BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13431

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073481.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  66.2    3e-09   
ref|XP_011080886.1|  PREDICTED: uncharacterized protein LOC105164037  62.4    6e-08   Sesamum indicum [beniseed]
ref|XP_002276602.1|  PREDICTED: uncharacterized protein LOC100255255  62.0    1e-07   Vitis vinifera
ref|XP_008239003.1|  PREDICTED: uncharacterized protein LOC103337613  61.6    1e-07   Prunus mume [ume]
ref|XP_009630287.1|  PREDICTED: uncharacterized protein LOC104120257  60.1    4e-07   Nicotiana tomentosiformis
gb|EYU23400.1|  hypothetical protein MIMGU_mgv1a004206mg              59.7    5e-07   Erythranthe guttata [common monkey flower]
ref|XP_009796704.1|  PREDICTED: uncharacterized protein LOC104243241  59.7    5e-07   Nicotiana sylvestris
ref|XP_006343911.1|  PREDICTED: cell wall protein AWA1-like isofo...  58.9    9e-07   Solanum tuberosum [potatoes]
emb|CDP12102.1|  unnamed protein product                              58.5    1e-06   Coffea canephora [robusta coffee]
gb|KJB19068.1|  hypothetical protein B456_003G083700                  57.4    3e-06   Gossypium raimondii
ref|XP_007211292.1|  hypothetical protein PRUPE_ppa002459mg           56.6    6e-06   Prunus persica
ref|XP_010261439.1|  PREDICTED: uncharacterized protein LOC104600276  56.6    6e-06   Nelumbo nucifera [Indian lotus]
emb|CBI34417.3|  unnamed protein product                              55.8    1e-05   Vitis vinifera
ref|XP_008336898.1|  PREDICTED: uncharacterized protein LOC103456102  55.1    2e-05   Malus domestica [apple tree]
ref|XP_010106584.1|  hypothetical protein L484_003082                 55.1    2e-05   Morus notabilis
gb|KJB37515.1|  hypothetical protein B456_006G208300                  55.1    2e-05   Gossypium raimondii
ref|XP_007040391.1|  F22C12.10, putative isoform 2                    54.7    2e-05   
ref|XP_007040390.1|  Uncharacterized protein isoform 1                55.1    2e-05   
gb|KDO76383.1|  hypothetical protein CISIN_1g011430mg                 54.7    2e-05   Citrus sinensis [apfelsine]
ref|XP_006391666.1|  hypothetical protein EUTSA_v10023333mg           54.7    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_006476466.1|  PREDICTED: uncharacterized protein LOC102631...  54.7    3e-05   Citrus sinensis [apfelsine]
ref|XP_004245556.1|  PREDICTED: uncharacterized protein LOC101268782  54.7    3e-05   Solanum lycopersicum
ref|XP_006439437.1|  hypothetical protein CICLE_v10019140mg           54.7    3e-05   Citrus clementina [clementine]
gb|KHG18325.1|  putative WRKY transcription factor 19 -like protein   54.3    4e-05   Gossypium arboreum [tree cotton]
ref|XP_009334483.1|  PREDICTED: uncharacterized protein LOC103927300  53.5    7e-05   Pyrus x bretschneideri [bai li]
ref|XP_002509888.1|  transcription factor, putative                   52.4    1e-04   Ricinus communis
ref|XP_004244623.1|  PREDICTED: uncharacterized protein LOC101256504  50.1    0.001   Solanum lycopersicum



>ref|XP_011073481.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105158420 
[Sesamum indicum]
Length=634

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  FH +G+AAN  SNAFKNL N IQ G A    V   CADTTLRLDS       I + 
Sbjct  1    MDARFHNVGFAANPKSNAFKNLCNSIQIGAAGAEVVY--CADTTLRLDSPGFVTPFISAP  58

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWSS DG      GS
Sbjct  59   KGIKRKWSSRDGPMDLQVGS  78



>ref|XP_011080886.1| PREDICTED: uncharacterized protein LOC105164037 [Sesamum indicum]
 ref|XP_011080887.1| PREDICTED: uncharacterized protein LOC105164037 [Sesamum indicum]
Length=667

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F  LG+AAN  SNAFKNL N IQ GGA    V   CADTTLRLDS   +   I + 
Sbjct  1    MDARFDNLGFAANPQSNAFKNLCNSIQIGGAGAEVVY--CADTTLRLDSPGFANPFISAP  58

Query  644  KGIKRKWSSIDG  679
            KG+KRKWSS+ G
Sbjct  59   KGVKRKWSSVGG  70



>ref|XP_002276602.1| PREDICTED: uncharacterized protein LOC100255255 [Vitis vinifera]
 ref|XP_010658581.1| PREDICTED: uncharacterized protein LOC100255255 [Vitis vinifera]
Length=684

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = +2

Query  476  FHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipssKGIK  655
            F  LG+AAN SSNAFKNLGN +Q GGA        C DT LRLDS SSS   + +SKG+K
Sbjct  5    FQNLGFAANHSSNAFKNLGNSMQVGGARANY----CMDTILRLDSPSSSIPDLTASKGVK  60

Query  656  RKWSSIDGS  682
            RKWS IDG+
Sbjct  61   RKWSLIDGT  69



>ref|XP_008239003.1| PREDICTED: uncharacterized protein LOC103337613 [Prunus mume]
Length=670

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD     LG+AAN SSNAF N+GN +Q GGA       +CADT LRL+S  S+   +  S
Sbjct  1    MDNRLQNLGFAANFSSNAFNNVGNSMQVGGAGTE----SCADTILRLNSPGSTMSYVSGS  56

Query  644  KGIKRKWSSIDGS  682
            +GIKRKWSSI GS
Sbjct  57   QGIKRKWSSIGGS  69



>ref|XP_009630287.1| PREDICTED: uncharacterized protein LOC104120257 [Nicotiana tomentosiformis]
Length=679

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MDP F  +G+      NAFKNLG  +  GGA   G   +CADTTLRLDS  SS  SIPS+
Sbjct  1    MDPRFRYVGFTVKPQLNAFKNLGKSVTLGGAGVGGG--HCADTTLRLDSIGSSIPSIPSA  58

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWSSI GS     GS
Sbjct  59   KGIKRKWSSIGGSADQQIGS  78



>gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Erythranthe guttata]
Length=539

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F+ LG+AAN  SNAFKNL N  Q GG    GV   CADTTLRLDS +  +    +S
Sbjct  1    MDARFYNLGFAANPQSNAFKNLCNSTQIGGNGAEGVY--CADTTLRLDSPAFPSPLASTS  58

Query  644  KGIKRKWSSIDG  679
             G+KRKWS +DG
Sbjct  59   MGLKRKWSFVDG  70



>ref|XP_009796704.1| PREDICTED: uncharacterized protein LOC104243241 [Nicotiana sylvestris]
 ref|XP_009796705.1| PREDICTED: uncharacterized protein LOC104243241 [Nicotiana sylvestris]
 ref|XP_009796706.1| PREDICTED: uncharacterized protein LOC104243241 [Nicotiana sylvestris]
Length=679

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MDP F  +G+  N   NAFKNLG  +          GG+CADTTLRLDS  SS  S P++
Sbjct  1    MDPRFRYVGFTVNPQLNAFKNLGKSVT--VGGAGVGGGHCADTTLRLDSIGSSIPSTPAT  58

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWSSI GS     GS
Sbjct  59   KGIKRKWSSIGGSADQQIGS  78



>ref|XP_006343911.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Solanum tuberosum]
 ref|XP_006343912.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Solanum tuberosum]
Length=679

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MDP F  +G+  N   +AFKNLG  I  G A   G    CADTTLRLDS  SS  SIP+ 
Sbjct  1    MDPRFRYVGFTVNPQLSAFKNLGKSIAVGEAGVGGSY--CADTTLRLDSIGSSVPSIPAP  58

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWSSI GS     GS
Sbjct  59   KGIKRKWSSIGGSNDQPIGS  78



>emb|CDP12102.1| unnamed protein product [Coffea canephora]
Length=678

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  FH LG+AAN + NA +NLGN  Q G A G      CADTTL LDS  S    + +S
Sbjct  1    MDARFHNLGFAANPALNALENLGNSFQIGVAGGGF----CADTTLCLDSSGSPIPFVSAS  56

Query  644  KGIKRKWSSIDGS  682
            KG+KRKW  IDGS
Sbjct  57   KGMKRKWGLIDGS  69



>gb|KJB19068.1| hypothetical protein B456_003G083700 [Gossypium raimondii]
 gb|KJB19069.1| hypothetical protein B456_003G083700 [Gossypium raimondii]
Length=676

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F  LG+AAN S+NAFK LG+ IQ GG           DT LRLDS  SS     ++
Sbjct  1    MDTRFSHLGFAANYSANAFKILGSSIQVGGNGAAYS----TDTDLRLDSPGSSIPCRSTA  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWS +DGS     GS
Sbjct  57   KGIKRKWSLMDGSIGEQVGS  76



>ref|XP_007211292.1| hypothetical protein PRUPE_ppa002459mg [Prunus persica]
 gb|EMJ12491.1| hypothetical protein PRUPE_ppa002459mg [Prunus persica]
Length=670

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD     LG+AAN SSNAF  +GN +Q GGA       +CADT LRL+S  SS   + S 
Sbjct  1    MDNRLQNLGFAANFSSNAFNIVGNSMQVGGAGSE----SCADTILRLNSPGSSMACMSSL  56

Query  644  KGIKRKWSSIDG  679
            +GIKRKWSSI G
Sbjct  57   QGIKRKWSSIGG  68



>ref|XP_010261439.1| PREDICTED: uncharacterized protein LOC104600276 [Nelumbo nucifera]
 ref|XP_010261440.1| PREDICTED: uncharacterized protein LOC104600276 [Nelumbo nucifera]
Length=694

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +2

Query  464  MDPIFHGLGY-AANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsips  640
            MDP F  LG+   N S NAF+NL   IQ G          C DTTLRLDS  +S     +
Sbjct  1    MDPRFQNLGFFDPNPSPNAFENLSKVIQVGEVRADC----CTDTTLRLDSAGASFPHFLT  56

Query  641  sKGIKRKWSSIDGS  682
            SKGIKRKWS IDGS
Sbjct  57   SKGIKRKWSMIDGS  70



>emb|CBI34417.3| unnamed protein product [Vitis vinifera]
Length=505

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 4/64 (6%)
 Frame = +2

Query  476  FHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipssKGIK  655
            F  LG+AAN SSNAFKNLGN +Q GGA        C DT LRLDS SSS   + +SKG+K
Sbjct  5    FQNLGFAANHSSNAFKNLGNSMQVGGARANY----CMDTILRLDSPSSSIPDLTASKGVK  60

Query  656  RKWS  667
            RKW+
Sbjct  61   RKWT  64



>ref|XP_008336898.1| PREDICTED: uncharacterized protein LOC103456102 [Malus domestica]
 ref|XP_008337506.1| PREDICTED: uncharacterized protein LOC103456102 [Malus domestica]
Length=667

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD     LG+AAN SSNAF+ LGN +Q GGA G        DT LRL+S   S   +PS 
Sbjct  1    MDNRLQSLGFAANFSSNAFRILGNSMQVGGAGGEYS----TDTILRLNSPGFSMAYMPSP  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWSS+ GS     GS
Sbjct  57   KGIKRKWSSVGGSLTQHVGS  76



>ref|XP_010106584.1| hypothetical protein L484_003082 [Morus notabilis]
 gb|EXC10838.1| hypothetical protein L484_003082 [Morus notabilis]
Length=664

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F  LG+AAN SSNAFK LGN + FG A         ADT LRL+S  +S   + SS
Sbjct  1    MDDRFQNLGFAANYSSNAFKVLGNSMHFGVARVETR----ADTILRLNSPGASLPFMSSS  56

Query  644  KGIKRKWSSIDGS  682
            KG KRKWS +D S
Sbjct  57   KGTKRKWSLVDPS  69



>gb|KJB37515.1| hypothetical protein B456_006G208300 [Gossypium raimondii]
Length=682

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F  +G+ AN S NAFK LGN +Q GG  G        DT LRLDS  SS   + +S
Sbjct  1    MDSRFSNVGFPANYSLNAFKILGNSMQVGGTGGAYNM----DTVLRLDSAGSSVPYMSAS  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWSS+D S +   GS
Sbjct  57   KGIKRKWSSMDRSIRGQTGS  76



>ref|XP_007040391.1| F22C12.10, putative isoform 2 [Theobroma cacao]
 ref|XP_007040392.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY24892.1| F22C12.10, putative isoform 2 [Theobroma cacao]
 gb|EOY24893.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=539

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F  LG+AAN SSNAFK LG  +Q GG           DT LRLDS  SS   + +S
Sbjct  1    MDTRFSNLGFAANFSSNAFKILGGSMQVGGTGVAYG----TDTVLRLDSPGSSIPYMSTS  56

Query  644  KGIKRKWSSIDGS  682
            KG KRKWS +DGS
Sbjct  57   KGTKRKWSLMDGS  69



>ref|XP_007040390.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24891.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=657

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F  LG+AAN SSNAFK LG  +Q GG           DT LRLDS  SS   + +S
Sbjct  1    MDTRFSNLGFAANFSSNAFKILGGSMQVGGTGVAYG----TDTVLRLDSPGSSIPYMSTS  56

Query  644  KGIKRKWSSIDGS  682
            KG KRKWS +DGS
Sbjct  57   KGTKRKWSLMDGS  69



>gb|KDO76383.1| hypothetical protein CISIN_1g011430mg [Citrus sinensis]
 gb|KDO76384.1| hypothetical protein CISIN_1g011430mg [Citrus sinensis]
Length=486

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MDP F  L +AAN S NAFK  G+  Q GGA          DT LRLDS  SS   I +S
Sbjct  1    MDPSFQRLSFAANYSLNAFKTSGSSRQAGGAGAEDG----TDTILRLDSPGSSNPHISAS  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWS IDGS     GS
Sbjct  57   KGIKRKWSLIDGSVHQQVGS  76



>ref|XP_006391666.1| hypothetical protein EUTSA_v10023333mg [Eutrema salsugineum]
 gb|ESQ28952.1| hypothetical protein EUTSA_v10023333mg [Eutrema salsugineum]
Length=654

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 44/73 (60%), Gaps = 7/73 (10%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            M   FH  G+A N SSN+FK LG P+Q    E        ADTTLRLD   S A  + ++
Sbjct  1    MHARFHNSGFAGNSSSNSFKILGRPLQVEVPEVEFG----ADTTLRLD---SLASPLSNT  53

Query  644  KGIKRKWSSIDGS  682
            KGIKRKWS IDG+
Sbjct  54   KGIKRKWSLIDGA  66



>ref|XP_006476466.1| PREDICTED: uncharacterized protein LOC102631154 isoform X1 [Citrus 
sinensis]
 ref|XP_006476467.1| PREDICTED: uncharacterized protein LOC102631154 isoform X2 [Citrus 
sinensis]
Length=684

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MDP F  L +AAN S NAFK  G+  Q GGA          DT LRLDS  SS   I +S
Sbjct  1    MDPSFQRLSFAANYSLNAFKTSGSSRQAGGAGAEDG----TDTILRLDSPGSSNPHISAS  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWS IDGS     GS
Sbjct  57   KGIKRKWSLIDGSVHQQVGS  76



>ref|XP_004245556.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
 ref|XP_004245557.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
 ref|XP_010325376.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
 ref|XP_010325377.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
Length=681

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MDP F  +G+  N   +AFKNLG  I  G A   G    CADTTLRLDS  SS  SIP+ 
Sbjct  1    MDPRFRYVGFTVNPQLSAFKNLGKSIAVGEAGVGGSY--CADTTLRLDSICSSVPSIPAP  58

Query  644  KGIKRKWSSI  673
            KGIKRKWSS+
Sbjct  59   KGIKRKWSSL  68



>ref|XP_006439437.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
 ref|XP_006439438.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
 gb|ESR52677.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
 gb|ESR52678.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
Length=684

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MDP F  L +AAN S NAFK  G+  Q GGA          DT LRLDS  SS   I +S
Sbjct  1    MDPSFQRLSFAANYSLNAFKTSGSSRQAGGAGAEDG----TDTILRLDSPGSSNPHISAS  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWS IDGS     GS
Sbjct  57   KGIKRKWSLIDGSVHQQVGS  76



>gb|KHG18325.1| putative WRKY transcription factor 19 -like protein [Gossypium 
arboreum]
Length=676

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 46/80 (58%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  F  LG+ AN S+NAFK LG+ IQ GG           DT LRLDS  SS     ++
Sbjct  1    MDTRFSHLGFTANYSANAFKILGSSIQVGGNGAAYS----TDTDLRLDSPGSSIPCRSTA  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKW+ +DGS     GS
Sbjct  57   KGIKRKWNLMDGSIGEQVGS  76



>ref|XP_009334483.1| PREDICTED: uncharacterized protein LOC103927300 [Pyrus x bretschneideri]
Length=668

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD     LG+AAN+SSNAF+ LGN ++ GGA G        DT LRL+S  SS   +PS 
Sbjct  1    MDNRLQSLGFAANVSSNAFRILGNSMEVGGAGGEYS----TDTILRLNSPGSSMAHMPSP  56

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            KGIKRKWSS+ G      GS
Sbjct  57   KGIKRKWSSVGGPLTQHVGS  76



>ref|XP_002509888.1| transcription factor, putative [Ricinus communis]
 gb|EEF51275.1| transcription factor, putative [Ricinus communis]
Length=677

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            M+  F  LG+AA   SNAFK LG+    GG         CADT LRLDS  SS      S
Sbjct  1    MENKFQNLGFAATCPSNAFKILGSSTLVGGPVAEY----CADTVLRLDSPGSSVSCTSQS  56

Query  644  KGIKRKWSSIDGS  682
            KGIKRKW+ IDG+
Sbjct  57   KGIKRKWNFIDGT  69



>ref|XP_004244623.1| PREDICTED: uncharacterized protein LOC101256504 [Solanum lycopersicum]
Length=663

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = +2

Query  464  MDPIFHGLGYAANLSSNAFKNLGNPIQFggaegvgvggNCADTTLRLDsfsssalsipss  643
            MD  FH LG+AAN SSN  K++G+ I+    E    G +CA+TTL+LDS  S     P++
Sbjct  1    MDSRFHYLGFAANPSSNTSKSMGDSIRV--NEAEAEGADCANTTLQLDSVGSLMPLFPAT  58

Query  644  KGIKRKWSSIDGSXKSAAGS  703
            K IK  WS I GS     GS
Sbjct  59   KEIKHNWSLIRGSVDQQIGS  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394