIAYSATAALPFGTIVVIFLIWALVTSPLLVLGGIAGKNSKAEFQAPCRTTKYPREI  654
            N VA+ Y+   ALPF  IV I L+W+ V SPLLVLGGIAGKN+K EFQAPCRTTK PREI
Sbjct  379  NNVALVYNFATALPFSAIVAIVLMWSFVMSPLLVLGGIAGKNNKTEFQAPCRTTKCPREI  438

Query  653  PPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysilfivfiillivtaf  474
            PPLPWY+  +PQM +AG LPF AIY+EL+ + AS+WGH+IY  Y +LF+VF++L+IVTAF
Sbjct  439  PPLPWYQKTIPQMVIAGVLPFIAIYMELFLVLASMWGHKIYYTYGVLFMVFVVLVIVTAF  498

Query  473  itVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDMSGFMQTSFFFGYMA  294
            + +AL YFQLAAEDHEWWWRS L GGST LFI+  CLYYY+AR+DMSG MQTS FFGYMA
Sbjct  499  VAIALVYFQLAAEDHEWWWRSVLRGGSTSLFIFGQCLYYYFARTDMSGLMQTSSFFGYMA  558

Query  293  CICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            CICYG FL+LGTVGF  SL  VR++Y SIKCE
Sbjct  559  CICYGIFLLLGTVGFYISLVLVRYLYGSIKCE  590



>gb|ABR26036.1| transmembrane 9 superfamily protein member 1 precursor [Oryza 
sativa Indica Group]
Length=166

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -3

Query  695  FQAPCRTTKYPREIPPLPWYRGALPQMAMAGFLPFSAIYIELYYIFASVWGHRIYtiysi  516
            FQAPCRTTK+ RE+PPL WYR  +PQMAMAGFLPFSAIYIELYYIFAS+WGHRIYTIYSI
Sbjct  1    FQAPCRTTKFLREVPPLAWYRRTIPQMAMAGFLPFSAIYIELYYIFASIWGHRIYTIYSI  60

Query  515  lfivfiillivtafitVALTYFQLAAEDHEWWWRSFLCGGSTGLFIyayclyyyyARSDM  336
            LFIVFIILLIVTAFITVALTYFQL AEDHEWWWRSFLCGGSTG F++AYCLYYY  RSDM
Sbjct  61   LFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGFFVFAYCLYYYRERSDM  120

Query  335  SGFMQTSFFFGYMACICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  198
            SGFMQTSFFFGYMACICY FFLMLG VGFRA+L FVRHIY+SIKCE
Sbjct  121  SGFMQTSFFFGYMACICYAFFLMLGMVGFRAALLFVRHIYKSIKCE  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1785100074290