BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig134

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802140.1|  PREDICTED: 26S proteasome regulatory subunit...    362   5e-121   Nicotiana sylvestris
ref|XP_004242383.1|  PREDICTED: 26S proteasome regulatory subunit...    359   6e-120   Solanum lycopersicum
ref|XP_009601763.1|  PREDICTED: 26S proteasome regulatory subunit...    359   7e-120   Nicotiana tomentosiformis
ref|NP_001275024.1|  26S proteasome subunit 4-like                      358   1e-119   Solanum tuberosum [potatoes]
ref|XP_011080157.1|  PREDICTED: 26S proteasome regulatory subunit...    357   4e-119   Sesamum indicum [beniseed]
emb|CDP03836.1|  unnamed protein product                                357   6e-119   Coffea canephora [robusta coffee]
ref|XP_006352708.1|  PREDICTED: 26S proteasome regulatory subunit...    355   2e-118   Solanum tuberosum [potatoes]
gb|EPS64118.1|  hypothetical protein M569_10659                         351   1e-116   Genlisea aurea
gb|EYU17968.1|  hypothetical protein MIMGU_mgv1a006475mg                350   4e-116   Erythranthe guttata [common monkey flower]
ref|XP_007048402.1|  Regulatory particle AAA-ATPase 2A isoform 2        347   5e-116   
gb|KCW58094.1|  hypothetical protein EUGRSUZ_H00817                     344   6e-116   Eucalyptus grandis [rose gum]
ref|XP_007049878.1|  Regulatory particle AAA-ATPase 2A                  348   1e-115   Theobroma cacao [chocolate]
ref|XP_007048401.1|  Regulatory particle AAA-ATPase 2A isoform 1        348   2e-115   
gb|KDO65849.1|  hypothetical protein CISIN_1g0115531mg                  342   4e-115   Citrus sinensis [apfelsine]
gb|KHG18015.1|  26S proteasome regulatory subunit 4 A -like protein     347   9e-115   Gossypium arboreum [tree cotton]
ref|XP_003521331.1|  PREDICTED: 26S proteasome regulatory subunit...    346   9e-115   Glycine max [soybeans]
gb|KCW58093.1|  hypothetical protein EUGRSUZ_H00817                     345   1e-114   Eucalyptus grandis [rose gum]
ref|XP_002263334.1|  PREDICTED: 26S proteasome regulatory subunit...    346   1e-114   Vitis vinifera
ref|XP_008372431.1|  PREDICTED: 26S proteasome regulatory subunit...    346   2e-114   Malus domestica [apple tree]
gb|KJB18716.1|  hypothetical protein B456_003G066800                    346   2e-114   Gossypium raimondii
ref|XP_008382660.1|  PREDICTED: 26S proteasome regulatory subunit...    346   2e-114   
ref|XP_004290031.1|  PREDICTED: 26S proteasome regulatory subunit...    345   2e-114   Fragaria vesca subsp. vesca
gb|KHG23423.1|  26S proteasome regulatory subunit 4 A -like protein     345   2e-114   Gossypium arboreum [tree cotton]
dbj|BAJ79010.1|  regulatory particle triple-A ATPase 2                  345   3e-114   Sophora flavescens
ref|XP_004493865.1|  PREDICTED: 26S proteasome regulatory subunit...    345   3e-114   Cicer arietinum [garbanzo]
gb|KHG28065.1|  26S proteasome regulatory subunit 4 B -like protein     345   4e-114   Gossypium arboreum [tree cotton]
gb|KJB26079.1|  hypothetical protein B456_004G224000                    344   5e-114   Gossypium raimondii
ref|XP_008235533.1|  PREDICTED: 26S proteasome regulatory subunit...    345   5e-114   Prunus mume [ume]
gb|KJB10976.1|  hypothetical protein B456_001G234700                    344   5e-114   Gossypium raimondii
ref|XP_010069676.1|  PREDICTED: 26S proteasome regulatory subunit...    344   6e-114   Eucalyptus grandis [rose gum]
ref|XP_003554317.1|  PREDICTED: 26S proteasome regulatory subunit...    344   6e-114   Glycine max [soybeans]
ref|XP_002320617.2|  hypothetical protein POPTR_0014s18530g             343   7e-114   
ref|XP_006845594.1|  PREDICTED: 26S proteasome regulatory subunit...    343   1e-113   Amborella trichopoda
ref|XP_009371109.1|  PREDICTED: 26S proteasome regulatory subunit...    343   1e-113   
ref|XP_007162652.1|  hypothetical protein PHAVU_001G168800g             343   2e-113   Phaseolus vulgaris [French bean]
ref|XP_010109676.1|  26S proteasome regulatory subunit 4-B-like p...    343   2e-113   Morus notabilis
ref|XP_010245668.1|  PREDICTED: 26S proteasome regulatory subunit...    343   3e-113   Nelumbo nucifera [Indian lotus]
ref|XP_010264024.1|  PREDICTED: 26S proteasome regulatory subunit...    342   4e-113   Nelumbo nucifera [Indian lotus]
ref|XP_006443671.1|  hypothetical protein CICLE_v10020143mg             342   4e-113   Citrus clementina [clementine]
gb|KHN09416.1|  26S proteasome regulatory subunit 4 like A              342   5e-113   Glycine soja [wild soybean]
ref|XP_011011091.1|  PREDICTED: 26S proteasome regulatory subunit...    342   7e-113   Populus euphratica
ref|XP_004149071.1|  PREDICTED: 26S proteasome regulatory subunit...    342   7e-113   Cucumis sativus [cucumbers]
ref|XP_002301829.1|  26S protease regulatory complex subunit 4 fa...    341   8e-113   Populus trichocarpa [western balsam poplar]
ref|XP_003537160.1|  PREDICTED: 26S proteasome regulatory subunit...    341   9e-113   Glycine max [soybeans]
ref|XP_007144443.1|  hypothetical protein PHAVU_007G156500g             341   9e-113   Phaseolus vulgaris [French bean]
ref|XP_003542453.1|  PREDICTED: 26S proteasome regulatory subunit...    341   1e-112   Glycine max [soybeans]
gb|KEH23989.1|  regulatory particle triple-A ATPase                     340   1e-112   Medicago truncatula
ref|XP_003625484.1|  26S proteasome regulatory subunit-like protein     341   1e-112   Medicago truncatula
ref|XP_011024543.1|  PREDICTED: 26S proteasome regulatory subunit...    340   2e-112   Populus euphratica
ref|XP_010099046.1|  26S proteasome regulatory subunit 4-A-like p...    338   1e-111   Morus notabilis
gb|KEH42401.1|  regulatory particle triple-A ATPase                     336   3e-111   Medicago truncatula
ref|XP_006283684.1|  hypothetical protein CARUB_v10004747mg             338   4e-111   
ref|XP_004495023.1|  PREDICTED: 26S proteasome regulatory subunit...    336   1e-110   Cicer arietinum [garbanzo]
gb|KEH42402.1|  regulatory particle triple-A ATPase                     336   1e-110   Medicago truncatula
ref|XP_002526219.1|  26S protease regulatory subunit, putative          335   3e-110   Ricinus communis
ref|XP_004152012.1|  PREDICTED: 26S proteasome regulatory subunit...    334   5e-110   Cucumis sativus [cucumbers]
ref|XP_012085169.1|  PREDICTED: 26S proteasome regulatory subunit...    333   2e-109   Jatropha curcas
emb|CAC14432.1|  26S proteasome subunit 4-like protein                  333   2e-109   Brassica napus [oilseed rape]
ref|XP_010489089.1|  PREDICTED: 26S proteasome regulatory subunit...    333   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002885999.1|  hypothetical protein ARALYDRAFT_480455             333   2e-109   
ref|XP_002869455.1|  regulatory particle triple-a 2A                    332   3e-109   Arabidopsis lyrata subsp. lyrata
ref|NP_194633.1|  regulatory particle AAA-ATPase 2A                     332   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521148.1|  26S protease regulatory subunit, putative          331   3e-109   
ref|XP_012065309.1|  PREDICTED: 26S proteasome regulatory subunit...    332   4e-109   Jatropha curcas
gb|ACJ84720.1|  unknown                                                 323   4e-109   Medicago truncatula
ref|XP_010438356.1|  PREDICTED: 26S proteasome regulatory subunit...    332   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010433142.1|  PREDICTED: 26S proteasome regulatory subunit...    332   4e-109   Camelina sativa [gold-of-pleasure]
gb|ABR16267.1|  unknown                                                 332   5e-109   Picea sitchensis
ref|XP_009129033.1|  PREDICTED: 26S proteasome regulatory subunit...    332   6e-109   Brassica rapa
ref|XP_010416236.1|  PREDICTED: 26S proteasome regulatory subunit...    332   6e-109   Camelina sativa [gold-of-pleasure]
emb|CDY06847.1|  BnaC01g09460D                                          331   6e-109   
gb|KFK29443.1|  hypothetical protein AALP_AA7G135000                    331   9e-109   Arabis alpina [alpine rockcress]
ref|XP_006412885.1|  hypothetical protein EUTSA_v10026925mg             335   1e-108   
ref|NP_179604.1|  26S proteasome subunit RPT2B                          331   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109057.1|  PREDICTED: 26S proteasome regulatory subunit...    331   1e-108   Brassica rapa
ref|XP_008789682.1|  PREDICTED: 26S proteasome regulatory subunit...    330   2e-108   Phoenix dactylifera
emb|CDX97472.1|  BnaC08g13370D                                          330   2e-108   
ref|XP_010540956.1|  PREDICTED: 26S proteasome regulatory subunit...    330   3e-108   Tarenaya hassleriana [spider flower]
ref|XP_006297610.1|  hypothetical protein CARUB_v10013630mg             330   4e-108   
gb|AAK50114.1|AF372977_1  At2g20140/T2G17.6                             329   5e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AAF22522.1|AF123391_1  26S proteasome AAA-ATPase subunit RPT2a       329   5e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65126.1|  26S proteasome subunit 4                                329   6e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928641.1|  PREDICTED: 26S proteasome regulatory subunit...    328   8e-108   Elaeis guineensis
ref|XP_010526468.1|  PREDICTED: 26S proteasome regulatory subunit...    328   8e-108   Tarenaya hassleriana [spider flower]
ref|XP_010913635.1|  PREDICTED: 26S proteasome regulatory subunit...    327   2e-107   
ref|XP_008800188.1|  PREDICTED: 26S proteasome regulatory subunit...    327   3e-107   Phoenix dactylifera
ref|XP_006408928.1|  hypothetical protein EUTSA_v10001985mg             325   1e-106   
gb|KDP43828.1|  hypothetical protein JCGZ_23036                         323   9e-106   Jatropha curcas
ref|XP_009395473.1|  PREDICTED: 26S protease regulatory subunit 4...    322   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146268.1|  uncharacterized protein LOC100279843               322   2e-105   Zea mays [maize]
gb|ACG31403.1|  26S protease regulatory subunit 4                       322   3e-105   Zea mays [maize]
ref|XP_009395470.1|  PREDICTED: 26S protease regulatory subunit 4...    322   4e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004984889.1|  PREDICTED: 26S protease regulatory subunit 4...    321   8e-105   Setaria italica
ref|XP_001769084.1|  predicted protein                                  321   1e-104   
ref|NP_001049843.1|  Os03g0298400                                       321   1e-104   
dbj|BAA04615.1|  rice homologue of Tat binding protein                  320   1e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060719.1|  Os07g0691800                                       320   3e-104   
ref|XP_002966632.1|  hypothetical protein SELMODRAFT_267030             318   9e-104   Selaginella moellendorffii
gb|EMS67713.1|  26S protease regulatory subunit 4-like protein          318   1e-103   Triticum urartu
ref|XP_001752421.1|  predicted protein                                  318   1e-103   
ref|XP_003558120.1|  PREDICTED: 26S protease regulatory subunit 4...    315   2e-102   Brachypodium distachyon [annual false brome]
ref|XP_001754191.1|  predicted protein                                  313   9e-102   
ref|XP_010684990.1|  PREDICTED: 26S proteasome regulatory subunit...    312   2e-101   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK03283.1|  predicted protein                                      311   5e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010233630.1|  PREDICTED: 26S protease regulatory subunit 4...    306   4e-99    Brachypodium distachyon [annual false brome]
gb|AAL73395.1|AF432345_1  26S proteasome regulatory subunit IV          306   5e-99    Syntrichia ruralis
ref|XP_004958786.1|  PREDICTED: 26S protease regulatory subunit 4...    305   9e-99    Setaria italica
ref|XP_008653527.1|  PREDICTED: 26S protease regulatory subunit 4...    304   4e-98    Zea mays [maize]
ref|XP_002463440.1|  hypothetical protein SORBIDRAFT_02g043840          303   1e-97    Sorghum bicolor [broomcorn]
gb|EMT04844.1|  26S protease regulatory subunit 4-like protein          301   9e-95    
ref|XP_009592455.1|  PREDICTED: 26S proteasome regulatory subunit...    284   2e-94    
gb|KJB18717.1|  hypothetical protein B456_003G066800                    292   7e-94    Gossypium raimondii
gb|KJB18718.1|  hypothetical protein B456_003G066800                    292   1e-93    Gossypium raimondii
emb|CBI37252.3|  unnamed protein product                                279   6e-89    Vitis vinifera
ref|NP_001229616.1|  proteasome 26S subunit subunit 4 ATPase-like       273   4e-86    Strongylocentrotus purpuratus [purple urchin]
gb|ACH56913.1|  26S proteasome regulatory complex ATPase RPT2           265   5e-86    Simulium vittatum
gb|ERL96197.1|  hypothetical protein D910_01383                         267   2e-85    Dendroctonus ponderosae
gb|ERL96126.1|  hypothetical protein D910_01116                         267   3e-85    Dendroctonus ponderosae
gb|AHH81783.1|  26S protease regulatory subunit 4-like protein          263   8e-85    Biomphalaria glabrata [bloodfluke planorb]
gb|EHJ78448.1|  putative 26S protease regulatory subunit 4              266   2e-84    
dbj|BAN20514.1|  proteasome 26S subunit subunit 4 ATPase                268   2e-84    Riptortus pedestris
ref|XP_011550572.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    268   3e-84    Plutella xylostella [cabbage moth]
gb|AEE62840.1|  unknown                                                 267   5e-84    Dendroctonus ponderosae
ref|XP_001655853.1|  AAEL012095-PA                                      267   6e-84    Aedes aegypti
ref|XP_010548707.1|  PREDICTED: 26S proteasome regulatory subunit...    267   6e-84    
dbj|BAM19425.1|  proteasome 26S subunit subunit 4 ATPase                267   7e-84    Papilio xuthus [Chinese swallowtail]
ref|XP_001861875.1|  26S protease regulatory subunit 4                  267   8e-84    Culex quinquefasciatus
ref|XP_002959240.1|  26S proteasome regulatory complex                  266   1e-83    Volvox carteri f. nagariensis
emb|CCA21636.1|  26S proteasome AAAATPase subunit RPT2a putative        266   1e-83    Albugo laibachii Nc14
ref|XP_974859.1|  PREDICTED: 26S protease regulatory subunit 4          266   2e-83    Tribolium castaneum [rust-red flour beetle]
ref|XP_012150316.1|  PREDICTED: 26S protease regulatory subunit 4       266   2e-83    Megachile rotundata
gb|ETN59541.1|  26S protease regulatory subunit 4                       266   2e-83    Anopheles darlingi [American malaria mosquito]
gb|KDR19574.1|  26S protease regulatory subunit 4                       265   3e-83    Zootermopsis nevadensis
ref|XP_003696714.1|  PREDICTED: 26S protease regulatory subunit 4...    265   5e-83    Apis florea [dwarf honeybee]
ref|XP_623527.1|  PREDICTED: 26S protease regulatory subunit 4 is...    265   5e-83    Apis mellifera [bee]
ref|XP_003395819.1|  PREDICTED: 26S protease regulatory subunit 4...    265   5e-83    Bombus terrestris [large earth bumblebee]
ref|XP_004523315.1|  PREDICTED: 26S protease regulatory subunit 4...    265   5e-83    Ceratitis capitata [medfly]
gb|KFB53205.1|  hypothetical protein ZHAS_00021511                      265   6e-83    Anopheles sinensis
ref|XP_011051171.1|  PREDICTED: 26S protease regulatory subunit 4       265   6e-83    Acromyrmex echinatior
ref|XP_001982075.1|  GG12390                                            265   6e-83    Drosophila erecta
gb|EGI70823.1|  26S protease regulatory subunit 4                       265   6e-83    Acromyrmex echinatior
ref|XP_011185945.1|  PREDICTED: 26S protease regulatory subunit 4       265   6e-83    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_001993700.1|  GH19692                                            265   7e-83    Drosophila grimshawi
ref|XP_001690446.1|  26S proteasome regulatory subunit                  265   7e-83    Chlamydomonas reinhardtii
ref|XP_001622029.1|  hypothetical protein NEMVEDRAFT_v1g176351          259   7e-83    Nematostella vectensis
ref|NP_524469.2|  regulatory particle triple-A ATPase 2, isoform A      264   7e-83    Drosophila melanogaster
ref|XP_002000888.1|  GI22277                                            264   8e-83    Drosophila mojavensis
ref|XP_001358781.1|  GA18789                                            264   8e-83    Drosophila pseudoobscura pseudoobscura
ref|XP_001953861.1|  GF17023                                            265   9e-83    
ref|XP_002053771.1|  GJ24070                                            264   9e-83    
ref|XP_312923.4|  AGAP003215-PA                                         264   9e-83    Anopheles gambiae str. PEST
gb|ACI68459.1|  26S protease regulatory subunit 4                       257   1e-82    Salmo salar
ref|XP_005838339.1|  26S proteasome regulatory complex, ATPase RPT2     264   1e-82    Guillardia theta CCMP2712
ref|XP_011640062.1|  PREDICTED: 26S protease regulatory subunit 4       264   1e-82    Pogonomyrmex barbatus
ref|XP_002900803.1|  26S protease regulatory subunit 4                  264   1e-82    Phytophthora infestans T30-4
ref|XP_009521651.1|  hypothetical protein PHYSODRAFT_354148             264   2e-82    Phytophthora sojae
ref|XP_008550534.1|  PREDICTED: 26S protease regulatory subunit 4       263   2e-82    Microplitis demolitor
ref|XP_001604655.1|  PREDICTED: 26S protease regulatory subunit 4       264   2e-82    Nasonia vitripennis
ref|XP_005179926.1|  PREDICTED: 26S protease regulatory subunit 4       263   2e-82    Musca domestica
gb|AII16487.1|  26S protease regulatory subunit 4                       263   2e-82    Paracyclopina nana
ref|XP_011260462.1|  PREDICTED: 26S protease regulatory subunit 4       263   2e-82    Camponotus floridanus
emb|CCI47533.1|  unnamed protein product                                263   2e-82    Albugo candida
ref|XP_011400256.1|  26S proteasome regulatory subunit 4-like pro...    263   2e-82    Auxenochlorella protothecoides
ref|XP_011146352.1|  PREDICTED: 26S protease regulatory subunit 4       263   2e-82    Harpegnathos saltator
ref|XP_008896011.1|  26S protease regulatory subunit 4                  263   2e-82    Phytophthora parasitica INRA-310
ref|XP_011343804.1|  PREDICTED: 26S protease regulatory subunit 4       263   2e-82    Ooceraea biroi
ref|XP_011303495.1|  PREDICTED: 26S protease regulatory subunit 4       263   2e-82    Fopius arisanus
gb|EFN79932.1|  26S protease regulatory subunit 4                       264   4e-82    Harpegnathos saltator
gb|ACO07775.1|  26S protease regulatory subunit 4                       256   8e-82    Oncorhynchus mykiss
ref|XP_002402795.1|  ATPase, putative                                   256   9e-82    Ixodes scapularis [blacklegged tick]
ref|XP_005710517.1|  26S proteasome ATP-dependent regulatory subunit    261   1e-81    Chondrus crispus [carageen]
ref|XP_005106466.1|  PREDICTED: 26S protease regulatory subunit 4...    261   1e-81    Aplysia californica
gb|ETP34278.1|  26S protease regulatory subunit 4                       261   1e-81    Phytophthora parasitica P10297
gb|KFH72195.1|  26S protease regulatory subunit 4                       261   1e-81    Mortierella verticillata NRRL 6337
ref|XP_005705264.1|  AAA-type ATPase                                    260   1e-81    Galdieria sulphuraria
ref|XP_011504351.1|  PREDICTED: 26S protease regulatory subunit 4       261   2e-81    Ceratosolen solmsi marchali
emb|CDQ64506.1|  unnamed protein product                                255   2e-81    Oncorhynchus mykiss
ref|XP_005773763.1|  hypothetical protein EMIHUDRAFT_444500             260   3e-81    Emiliania huxleyi CCMP1516
ref|XP_008605817.1|  26S proteasome regulatory subunit 4 like A         260   4e-81    Saprolegnia diclina VS20
gb|AAB34134.1|  P26s4                                                   260   4e-81    Drosophila melanogaster
emb|CDQ81314.1|  unnamed protein product                                255   5e-81    Oncorhynchus mykiss
gb|KDO27797.1|  26S proteasome regulatory subunit 4 A                   259   5e-81    Saprolegnia parasitica CBS 223.65
gb|KFK40382.1|  hypothetical protein AALP_AA3G366200                    258   6e-81    Arabis alpina [alpine rockcress]
ref|XP_002613460.1|  hypothetical protein BRAFLDRAFT_119863             259   1e-80    Branchiostoma floridae
ref|XP_009829202.1|  26S protease regulatory subunit 4                  259   1e-80    Aphanomyces astaci
gb|ACO12018.1|  26S protease regulatory subunit 4                       258   2e-80    Lepeophtheirus salmonis
gb|EYU46362.1|  hypothetical protein MIMGU_mgv1a023433mg                258   2e-80    Erythranthe guttata [common monkey flower]
gb|EDK98128.1|  mCG129012                                               252   2e-80    Mus musculus [mouse]
ref|XP_010880812.1|  PREDICTED: 26S protease regulatory subunit 4...    258   2e-80    Esox lucius
ref|XP_008875734.1|  26S protease regulatory subunit 4                  258   3e-80    Aphanomyces invadans
ref|XP_002431748.1|  26S protease regulatory subunit, putative          257   5e-80    Pediculus humanus corporis [human body lice]
gb|ACO10548.1|  26S protease regulatory subunit 4                       256   8e-80    Caligus rogercresseyi
gb|ACH85269.1|  proteasome (prosome, macropain) 26S subunit, ATPa...    256   8e-80    Salmo salar
gb|ACN10996.1|  26S protease regulatory subunit 4                       256   8e-80    Salmo salar
ref|XP_003746341.1|  PREDICTED: 26S protease regulatory subunit 4...    256   1e-79    
ref|XP_003062555.1|  predicted protein                                  256   2e-79    Micromonas pusilla CCMP1545
ref|XP_010780333.1|  PREDICTED: 26S protease regulatory subunit 4...    256   2e-79    Notothenia coriiceps [yellowbelly rockcod]
gb|ESA02536.1|  hypothetical protein GLOINDRAFT_337332                  256   2e-79    
ref|XP_010876963.1|  PREDICTED: 26S protease regulatory subunit 4       255   2e-79    Esox lucius
gb|ACI68908.1|  26S protease regulatory subunit 4                       255   2e-79    Salmo salar
gb|KIZ04434.1|  26S proteasome regulatory subunit T2                    256   3e-79    Monoraphidium neglectum
gb|ELU12421.1|  hypothetical protein CAPTEDRAFT_160726                  255   3e-79    Capitella teleta
ref|XP_009065811.1|  hypothetical protein LOTGIDRAFT_197242             254   4e-79    Lottia gigantea
dbj|BAD96388.1|  proteasome 26S ATPase subunit 1 variant                254   5e-79    Homo sapiens [man]
gb|ACH44455.1|  putative 26S ATPase complex subunit 4                   247   6e-79    Taeniopygia guttata
ref|XP_007253845.1|  PREDICTED: 26S protease regulatory subunit 4...    254   6e-79    
ref|NP_001002091.1|  proteasome (prosome, macropain) 26S subunit,...    254   1e-78    Danio rerio [leopard danio]
ref|XP_004335995.1|  26S proteasome AAAATPase subunit RPT2a, puta...    254   1e-78    Acanthamoeba castellanii str. Neff
gb|ACN10104.1|  26S protease regulatory subunit 4                       253   1e-78    Salmo salar
ref|XP_004083702.1|  PREDICTED: 26S protease regulatory subunit 4       253   2e-78    
ref|XP_008159924.1|  PREDICTED: 26S protease regulatory subunit 4       246   3e-78    
gb|KFZ49324.1|  26S protease regulatory subunit 4                       246   8e-78    Podiceps cristatus
gb|ACO07810.1|  26S protease regulatory subunit 4                       251   8e-78    Oncorhynchus mykiss
ref|XP_002117269.1|  26S proteasome regulatory chain 4                  250   9e-78    Trichoplax adhaerens
ref|XP_004363832.1|  proteasome 26S subunit                             251   1e-77    Capsaspora owczarzaki ATCC 30864
gb|EAW65462.1|  hCG16327, isoform CRA_b                                 246   1e-77    Homo sapiens [man]
gb|KFQ75527.1|  26S protease regulatory subunit 4                       246   2e-77    Phoenicopterus ruber ruber
ref|XP_004294291.1|  PREDICTED: 26S proteasome regulatory subunit...    251   2e-77    Fragaria vesca subsp. vesca
emb|CCG80742.1|  26S protease regulatory subunit 4                      250   2e-77    Taphrina deformans PYCC 5710
gb|EFX87779.1|  hypothetical protein DAPPUDRAFT_306388                  250   2e-77    Daphnia pulex
ref|XP_004924561.1|  PREDICTED: 26S protease regulatory subunit 4...    249   3e-77    
ref|XP_011410414.1|  PREDICTED: 26S protease regulatory subunit 4...    249   3e-77    
gb|AAX25706.2|  SJCHGC04846 protein                                     242   3e-77    Schistosoma japonicum
gb|EMD34033.1|  hypothetical protein CERSUDRAFT_117543                  250   4e-77    Gelatoporia subvermispora B
ref|XP_011425280.1|  PREDICTED: 26S protease regulatory subunit 4       249   4e-77    Crassostrea gigas
emb|CDH57868.1|  26s proteasome subunit p45                             249   4e-77    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH57869.1|  26s proteasome subunit p45                             249   4e-77    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009100602.1|  PREDICTED: 26S protease regulatory subunit 4       249   5e-77    
emb|CDJ05993.1|  proteasome 26s subunit subunit 4 atpase                249   8e-77    
dbj|BAK63819.1|  26S protease regulatory subunit 4                      246   8e-77    Pan troglodytes
ref|XP_002501620.1|  predicted protein                                  249   9e-77    Micromonas commoda
emb|CDS33761.1|  proteasome 26s subunit subunit 4 atpase                248   1e-76    Hymenolepis microstoma
emb|CEG65804.1|  Putative 26s protease regulatory subunit 4             248   1e-76    Rhizopus microsporus
ref|XP_005847625.1|  26S proteasome AAA-ATPase subunit RPT2a            248   1e-76    Chlorella variabilis
ref|XP_002165829.1|  PREDICTED: 26S protease regulatory subunit 4...    248   1e-76    Hydra vulgaris
ref|XP_005769175.1|  hypothetical protein EMIHUDRAFT_355962             248   1e-76    Emiliania huxleyi CCMP1516
ref|XP_007318478.1|  hypothetical protein SERLADRAFT_348772             248   2e-76    Serpula lacrymans var. lacrymans S7.9
ref|XP_003322501.1|  26S protease regulatory subunit 4                  248   2e-76    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_006793170.1|  PREDICTED: 26S protease regulatory subunit 4...    245   2e-76    Neolamprologus brichardi [lyretail cichlid]
gb|ETE70436.1|  26S protease regulatory subunit 4                       246   2e-76    Ophiophagus hannah
gb|EEE58887.1|  hypothetical protein OsJ_10505                          248   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006042318.1|  PREDICTED: 26S protease regulatory subunit 4       248   3e-76    
gb|KFW63950.1|  26S protease regulatory subunit 4                       247   3e-76    Pygoscelis adeliae
gb|EPB87829.1|  26S protease regulatory subunit 4                       247   3e-76    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007330473.1|  hypothetical protein AGABI1DRAFT_114231            248   3e-76    Agaricus bisporus var. burnettii JB137-S8
ref|XP_004376827.1|  PREDICTED: 26S protease regulatory subunit 4       247   3e-76    
ref|XP_006459243.1|  hypothetical protein AGABI2DRAFT_191249            247   3e-76    Agaricus bisporus var. bisporus H97
ref|XP_001416670.1|  predicted protein                                  247   3e-76    Ostreococcus lucimarinus CCE9901
gb|KFR12490.1|  26S protease regulatory subunit 4                       246   4e-76    Opisthocomus hoazin [hoatzin]
emb|CEP14990.1|  hypothetical protein                                   247   4e-76    Parasitella parasitica
dbj|GAN01086.1|  26S proteasome subunit P45                             247   4e-76    Mucor ambiguus
gb|KFP11560.1|  26S protease regulatory subunit 4                       246   4e-76    Egretta garzetta
ref|XP_007633803.1|  PREDICTED: 26S protease regulatory subunit 4...    246   4e-76    
ref|XP_009817125.1|  PREDICTED: 26S protease regulatory subunit 4       247   4e-76    Gavia stellata
gb|EMC87979.1|  26S protease regulatory subunit 4                       247   5e-76    
gb|KFV59426.1|  26S protease regulatory subunit 4                       246   5e-76    Gavia stellata
gb|KFQ29040.1|  26S protease regulatory subunit 4                       247   5e-76    Mesitornis unicolor
ref|NP_595480.1|  19S proteasome regulatory subunit Rpt2                247   5e-76    Schizosaccharomyces pombe
gb|KFQ49939.1|  26S protease regulatory subunit 4                       246   5e-76    Nestor notabilis
gb|KFV19800.1|  26S protease regulatory subunit 4                       247   5e-76    Tauraco erythrolophus
gb|KIP07625.1|  hypothetical protein PHLGIDRAFT_89262                   247   5e-76    Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_003214402.1|  PREDICTED: 26S protease regulatory subunit 4       247   5e-76    Anolis carolinensis [Carolina anole]
ref|XP_009702606.1|  PREDICTED: 26S protease regulatory subunit 4       246   5e-76    Cariama cristata
gb|KFP40116.1|  26S protease regulatory subunit 4                       246   5e-76    Chlamydotis macqueenii
ref|XP_007908313.1|  PREDICTED: 26S protease regulatory subunit 4       247   5e-76    Callorhinchus milii [Australian ghost shark]
gb|KFP32693.1|  26S protease regulatory subunit 4                       246   5e-76    Colius striatus
ref|XP_008049593.1|  PREDICTED: 26S protease regulatory subunit 4       247   5e-76    Carlito syrichta
ref|XP_008697005.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   5e-76    Ursus maritimus [white bear]
ref|XP_009073865.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   6e-76    Acanthisitta chloris
ref|XP_010192568.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    247   6e-76    Mesitornis unicolor
ref|XP_010078854.1|  PREDICTED: 26S protease regulatory subunit 4       246   6e-76    Pterocles gutturalis
ref|NP_001232241.1|  putative 26S ATPase complex subunit 4              246   6e-76    Taeniopygia guttata
ref|XP_008938987.1|  PREDICTED: 26S protease regulatory subunit 4       246   6e-76    Merops nubicus
ref|NP_001080548.1|  proteasome (prosome, macropain) 26S subunit,...    246   6e-76    Xenopus laevis [clawed frog]
ref|XP_009968495.1|  PREDICTED: 26S protease regulatory subunit 4       246   6e-76    Tyto alba [Schleiereule]
ref|XP_009871810.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   6e-76    Apaloderma vittatum
ref|XP_008921933.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   6e-76    
ref|XP_009584690.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   6e-76    Fulmarus glacialis
ref|XP_005438976.1|  PREDICTED: 26S protease regulatory subunit 4       246   6e-76    
gb|KFQ83018.1|  26S protease regulatory subunit 4                       246   6e-76    
gb|EHB02601.1|  26S protease regulatory subunit 4                       246   6e-76    
ref|XP_005506251.1|  PREDICTED: 26S protease regulatory subunit 4       247   6e-76    
gb|KFO76440.1|  26S protease regulatory subunit 4                       246   6e-76    
gb|KGL93771.1|  26S protease regulatory subunit 4                       246   6e-76    
ref|XP_010151155.1|  PREDICTED: 26S protease regulatory subunit 4       246   6e-76    
ref|XP_002171981.1|  19S proteasome regulatory subunit Rpt2             247   6e-76    
ref|XP_003078201.1|  26S proteasome subunit 4-like protein (ISS)        246   6e-76    
ref|XP_005983102.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
ref|XP_005285442.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
ref|XP_009951400.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
ref|XP_010132796.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
ref|XP_010307096.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
ref|XP_009499601.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   7e-76    
gb|KFQ92146.1|  26S protease regulatory subunit 4                       246   7e-76    
ref|XP_010114824.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
gb|KGL73273.1|  26S protease regulatory subunit 4                       246   7e-76    
ref|XP_009903131.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
ref|XP_009987575.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   7e-76    
gb|AAA35484.1|  26S protease (S4) regulatory subunit                    246   7e-76    
ref|XP_007526891.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-76    
ref|NP_032973.1|  26S protease regulatory subunit 4                     246   7e-76    
ref|XP_010392357.1|  PREDICTED: 26S protease regulatory subunit 4...    246   7e-76    
emb|CDS23259.1|  proteasome 26s subunit subunit 4 atpase                247   7e-76    
ref|XP_009883909.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   7e-76    
ref|XP_004055612.1|  PREDICTED: 26S protease regulatory subunit 4...    246   7e-76    
ref|XP_010013217.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   7e-76    
emb|CDJ39342.1|  26S proteasome subunit 4, putative                     246   8e-76    
gb|KFQ30128.1|  26S protease regulatory subunit 4                       246   8e-76    
ref|XP_007180940.1|  PREDICTED: 26S protease regulatory subunit 4...    246   8e-76    
gb|KFW89199.1|  26S protease regulatory subunit 4                       246   8e-76    
dbj|GAA49174.1|  26S proteasome regulatory subunit T2                   245   8e-76    
ref|XP_009474195.1|  PREDICTED: 26S protease regulatory subunit 4       247   8e-76    
ref|XP_010293470.1|  PREDICTED: 26S protease regulatory subunit 4       246   8e-76    
ref|XP_009317798.1|  PREDICTED: 26S protease regulatory subunit 4       246   8e-76    
gb|KFV70634.1|  26S protease regulatory subunit 4                       246   8e-76    
ref|XP_007846015.1|  putative rpt2-26s proteasome regulatory subunit    246   8e-76    
ref|XP_006158084.1|  PREDICTED: 26S protease regulatory subunit 4       247   8e-76    
gb|EUB61439.1|  26S protease regulatory subunit 4                       247   8e-76    
ref|XP_003987959.1|  PREDICTED: 26S protease regulatory subunit 4       246   8e-76    
ref|XP_012037609.1|  PREDICTED: 26S protease regulatory subunit 4...    246   9e-76    
ref|XP_005809990.1|  PREDICTED: 26S protease regulatory subunit 4...    245   9e-76    
ref|XP_011810030.1|  PREDICTED: 26S protease regulatory subunit 4       246   9e-76    
ref|XP_009688138.1|  PREDICTED: 26S protease regulatory subunit 4       246   9e-76    
gb|KFO56091.1|  26S protease regulatory subunit 4                       246   1e-75    
ref|XP_007253016.1|  PREDICTED: 26S protease regulatory subunit 4...    246   1e-75    
gb|EEC75058.1|  hypothetical protein OsI_11173                          246   1e-75    
ref|XP_007262774.1|  26S proteasome subunit P45                         246   1e-75    
emb|CEF97142.1|  26S proteasome subunit P45                             246   1e-75    
gb|EPQ10744.1|  26S protease regulatory subunit 4                       246   1e-75    
ref|XP_001103312.1|  PREDICTED: 26S protease regulatory subunit 4...    246   1e-75    
ref|XP_006028418.1|  PREDICTED: 26S protease regulatory subunit 4       246   1e-75    
ref|XP_008491049.1|  PREDICTED: 26S protease regulatory subunit 4       247   1e-75    
ref|XP_004884174.1|  PREDICTED: 26S protease regulatory subunit 4...    247   1e-75    
gb|KDQ19257.1|  hypothetical protein BOTBODRAFT_170378                  246   1e-75    
ref|XP_011571254.1|  PREDICTED: 26S protease regulatory subunit 4...    246   1e-75    
emb|CDO70660.1|  hypothetical protein BN946_scf184756.g27               246   1e-75    
ref|XP_010202613.1|  PREDICTED: 26S protease regulatory subunit 4       246   1e-75    
ref|XP_005242001.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   1e-75    
ref|XP_005888676.1|  PREDICTED: 26S protease regulatory subunit 4       246   1e-75    
ref|XP_008628045.1|  PREDICTED: 26S protease regulatory subunit 4       246   2e-75    
ref|XP_011805187.1|  PREDICTED: 26S protease regulatory subunit 4       247   2e-75    
ref|XP_003027303.1|  hypothetical protein SCHCODRAFT_238082             246   2e-75    
gb|KDD76237.1|  AAA+ ATPase                                             246   2e-75    
gb|KIL58753.1|  hypothetical protein M378DRAFT_132186                   246   2e-75    
ref|XP_006632337.1|  PREDICTED: 26S protease regulatory subunit 4...    246   2e-75    
ref|XP_009279221.1|  PREDICTED: 26S protease regulatory subunit 4       246   2e-75    
ref|XP_009914241.1|  PREDICTED: 26S protease regulatory subunit 4       246   2e-75    
emb|CAG00116.1|  unnamed protein product                                245   2e-75    
ref|XP_005149701.1|  PREDICTED: 26S protease regulatory subunit 4       247   2e-75    
ref|XP_003440735.1|  PREDICTED: 26S protease regulatory subunit 4...    245   2e-75    
ref|XP_010002048.1|  PREDICTED: 26S protease regulatory subunit 4       247   2e-75    
ref|XP_006122416.1|  PREDICTED: 26S protease regulatory subunit 4       246   2e-75    
ref|XP_005725123.1|  PREDICTED: 26S protease regulatory subunit 4...    245   3e-75    
ref|XP_009018363.1|  hypothetical protein HELRODRAFT_185636             245   3e-75    
ref|XP_005417623.1|  PREDICTED: 26S protease regulatory subunit 4       246   3e-75    
ref|XP_007877676.1|  hypothetical protein PFL1_01974                    244   3e-75    
ref|XP_007393654.1|  hypothetical protein PHACADRAFT_252589             246   3e-75    
gb|ELK01127.1|  26S protease regulatory subunit 4                       246   3e-75    
ref|XP_010392353.1|  PREDICTED: 26S protease regulatory subunit 4...    246   3e-75    
ref|XP_010392347.1|  PREDICTED: 26S protease regulatory subunit 4...    246   4e-75    
ref|XP_008039737.1|  26S proteasome subunit P45                         245   4e-75    
ref|XP_007869061.1|  26S proteasome subunit P45                         244   4e-75    
ref|XP_010582318.1|  PREDICTED: 26S protease regulatory subunit 4       246   4e-75    
ref|NP_001014855.1|  26S protease regulatory subunit 4                  244   4e-75    
gb|KFO18267.1|  26S protease regulatory subunit 4                       246   4e-75    
ref|XP_007383110.1|  26S proteasome subunit P45                         244   4e-75    
gb|KFW88177.1|  26S protease regulatory subunit 4                       234   5e-75    
ref|XP_010348883.1|  PREDICTED: 26S protease regulatory subunit 4       244   5e-75    
gb|KII85055.1|  hypothetical protein PLICRDRAFT_178815                  244   5e-75    
ref|XP_003206722.2|  PREDICTED: 26S protease regulatory subunit 4       246   5e-75    
emb|CBY14503.1|  unnamed protein product                                244   5e-75    
ref|XP_011388969.1|  putative proteasome regulatory particle base...    244   5e-75    
ref|XP_009559613.1|  PREDICTED: 26S protease regulatory subunit 4       246   6e-75    
gb|ABB71588.1|  26S proteasome subunit ATPase 4                         243   6e-75    
gb|KIM73259.1|  hypothetical protein PILCRDRAFT_829271                  244   6e-75    
ref|XP_009647646.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    246   6e-75    
ref|XP_008310982.1|  PREDICTED: 26S protease regulatory subunit 4...    244   6e-75    
ref|NP_001271694.1|  uncharacterized protein LOC101925039               244   6e-75    
ref|XP_007362693.1|  26S proteasome subunit P45                         244   7e-75    
ref|XP_009935165.1|  PREDICTED: 26S protease regulatory subunit 4       246   7e-75    
gb|AAH67741.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    243   9e-75    
ref|XP_003756221.1|  PREDICTED: 26S protease regulatory subunit 4       246   9e-75    
gb|KIY61485.1|  26S proteasome subunit P45                              244   9e-75    
emb|CAZ36600.1|  26S protease regulatory subunit, putative              243   1e-74    
gb|EHH62123.1|  hypothetical protein EGM_20328                          243   1e-74    
gb|EST05622.1|  26S proteasome regulatory complex, ATPase RPT2          243   1e-74    
ref|XP_006681706.1|  hypothetical protein BATDEDRAFT_32324              243   1e-74    
dbj|GAC94094.1|  hypothetical protein PHSY_001663                       243   1e-74    
gb|KDE06590.1|  26S protease regulatory subunit 4                       243   1e-74    
gb|KDN53131.1|  putative RPT2-26S proteasome regulatory subunit         243   1e-74    
ref|XP_004649113.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    245   1e-74    
gb|KHN05911.1|  26S proteasome regulatory subunit 4 like A              241   1e-74    
ref|XP_007299755.1|  26S proteasome subunit P45                         243   2e-74    
emb|CDJ59770.1|  Similar to uniprot|P40327 Saccharomyces cerevisi...    236   2e-74    
dbj|BAM11111.1|  proteasome (prosome, macropain) 26S subunit, ATP...    241   2e-74    
ref|XP_002141206.1|  26S proteasome subunit 4                           243   2e-74    
dbj|GAK64532.1|  RPT2-26S proteasome regulatory subunit                 244   2e-74    
gb|AAH16368.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    243   2e-74    
ref|XP_005047560.1|  PREDICTED: 26S protease regulatory subunit 4       246   2e-74    
emb|CDI53416.1|  probable RPT2-26S proteasome regulatory subunit        242   2e-74    
ref|NP_990289.1|  26S protease regulatory subunit 4                     242   3e-74    
emb|CCF52771.1|  probable RPT2-26S proteasome regulatory subunit        242   3e-74    
ref|XP_007414749.1|  ATP-dependent 26S proteasome regulatory subunit    242   3e-74    
dbj|GAC71901.1|  26S proteasome regulatory complex, ATPase RPT2         242   3e-74    
gb|EPY49346.1|  19S proteasome regulatory subunit Rpt2                  242   3e-74    
emb|CAX73881.1|  Proteasome 26S subunit subunit 4 ATPase                242   4e-74    
gb|KIK10182.1|  hypothetical protein K443DRAFT_141943                   242   5e-74    
ref|XP_010233369.1|  PREDICTED: 26S protease regulatory subunit 4...    234   5e-74    
ref|XP_504910.1|  YALI0F02585p                                          241   6e-74    
gb|EKC29780.1|  26S protease regulatory subunit 4                       250   6e-74    
gb|EPX74224.1|  19S proteasome regulatory subunit Rpt2                  241   7e-74    
ref|XP_002677130.1|  predicted protein                                  241   8e-74    
emb|CDW53193.1|  26S proteasome regulatory complex ATPase RPT2          241   8e-74    
gb|KDQ24457.1|  hypothetical protein PLEOSDRAFT_170485                  241   8e-74    
ref|XP_001880695.1|  predicted protein                                  241   1e-73    
gb|KIO31628.1|  hypothetical protein M407DRAFT_128871                   241   1e-73    
emb|CBQ72941.1|  probable RPT2-26S proteasome regulatory subunit        240   1e-73    
gb|EUC64951.1|  26S proteasome regulatory complex, ATPase RPT2          241   1e-73    
gb|AAI54337.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    240   1e-73    
ref|XP_005992765.1|  PREDICTED: 26S protease regulatory subunit 4       240   2e-73    
gb|ELR61578.1|  26S protease regulatory subunit 4                       240   2e-73    
ref|XP_002127866.1|  PREDICTED: 26S protease regulatory subunit 4       240   2e-73    
ref|XP_625714.1|  26S proteasome regulatory subunit S4 like AAA A...    240   2e-73    
gb|KIJ13444.1|  hypothetical protein PAXINDRAFT_81037                   240   2e-73    
ref|XP_008930490.1|  PREDICTED: 26S protease regulatory subunit 4...    230   2e-73    
gb|KIK62983.1|  hypothetical protein GYMLUDRAFT_57752                   240   2e-73    
gb|KDQ57318.1|  hypothetical protein JAAARDRAFT_157515                  240   2e-73    
ref|XP_001948523.1|  PREDICTED: 26S protease regulatory subunit 4       240   3e-73    
emb|CCM00111.1|  predicted protein                                      240   3e-73    
ref|XP_004649731.1|  PREDICTED: 26S protease regulatory subunit 4       246   3e-73    
ref|XP_002494172.1|  One of six ATPases of the 19S regulatory par...    239   3e-73    
gb|EJU04754.1|  26S proteasome subunit P45                              239   3e-73    
emb|CCO30814.1|  26S protease regulatory subunit 4 Short=P26s4          239   5e-73    
gb|KIJ51065.1|  hypothetical protein M422DRAFT_44261                    239   5e-73    
ref|XP_011809801.1|  PREDICTED: 26S protease regulatory subunit 4...    238   9e-73    
ref|NP_956327.1|  proteasome (prosome, macropain) 26S subunit, AT...    238   9e-73    
gb|ACI69519.1|  26S protease regulatory subunit 4                       230   1e-72    
emb|CDK28628.1|  unnamed protein product                                238   1e-72    
gb|EWM27689.1|  26s proteasome subunit 4                                238   1e-72    
gb|KIK96783.1|  hypothetical protein PAXRUDRAFT_825584                  238   2e-72    
gb|KIM33574.1|  hypothetical protein M408DRAFT_310025                   238   2e-72    
emb|CCA75216.1|  probable RPT2-26S proteasome regulatory subunit        237   2e-72    
emb|CDI80922.1|  26S proteasome subunit 4, putative                     239   2e-72    
ref|XP_009545449.1|  26S proteasome regulatory complex, ATPase RPT2     238   2e-72    
ref|XP_001944737.2|  PREDICTED: 26S protease regulatory subunit 4...    237   3e-72    
gb|EPT01431.1|  hypothetical protein FOMPIDRAFT_1023309                 237   4e-72    
ref|XP_673015.1|  26S proteasome regulatory subunit 4                   231   6e-72    
ref|XP_003880859.1|  probable 26S protease regulatory subunit 6B,...    236   6e-72    
emb|CCU99189.1|  unnamed protein product                                235   8e-72    
ref|XP_007342133.1|  26S proteasome subunit P45                         236   8e-72    
gb|KIK16118.1|  hypothetical protein PISMIDRAFT_16051                   236   9e-72    
gb|KIY42837.1|  putative RPT2-26S proteasome regulatory subunit         235   1e-71    
gb|KIO15228.1|  hypothetical protein M404DRAFT_208810                   235   2e-71    
gb|KIJ66972.1|  hypothetical protein HYDPIDRAFT_128491                  234   2e-71    
gb|KFB53206.1|  AGAP003215-PA-like protein                              234   2e-71    
emb|CEJ02486.1|  Putative Proteasome regulatory particle subunit ...    233   2e-71    
gb|KIM67558.1|  hypothetical protein SCLCIDRAFT_1210213                 235   2e-71    
emb|CEG65805.1|  Putative 26s protease regulatory subunit 4             233   3e-71    
ref|XP_007765789.1|  26S proteasome subunit P45                         234   4e-71    
ref|XP_001730706.1|  hypothetical protein MGL_2160                      236   4e-71    
ref|XP_007735746.1|  26S protease regulatory subunit 4                  234   5e-71    
ref|XP_004833397.1|  26S proteasome subunit 4, putative                 233   8e-71    
ref|XP_953936.1|  26S proteasome subunit 4                              233   9e-71    
ref|XP_003844688.1|  similar to 26S protease regulatory subunit 4       234   1e-70    
gb|KFD63631.1|  hypothetical protein M514_09682                         241   1e-70    
gb|ESW95765.1|  26S protease regulatory subunit 4                       233   1e-70    
gb|KFG58896.1|  putative 26S protease regulatory subunit 4              226   1e-70    
gb|EMS22541.1|  26S proteasome regulatory subunit T2                    233   1e-70    
gb|KFD49415.1|  hypothetical protein M513_09682                         241   1e-70    
gb|ERE73673.1|  26S protease regulatory subunit 4-like protein          232   1e-70    
emb|CBJ33278.1|  conserved unknown protein                              233   2e-70    
gb|EGV91914.1|  26S protease regulatory subunit 4                       233   2e-70    
gb|EEE67865.1|  hypothetical protein OsJ_25676                          229   4e-70    
ref|XP_001382353.1|  26S protease regulatory subunit 4-like protein     231   4e-70    
gb|KKA30019.1|  hypothetical protein TD95_004321                        232   4e-70    
ref|XP_006686305.1|  hypothetical protein CANTEDRAFT_130346             231   5e-70    
gb|EUD72611.1|  26S proteasome regulatory subunit 4 like B              231   5e-70    
emb|CEF61023.1|  26S protease regulatory subunit 4                      231   5e-70    
gb|KGG51566.1|  hypothetical protein DI09_31p170                        232   6e-70    
ref|XP_726782.1|  26S proteasome subunit 4 protein                      231   6e-70    
ref|XP_008597310.1|  26S proteasome subunit P45 family protein          231   6e-70    
gb|KHJ45135.1|  26S proteasome subunit P45 family protein               240   6e-70    
gb|KIW16722.1|  hypothetical protein PV08_03911                         231   8e-70    
ref|XP_001836399.1|  endopeptidase                                      231   8e-70    
ref|XP_004221963.1|  26S proteasome regulatory subunit 4                231   8e-70    
gb|KGQ07722.1|  26S protease regulatory subunit 4                       231   9e-70    
gb|KJP87829.1|  26S protease regulatory subunit 4                       231   9e-70    
ref|XP_001614391.1|  26S proteasome regulatory subunit 4                231   9e-70    
emb|CDW71228.1|  26s protease regulatory subunit 4                      231   1e-69    
ref|XP_009159607.1|  26S proteasome regulatory subunit T2               232   1e-69    
gb|EMF12102.1|  proteasome regulatory particle subunit Rpt2             231   1e-69    
ref|XP_002258715.1|  26S proteasome regulatory subunit 4                230   1e-69    
ref|XP_008623308.1|  26S proteasome regulatory subunit 4 like B         230   1e-69    
gb|KIW38608.1|  hypothetical protein PV06_09561                         231   1e-69    
ref|XP_007722868.1|  26S protease regulatory subunit 4                  231   1e-69    
ref|XP_007749500.1|  26S protease regulatory subunit 4                  231   1e-69    
gb|KIV91353.1|  hypothetical protein PV10_05899                         231   1e-69    
ref|XP_006672331.1|  proteasome regulatory particle subunit Rpt2        231   2e-69    
ref|XP_001610851.1|  26S protease regulatory subunit 4                  230   2e-69    
gb|EME43092.1|  hypothetical protein DOTSEDRAFT_45089                   231   2e-69    



>ref|XP_009802140.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Nicotiana sylvestris]
Length=444

 Score =   362 bits (930),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 195/199 (98%), Positives = 197/199 (99%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLPGDRKND DKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT
Sbjct  1    MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>ref|XP_004242383.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Solanum 
lycopersicum]
Length=444

 Score =   359 bits (922),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLPGDRKND DKKEKKFEPAAPPARVGRKQRKQKGSEAAAR+P VTPLT
Sbjct  1    MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARIPAVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>ref|XP_009601763.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana 
tomentosiformis]
 ref|XP_009769924.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana 
sylvestris]
Length=444

 Score =   359 bits (922),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 196/199 (98%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQ PGDRKND DKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT
Sbjct  1    MGQGTPGGLNRQQPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>ref|NP_001275024.1| 26S proteasome subunit 4-like [Solanum tuberosum]
 gb|ABB02638.1| 26S proteasome subunit 4-like [Solanum tuberosum]
Length=444

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLPGDRKND DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1    MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDY LMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYFLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>ref|XP_011080157.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Sesamum 
indicum]
 ref|XP_011083104.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Sesamum 
indicum]
Length=444

 Score =   357 bits (917),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLPGDRKND DKKEKKFEPAAPPARVGRKQRKQKG EAAAR+PTVTPLT
Sbjct  1    MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARIPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>emb|CDP03836.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   357 bits (916),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLPGDRKND DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1    MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFV+NQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>ref|XP_006352708.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Solanum tuberosum]
Length=444

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLPGDRKND DKKEKKFEPAAPPARVGRKQRKQKGSEAAAR+P VTPLT
Sbjct  1    MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARIPAVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            K KLRLLK+ERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KSKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>gb|EPS64118.1| hypothetical protein M569_10659 [Genlisea aurea]
Length=444

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQ PGDRKND DKKEKKFEPAAPPARVGRKQRKQKG EAAAR+PTVTPLT
Sbjct  1    MGQGTPGGLNRQHPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARIPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121  DESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>gb|EYU17968.1| hypothetical protein MIMGU_mgv1a006475mg [Erythranthe guttata]
Length=443

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 2/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLP DRKND DKKEKKFEPAAPPARVGRKQRKQKG +AAAR+PTVTPLT
Sbjct  1    MGQGTPGGLNRQLP-DRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPDAAARIPTVTPLT  59

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLR LK+ERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  60   KCKLRFLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  119

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  120  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  179

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  180  EKAPLESYADIGGLDAQIQ  198



>ref|XP_007048402.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao]
 gb|EOX92559.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao]
Length=382

 Score =   347 bits (891),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 195/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK+D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKSDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KCW58094.1| hypothetical protein EUGRSUZ_H00817 [Eucalyptus grandis]
Length=305

 Score =   344 bits (883),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 192/200 (96%), Gaps = 3/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGGLNRQ  GDRK D  DKKEKKFEPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGLNRQ-SGDRKQDGSDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  59

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  60   TKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  119

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  120  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  179

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  180  VEKAPLESYADIGGLDAQIQ  199



>ref|XP_007049878.1| Regulatory particle AAA-ATPase 2A [Theobroma cacao]
 gb|EOX94035.1| Regulatory particle AAA-ATPase 2A [Theobroma cacao]
Length=446

 Score =   348 bits (894),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 195/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK+D  DKKEKKFEPAAPPARVGR+QRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKSDGSDKKEKKFEPAAPPARVGRRQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_007048401.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao]
 gb|EOX92558.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao]
Length=446

 Score =   348 bits (892),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 195/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK+D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKSDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KDO65849.1| hypothetical protein CISIN_1g0115531mg, partial [Citrus sinensis]
 gb|KDO65850.1| hypothetical protein CISIN_1g0115531mg, partial [Citrus sinensis]
 gb|KDO65851.1| hypothetical protein CISIN_1g0115531mg, partial [Citrus sinensis]
 gb|KDO65852.1| hypothetical protein CISIN_1g0115531mg, partial [Citrus sinensis]
Length=299

 Score =   342 bits (877),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPG-DRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ PG DRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGPGGDRKGDGADKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KHG18015.1| 26S proteasome regulatory subunit 4 A -like protein [Gossypium 
arboreum]
Length=446

 Score =   347 bits (889),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 194/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG+NRQ  PGDRK D  DKK+KKFEPAAPPARVGRKQRKQKGSEAAARLPTVTP
Sbjct  1    MGQGTPGGMNRQGFPGDRKPDGSDKKDKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLD+QIQ
Sbjct  181  KVEKAPLESYADIGGLDSQIQ  201



>ref|XP_003521331.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=446

 Score =   346 bits (888),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 194/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KCW58093.1| hypothetical protein EUGRSUZ_H00817 [Eucalyptus grandis]
Length=402

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 192/200 (96%), Gaps = 3/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGGLNRQ  GDRK D  DKKEKKFEPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGLNRQ-SGDRKQDGSDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  59

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  60   TKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  119

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  120  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  179

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  180  VEKAPLESYADIGGLDAQIQ  199



>ref|XP_002263334.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Vitis 
vinifera]
 emb|CAN78907.1| hypothetical protein VITISV_029788 [Vitis vinifera]
Length=445

 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 194/200 (97%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ LPGDRKND DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGASGGLNRQGLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            +KCKLRLLK+ERIKDYLLMEEEFV+NQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   SKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  181  VEKAPLESYADIGGLDAQIQ  200



>ref|XP_008372431.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Malus domestica]
Length=446

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 193/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KJB18716.1| hypothetical protein B456_003G066800 [Gossypium raimondii]
Length=446

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 194/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  +KKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_008382660.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Malus 
domestica]
Length=446

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 193/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_004290031.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Fragaria 
vesca subsp. vesca]
Length=446

 Score =   345 bits (886),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 193/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKK+EPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGNDKKEKKYEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KHG23423.1| 26S proteasome regulatory subunit 4 A -like protein [Gossypium 
arboreum]
Length=446

 Score =   345 bits (886),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 194/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  +KKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>dbj|BAJ79010.1| regulatory particle triple-A ATPase 2 [Sophora flavescens]
Length=446

 Score =   345 bits (885),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 194/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG+PGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGSPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_004493865.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Cicer arietinum]
Length=446

 Score =   345 bits (885),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 194/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG E+AARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGSDKKDKKFEPAAPPARVGRKQRKQKGPESAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KHG28065.1| 26S proteasome regulatory subunit 4 B -like protein [Gossypium 
arboreum]
 gb|KJB26078.1| hypothetical protein B456_004G224000 [Gossypium raimondii]
Length=446

 Score =   345 bits (884),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ  PGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGFPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLK+ER+KDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   HTKCKLRLLKLERVKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KJB26079.1| hypothetical protein B456_004G224000 [Gossypium raimondii]
Length=423

 Score =   344 bits (882),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ  PGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGFPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLK+ER+KDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   HTKCKLRLLKLERVKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_008235533.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Prunus 
mume]
Length=446

 Score =   345 bits (884),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 193/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK++RIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLDRIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KJB10976.1| hypothetical protein B456_001G234700 [Gossypium raimondii]
Length=446

 Score =   344 bits (883),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 193/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG+NRQ  PGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGMNRQGFPGDRKPDGSDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLD+QIQ
Sbjct  181  KVEKAPLESYADIGGLDSQIQ  201



>ref|XP_010069676.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Eucalyptus 
grandis]
 gb|KCW58092.1| hypothetical protein EUGRSUZ_H00817 [Eucalyptus grandis]
Length=444

 Score =   344 bits (883),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 192/200 (96%), Gaps = 3/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGGLNRQ  GDRK D  DKKEKKFEPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGLNRQ-SGDRKQDGSDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  59

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  60   TKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  119

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  120  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  179

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  180  VEKAPLESYADIGGLDAQIQ  199



>ref|XP_003554317.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=446

 Score =   344 bits (883),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 194/201 (97%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_002320617.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa]
 gb|EEE98932.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa]
Length=423

 Score =   343 bits (880),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 185/200 (93%), Positives = 191/200 (96%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQLPGDRK D  DKK+KKFEPAAPP RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGPSGGLNRQLPGDRKQDGSDKKDKKFEPAAPPVRVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVG+LEEL
Sbjct  61   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKVEEDRSKVDDLRGSPMSVGSLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            V+KAPLESYADIGGLDAQIQ
Sbjct  181  VDKAPLESYADIGGLDAQIQ  200



>ref|XP_006845594.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Amborella 
trichopoda]
 gb|ERN07269.1| hypothetical protein AMTR_s00019p00202640 [Amborella trichopoda]
Length=444

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 194/199 (97%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQG+PGG+N+Q LPG+RK+DDKKEKKFEPAAPP+RVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1    MGQGSPGGMNKQGLPGERKHDDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFV+ QERLKPQE+K EEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVSGQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>ref|XP_009371109.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Pyrus 
x bretschneideri]
Length=446

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFV NQER KPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVTNQERQKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_007162652.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris]
 gb|ESW34646.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris]
Length=446

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 193/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EED SKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDLSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_010109676.1| 26S proteasome regulatory subunit 4-B-like protein [Morus notabilis]
 gb|EXC24146.1| 26S proteasome regulatory subunit 4-B-like protein [Morus notabilis]
Length=446

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/201 (94%), Positives = 193/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNR  LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRPGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFV+NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_010245668.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nelumbo 
nucifera]
Length=445

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 187/200 (94%), Positives = 194/200 (97%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGGLN+  LPGDRK+D DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGLNKGGLPGDRKHDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   TKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  181  VEKAPLESYADIGGLDAQIQ  200



>ref|XP_010264024.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Nelumbo 
nucifera]
Length=445

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 187/200 (94%), Positives = 194/200 (97%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGGLN+  LPGDRK+D DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGLNKGGLPGDRKHDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   TKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  181  VEKAPLESYADIGGLDAQIQ  200



>ref|XP_006443671.1| hypothetical protein CICLE_v10020143mg [Citrus clementina]
 ref|XP_006480183.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Citrus sinensis]
 gb|ESR56911.1| hypothetical protein CICLE_v10020143mg [Citrus clementina]
Length=446

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPG-DRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ PG DRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGTPGGLNRQGPGGDRKGDGADKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LSKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KHN09416.1| 26S proteasome regulatory subunit 4 like A [Glycine soja]
Length=447

 Score =   342 bits (877),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 194/202 (96%), Gaps = 4/202 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGS-EAAARLPTVT  188
            MGQGTPGGLNRQ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG  EAAARLPTVT
Sbjct  1    MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGGPEAAARLPTVT  60

Query  189  PLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLE  368
            PL+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLE
Sbjct  61   PLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLE  120

Query  369  ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  548
            ELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSV
Sbjct  121  ELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSV  180

Query  549  MKVEKAPLESYADIGGLDAQIQ  614
            MKVEKAPLESYADIGGLDAQIQ
Sbjct  181  MKVEKAPLESYADIGGLDAQIQ  202



>ref|XP_011011091.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Populus euphratica]
Length=445

 Score =   342 bits (876),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 191/200 (96%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQLPGDRK D  DKK+KKFEPAAPP RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGPSGGLNRQLPGDRKQDGSDKKDKKFEPAAPPVRVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQE+K EEDRSKVDDLRG+PMSVG+LEEL
Sbjct  61   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEDKVEEDRSKVDDLRGSPMSVGSLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            V+KAPLESYADIGGLDAQIQ
Sbjct  181  VDKAPLESYADIGGLDAQIQ  200



>ref|XP_004149071.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Cucumis 
sativus]
 ref|XP_008452203.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome regulatory subunit 
4 homolog B-like [Cucumis melo]
 gb|KGN61098.1| hypothetical protein Csa_2G049870 [Cucumis sativus]
Length=447

 Score =   342 bits (876),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 183/202 (91%), Gaps = 4/202 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRKNDDkkekkfepaapp--aRVGRKQRKQKGSEAAARLPTVT  188
            MGQGTPGGLNRQ  LPGDRK DD  +K  +       +RVGRKQRKQKG +AAARLPTVT
Sbjct  1    MGQGTPGGLNRQGGLPGDRKQDDPNKKDKKFEPAAPPSRVGRKQRKQKGPDAAARLPTVT  60

Query  189  PLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLE  368
            P TKCKLRLLK+ER+KDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLE
Sbjct  61   PHTKCKLRLLKLERVKDYLLMEEEFVTNQERLKPQEEKNEEDRSKVDDLRGSPMSVGNLE  120

Query  369  ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  548
            ELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSV
Sbjct  121  ELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSV  180

Query  549  MKVEKAPLESYADIGGLDAQIQ  614
            MKVEKAPLESYADIGGLDAQIQ
Sbjct  181  MKVEKAPLESYADIGGLDAQIQ  202



>ref|XP_002301829.1| 26S protease regulatory complex subunit 4 family protein [Populus 
trichocarpa]
 gb|EEE81102.1| 26S protease regulatory complex subunit 4 family protein [Populus 
trichocarpa]
Length=446

 Score =   341 bits (875),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 191/201 (95%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGLNRQ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGPSGGLNRQGLPGDRKQDGSDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   HTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_003537160.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=443

 Score =   341 bits (875),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 187/200 (94%), Positives = 192/200 (96%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+NRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP+
Sbjct  1    MGQGTPGGMNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPV  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  179  VEKAPLESYADIGGLDAQIQ  198



>ref|XP_007144443.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris]
 gb|ESW16437.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris]
Length=443

 Score =   341 bits (875),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 191/200 (96%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+NRQ  GDRK D  DKKEKKFEPAAPP RVGRKQRKQKG EAAARLPTVTP+
Sbjct  1    MGQGTPGGMNRQ--GDRKPDGGDKKEKKFEPAAPPTRVGRKQRKQKGPEAAARLPTVTPV  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  179  VEKAPLESYADIGGLDAQIQ  198



>ref|XP_003542453.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=443

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 192/200 (96%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+NRQ  GDRK D  DKKEKKFEP+APPARVGRKQRKQKG EAAARLPTVTP+
Sbjct  1    MGQGTPGGMNRQ--GDRKPDGGDKKEKKFEPSAPPARVGRKQRKQKGPEAAARLPTVTPV  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  179  VEKAPLESYADIGGLDAQIQ  198



>gb|KEH23989.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=425

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 194/201 (97%), Gaps = 4/201 (2%)
 Frame = +3

Query  21   MGQGTPGG-LNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG LNRQ PGDRK D  DKK+KKFEPAAPPARVGRKQRKQKGSEAA+RLPTVTP
Sbjct  1    MGQGTPGGGLNRQ-PGDRKPDGNDKKDKKFEPAAPPARVGRKQRKQKGSEAASRLPTVTP  59

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  60   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  119

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  120  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  179

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  180  KVEKAPLESYADIGGLDAQIQ  200



>ref|XP_003625484.1| 26S proteasome regulatory subunit-like protein [Medicago truncatula]
 gb|ABD32889.1| AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula]
 gb|ABN08912.1| AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula]
 gb|AES81702.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=445

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 188/201 (94%), Positives = 194/201 (97%), Gaps = 4/201 (2%)
 Frame = +3

Query  21   MGQGTPGG-LNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG LNRQ PGDRK D  DKK+KKFEPAAPPARVGRKQRKQKGSEAA+RLPTVTP
Sbjct  1    MGQGTPGGGLNRQ-PGDRKPDGNDKKDKKFEPAAPPARVGRKQRKQKGSEAASRLPTVTP  59

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  60   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  119

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  120  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  179

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  180  KVEKAPLESYADIGGLDAQIQ  200



>ref|XP_011024543.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Populus 
euphratica]
Length=446

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 191/201 (95%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGLNRQ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGPSGGLNRQGLPGDRKQDGSDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQ +VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQHEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_010099046.1| 26S proteasome regulatory subunit 4-A-like protein [Morus notabilis]
 gb|EXB76506.1| 26S proteasome regulatory subunit 4-A-like protein [Morus notabilis]
Length=446

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 187/201 (93%), Positives = 191/201 (95%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNR+ LPGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLP VTP
Sbjct  1    MGQGTPGGLNRKGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPVVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFV NQE LKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   LTKCKLRLLKLERIKDYLLMEEEFVTNQECLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KEH42401.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=398

 Score =   336 bits (861),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG+NRQ  PGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG +AA+RLPTVTP
Sbjct  1    MGQGTPGGMNRQGHPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPDAASRLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            ++KCKLRLLK+ER+KDYLLMEEEFVA QERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   VSKCKLRLLKLERVKDYLLMEEEFVAYQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_006283684.1| hypothetical protein CARUB_v10004747mg, partial [Capsella rubella]
 gb|EOA16582.1| hypothetical protein CARUB_v10004747mg, partial [Capsella rubella]
Length=466

 Score =   338 bits (866),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 192/203 (95%), Gaps = 4/203 (2%)
 Frame = +3

Query  12   RRIMGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTV  185
            +RIMGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTV
Sbjct  21   KRIMGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTV  78

Query  186  TPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNL  365
            TP TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNL
Sbjct  79   TPSTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNL  138

Query  366  EELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVS  545
            EELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVS
Sbjct  139  EELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVS  198

Query  546  VMKVEKAPLESYADIGGLDAQIQ  614
            VMKVEKAPLESYADIGGL+AQIQ
Sbjct  199  VMKVEKAPLESYADIGGLEAQIQ  221



>ref|XP_004495023.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Cicer arietinum]
Length=446

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG+NRQ  PGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG +AA+RLPTVTP
Sbjct  1    MGQGTPGGMNRQGHPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPDAASRLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            ++KCKLRLLK+ER+KDYLLMEEEFVA QERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   VSKCKLRLLKLERVKDYLLMEEEFVAYQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|KEH42402.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=446

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 192/201 (96%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG+NRQ  PGDRK D  DKKEKKFEPAAPPARVGRKQRKQKG +AA+RLPTVTP
Sbjct  1    MGQGTPGGMNRQGHPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPDAASRLPTVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            ++KCKLRLLK+ER+KDYLLMEEEFVA QERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   VSKCKLRLLKLERVKDYLLMEEEFVAYQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_002526219.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF36160.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=443

 Score =   335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 191/200 (96%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG P G+NR  PGDRKND  +KK+KK+EPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQG-PSGMNRP-PGDRKNDSDNKKDKKYEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKNEEDRSKVDDLRGSPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  179  VEKAPLESYADIGGLDAQIQ  198



>ref|XP_004152012.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Cucumis sativus]
 ref|XP_008447342.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Cucumis melo]
 gb|KGN58327.1| hypothetical protein Csa_3G623950 [Cucumis sativus]
Length=445

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKNDDkkekkfepaapp--aRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGGLNRQ PGDRK+D  K+K  +        RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGLNRQAPGDRKSDADKKKDKKYEPAAPPTRVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKC+LRLLK+ER+KDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   TKCRLRLLKLERVKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV I+SFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVGIMSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  181  VEKAPLESYADIGGLDAQIQ  200



>ref|XP_012085169.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Jatropha 
curcas]
 gb|KDP26427.1| hypothetical protein JCGZ_17585 [Jatropha curcas]
Length=444

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 191/201 (95%), Gaps = 5/201 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  G  NRQ LPGDRK+D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGPSG--NRQGLPGDRKSDGGDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  58

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  59   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  118

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  119  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  178

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  179  KVEKAPLESYADIGGLDAQIQ  199



>emb|CAC14432.1| 26S proteasome subunit 4-like protein [Brassica napus]
 emb|CDX92914.1| BnaC07g41720D [Brassica napus]
Length=443

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNR  PGDRK D  +KKEKKFEPAAPP+RVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNR--PGDRKPDGNEKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_010489089.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X1 [Camelina sativa]
 ref|XP_010489090.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X2 [Camelina sativa]
Length=443

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQR+QKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKTDGGDKKEKKFEPAAPPARVGRKQRRQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_002885999.1| hypothetical protein ARALYDRAFT_480455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62258.1| hypothetical protein ARALYDRAFT_480455 [Arabidopsis lyrata subsp. 
lyrata]
Length=443

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_002869455.1| regulatory particle triple-a 2A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45714.1| regulatory particle triple-a 2A [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|NP_194633.1| regulatory particle AAA-ATPase 2A [Arabidopsis thaliana]
 sp|Q9SZD4.1|PRS4A_ARATH RecName: Full=26S proteasome regulatory subunit 4 homolog A; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2a; AltName: 
Full=26S proteasome subunit 4 homolog A; AltName: Full=Protein 
HALTED ROOT; AltName: Full=Regulatory particle triple-A 
ATPase subunit 2a [Arabidopsis thaliana]
 emb|CAB43918.1| 26S proteasome subunit 4-like protein [Arabidopsis thaliana]
 emb|CAB79662.1| 26S proteasome subunit 4-like protein [Arabidopsis thaliana]
 gb|AAK59480.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 dbj|BAD18016.1| 26S proteasome subunit AtRPT2a [Arabidopsis thaliana]
 gb|AEE85578.1| regulatory particle AAA-ATPase 2A [Arabidopsis thaliana]
Length=443

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_002521148.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF41299.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=399

 Score =   331 bits (848),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 190/201 (95%), Gaps = 5/201 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  G  NRQ LPG+R+ D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGPSG--NRQGLPGERRQDGGDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  58

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            LTKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  59   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  118

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  119  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  178

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  179  KVEKAPLESYADIGGLDAQIQ  199



>ref|XP_012065309.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X1 [Jatropha curcas]
 ref|XP_012065310.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X2 [Jatropha curcas]
Length=443

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 190/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG P G+NR  PGDRKND  +KK+KK+EPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQG-PSGMNRP-PGDRKNDSDNKKDKKYEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKP EEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPLEEKNEEDRSKVDDLRGSPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  179  VEKAPLESYADIGGLDAQIQ  198



>gb|ACJ84720.1| unknown [Medicago truncatula]
 gb|AFK41190.1| unknown [Medicago truncatula]
Length=202

 Score =   323 bits (828),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 186/196 (95%), Gaps = 4/196 (2%)
 Frame = +3

Query  21   MGQGTPGG-LNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGG LNRQ PGDRK D  DKK+KKFEPAAPPARVGRKQRKQKGSEAA+RLPTVTP
Sbjct  1    MGQGTPGGGLNRQ-PGDRKPDGNDKKDKKFEPAAPPARVGRKQRKQKGSEAASRLPTVTP  59

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  60   LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  119

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  120  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  179

Query  552  KVEKAPLESYADIGGL  599
            KVEKAPLESYADI   
Sbjct  180  KVEKAPLESYADIWWF  195



>ref|XP_010438356.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Camelina sativa]
Length=444

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 189/201 (94%), Gaps = 5/201 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND---DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGLNRQ  GDRK D   DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  58

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEE
Sbjct  59   STKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEE  118

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  119  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVM  178

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGL+AQIQ
Sbjct  179  KVEKAPLESYADIGGLEAQIQ  199



>ref|XP_010433142.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Camelina 
sativa]
 ref|XP_010447896.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Camelina 
sativa]
Length=444

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 189/201 (94%), Gaps = 5/201 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND---DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGLNRQ  GDRK D   DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  58

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEE
Sbjct  59   STKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEE  118

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  119  LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVM  178

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGL+AQIQ
Sbjct  179  KVEKAPLESYADIGGLEAQIQ  199



>gb|ABR16267.1| unknown [Picea sitchensis]
Length=444

 Score =   332 bits (850),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQ   GGLNR+  P DRK DDKKEKKFEPAAPP RVGR+QRKQKG EAAARLP VTPLT
Sbjct  1    MGQAHGGGLNRKGSPDDRKQDDKKEKKFEPAAPPTRVGRRQRKQKGPEAAARLPVVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRG+PMSVGNLEE+I
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEEII  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121  DENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLESYADIGGLDAQIQ
Sbjct  181  EKAPLESYADIGGLDAQIQ  199



>ref|XP_009129033.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Brassica 
rapa]
 emb|CDY35245.1| BnaA01g07860D [Brassica napus]
Length=443

 Score =   332 bits (850),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GD+K D  DKKEKKFEPAAPP+RVGRKQR+QKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDKKPDGGDKKEKKFEPAAPPSRVGRKQRRQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_010416236.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Camelina 
sativa]
 ref|XP_010467933.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B isoform 
X1 [Camelina sativa]
 ref|XP_010467934.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B isoform 
X2 [Camelina sativa]
Length=443

 Score =   332 bits (850),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQR+QKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRRQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>emb|CDY06847.1| BnaC01g09460D [Brassica napus]
Length=443

 Score =   331 bits (849),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GD+K D  DKKEKKFEPAAPP+RVGRKQR+QKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDKKPDGGDKKEKKFEPAAPPSRVGRKQRRQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>gb|KFK29443.1| hypothetical protein AALP_AA7G135000 [Arabis alpina]
Length=443

 Score =   331 bits (848),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK++RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLDRIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_006412885.1| hypothetical protein EUTSA_v10026925mg, partial [Eutrema salsugineum]
 gb|ESQ54338.1| hypothetical protein EUTSA_v10026925mg, partial [Eutrema salsugineum]
Length=589

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 191/204 (94%), Gaps = 4/204 (2%)
 Frame = +3

Query  9    RRRIMGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPT  182
            R  IMGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPT
Sbjct  106  REEIMGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPT  163

Query  183  VTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGN  362
            VTP TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGN
Sbjct  164  VTPSTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGN  223

Query  363  LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  542
            LEELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMV
Sbjct  224  LEELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV  283

Query  543  SVMKVEKAPLESYADIGGLDAQIQ  614
            SVMKVEKAPLESYADIGGL+AQIQ
Sbjct  284  SVMKVEKAPLESYADIGGLEAQIQ  307



>ref|NP_179604.1| 26S proteasome subunit RPT2B [Arabidopsis thaliana]
 sp|Q9SL67.1|PRS4B_ARATH RecName: Full=26S proteasome regulatory subunit 4 homolog B; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2b; AltName: 
Full=26S proteasome subunit 4 homolog B; AltName: Full=Regulatory 
particle triple-A ATPase subunit 2b [Arabidopsis thaliana]
 gb|AAD24384.1| 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AAK59577.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AAL07184.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AEC06970.1| 26S proteasome subunit RPT2B [Arabidopsis thaliana]
Length=443

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  +KKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_009109057.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Brassica rapa]
 emb|CDY14224.1| BnaA08g13550D [Brassica napus]
Length=445

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 189/201 (94%), Gaps = 4/201 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND---DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGLNRQ  GDRK D   DKKEKKFEPAAPP+RVGRKQRKQ+G EAAARLPTVTP
Sbjct  1    MGQGPSGGLNRQ-GGDRKPDGGGDKKEKKFEPAAPPSRVGRKQRKQRGPEAAARLPTVTP  59

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEE
Sbjct  60   STKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEE  119

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV I+SFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  120  LIDENHAIVSSSVGPEYYVGIMSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVM  179

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGL+AQIQ
Sbjct  180  KVEKAPLESYADIGGLEAQIQ  200



>ref|XP_008789682.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform 
X1 [Phoenix dactylifera]
 ref|XP_008789683.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform 
X2 [Phoenix dactylifera]
Length=445

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 187/200 (94%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaapp-aRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+N+Q LPGDRK+D  K+ K    A P +RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKC+LRLLK+ERIKDYLLMEEEFVANQERL+P E+K EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   TKCRLRLLKLERIKDYLLMEEEFVANQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  181  VEKAPLESYADIGGLDAQIQ  200



>emb|CDX97472.1| BnaC08g13370D [Brassica napus]
Length=445

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 188/201 (94%), Gaps = 4/201 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND---DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGLNRQ  GDRK D   DKKEKKFEPAAPP+RVGRKQRKQKG EAAARLP VTP
Sbjct  1    MGQGPSGGLNRQ-GGDRKPDGGGDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPAVTP  59

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEE
Sbjct  60   STKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEE  119

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV I+SFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  120  LIDENHAIVSSSVGPEYYVGIMSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVM  179

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGL+AQIQ
Sbjct  180  KVEKAPLESYADIGGLEAQIQ  200



>ref|XP_010540956.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Tarenaya 
hassleriana]
Length=443

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 187/200 (94%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG   GLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSSGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
             KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   AKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_006297610.1| hypothetical protein CARUB_v10013630mg, partial [Capsella rubella]
 gb|EOA30508.1| hypothetical protein CARUB_v10013630mg, partial [Capsella rubella]
Length=468

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARVGRKQRKQ+G EAAARLPTVTP 
Sbjct  26   MGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVGRKQRKQRGPEAAARLPTVTPS  83

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK++RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  84   TKCKLRLLKLDRIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  143

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  144  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  203

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  204  VEKAPLESYADIGGLEAQIQ  223



>gb|AAK50114.1|AF372977_1 At2g20140/T2G17.6 [Arabidopsis thaliana]
Length=443

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  +KKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSV+K
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVVK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>gb|AAF22522.1|AF123391_1 26S proteasome AAA-ATPase subunit RPT2a [Arabidopsis thaliana]
Length=443

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 188/200 (94%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  DKKEKKFEPAAPPARV RKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGDKKEKKFEPAAPPARVVRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>gb|AAM65126.1| 26S proteasome subunit 4 [Arabidopsis thaliana]
Length=443

 Score =   329 bits (843),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 189/200 (95%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGL+RQ  GDRK D  +KKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSGGLHRQ--GDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_010928641.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Elaeis 
guineensis]
 ref|XP_010928642.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Elaeis 
guineensis]
Length=445

 Score =   328 bits (842),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 186/200 (93%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaapp-aRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+N+Q LPGDRK+D  K+ K    A P +RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKC+LRLLK+ERIKDYLLMEEEFV NQERL+P E+K EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   TKCRLRLLKLERIKDYLLMEEEFVTNQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  181  VEKAPLESYADIGGLDAQIQ  200



>ref|XP_010526468.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
Length=443

 Score =   328 bits (842),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 187/200 (94%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRK--NDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG   GLNRQ  GDRK  + DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP 
Sbjct  1    MGQGPSSGLNRQ--GDRKPNSGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
             KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   AKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>ref|XP_010913635.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010913636.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
isoform X2 [Elaeis guineensis]
Length=445

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 186/200 (93%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaapp-aRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+N+Q LPGDRK+D  K+ K    A P +RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKC+LRLLK+ERIKDYLLMEEEFV NQERL+P E+K EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   TKCRLRLLKLERIKDYLLMEEEFVTNQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLD+QIQ
Sbjct  181  VEKAPLESYADIGGLDSQIQ  200



>ref|XP_008800188.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Phoenix dactylifera]
Length=445

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 186/200 (93%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaapp-aRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+N+Q LPGDRK+D  K+ K    A P +RVGRKQRKQKG EAAARLPTVTP+
Sbjct  1    MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPV  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKC+LRLLK+ERIKDYLLMEEEFV NQERL+P E+K EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   TKCRLRLLKLERIKDYLLMEEEFVTNQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  181  VEKAPLESYADIGGLDAQIQ  200



>ref|XP_006408928.1| hypothetical protein EUTSA_v10001985mg [Eutrema salsugineum]
 gb|ESQ50381.1| hypothetical protein EUTSA_v10001985mg [Eutrema salsugineum]
Length=443

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 188/200 (94%), Gaps = 4/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ  GDRK D  +KKEKKFEPAAPPARVGRKQRK KG EAA+RLPTVTP 
Sbjct  1    MGQGPSGGLNRQ--GDRKPDGGEKKEKKFEPAAPPARVGRKQRKLKGPEAASRLPTVTPS  58

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLKMERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRGTPMSVGNLEEL
Sbjct  59   TKCKLRLLKMERIKDYLLMEEEFVSNQERLKPQEDKAEEDRSKVDDLRGTPMSVGNLEEL  118

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  119  IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  178

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGL+AQIQ
Sbjct  179  VEKAPLESYADIGGLEAQIQ  198



>gb|KDP43828.1| hypothetical protein JCGZ_23036 [Jatropha curcas]
Length=436

 Score =   323 bits (828),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 184/192 (96%), Gaps = 3/192 (2%)
 Frame = +3

Query  45   LNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLTKCKLRLL  218
            +NR  PGDRKND  +KK+KK+EPAAPP+RVGRKQRKQKG EAAARLPTVTPLTKCKLRLL
Sbjct  1    MNRP-PGDRKNDSDNKKDKKYEPAAPPSRVGRKQRKQKGPEAAARLPTVTPLTKCKLRLL  59

Query  219  KMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIV  398
            K+ERIKDYLLMEEEFVANQERLKP EEK EEDRSKVDDLRG+PMSVGNLEELIDENHAIV
Sbjct  60   KLERIKDYLLMEEEFVANQERLKPLEEKNEEDRSKVDDLRGSPMSVGNLEELIDENHAIV  119

Query  399  SSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLES  578
            SSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKVEKAPLES
Sbjct  120  SSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVEKAPLES  179

Query  579  YADIGGLDAQIQ  614
            YADIGGLDAQIQ
Sbjct  180  YADIGGLDAQIQ  191



>ref|XP_009395473.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395474.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKNDDkkekkfepaapp--aRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+ +Q P   +  D  +K  +       +RVGRKQR+QKG EAAARLP VTPL
Sbjct  1    MGQGTPGGMGKQGPPGDRKRDGDKKDKKFEPAAPPSRVGRKQRRQKGPEAAARLPAVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            +KC+LR+LK+ERIKDYLLMEEEFVANQERL+PQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   SKCRLRVLKLERIKDYLLMEEEFVANQERLRPQEEKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLD+QIQ
Sbjct  181  VEKAPLESYADIGGLDSQIQ  200



>ref|NP_001146268.1| uncharacterized protein LOC100279843 [Zea mays]
 gb|ACL53605.1| unknown [Zea mays]
 tpg|DAA44915.1| TPA: 26S protease regulatory subunit 4 [Zea mays]
Length=446

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRKNDDkkekkfepaapp-aRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG+PGG+ +Q  LPGDRK  D K++K        +RVGRKQ++QKGSEAAARLP V P
Sbjct  1    MGQGSPGGMGKQPGLPGDRKQGDGKKEKKYEPPAAPSRVGRKQKRQKGSEAAARLPAVAP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KC+LRLLK+ER+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRGTPM+VG+LEE
Sbjct  61   LSKCRLRLLKLERVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMNVGSLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            +IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  121  IIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>gb|ACG31403.1| 26S protease regulatory subunit 4 [Zea mays]
Length=446

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 182/201 (91%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRKNDDkkekkfepaapp-aRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG+PGG+ +Q  LPGDRK  D K++K        +RVGRKQ++QKGSEAAARLP V P
Sbjct  1    MGQGSPGGMGKQPGLPGDRKQGDGKKEKKYEPPAAPSRVGRKQKRQKGSEAAARLPAVAP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
            L+KC+LRLLK+ER+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRGTPM+VG+LEE
Sbjct  61   LSKCRLRLLKLERVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMNVGSLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            +IDE HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  121  IIDETHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  181  KVEKAPLESYADIGGLDAQIQ  201



>ref|XP_009395470.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395472.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaapp-aRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQGTPGG+ +Q LPGDRK D  K+ K    A P +RVGRKQR+QKG EAAARLP VTPL
Sbjct  1    MGQGTPGGMGKQGLPGDRKRDGDKKDKKFEPAAPPSRVGRKQRRQKGPEAAARLPAVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            +KC+LRLLK+ER+KDYLLMEEEFVANQERL+PQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   SKCRLRLLKLERVKDYLLMEEEFVANQERLRPQEEKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLD+QIQ
Sbjct  181  VEKAPLESYADIGGLDSQIQ  200



>ref|XP_004984889.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Setaria 
italica]
Length=447

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 184/202 (91%), Gaps = 4/202 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRKNDDkkekkfepa--appaRVGRKQRKQKGSEAAARLPTVT  188
            MGQGTPGG+ +Q  LPGDRK  D  +K  +    A P+RVGR+Q++QKGSEAAARLP V 
Sbjct  1    MGQGTPGGMGKQGGLPGDRKPGDGGKKDKKYEPPAAPSRVGRRQKRQKGSEAAARLPAVA  60

Query  189  PLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLE  368
            PL+KC+LRLLK+ER+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRGTPMSVG+LE
Sbjct  61   PLSKCRLRLLKLERVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMSVGSLE  120

Query  369  ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  548
            E+IDE+HAIVSSSVGPEYYV ++SFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSV
Sbjct  121  EIIDESHAIVSSSVGPEYYVGVMSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSV  180

Query  549  MKVEKAPLESYADIGGLDAQIQ  614
            MKVEKAPLESYADIGGLDAQIQ
Sbjct  181  MKVEKAPLESYADIGGLDAQIQ  202



>ref|XP_001769084.1| predicted protein [Physcomitrella patens]
 gb|EDQ66162.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 178/201 (89%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPG-DRKNDDkkekkfepaapp--aRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGL +Q PG DR   D  +K+ +       +RVGRKQRKQKGSEAAARLP VTP
Sbjct  1    MGQGQSGGLPKQGPGGDRTKGDGGKKEKKYEPAAPPSRVGRKQRKQKGSEAAARLPVVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLK+ER+KDYLLMEEEFV NQERLKPQE+K EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   ATKCKLRLLKLERVKDYLLMEEEFVTNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            +IDENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM
Sbjct  121  IIDENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLD QIQ
Sbjct  181  KVEKAPLESYADIGGLDPQIQ  201



>ref|NP_001049843.1| Os03g0298400 [Oryza sativa Japonica Group]
 ref|XP_006649937.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Oryza brachyantha]
 dbj|BAB78491.1| 26S proteasome regulatory particle triple-A ATPase subunit2b 
[Oryza sativa Japonica Group]
 gb|ABF95461.1| 26S protease regulatory subunit 4, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11757.1| Os03g0298400 [Oryza sativa Japonica Group]
 dbj|BAG91617.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 187/205 (91%), Gaps = 7/205 (3%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRK-----NDDkkekkfepaappaRVGRKQRKQKGSEAAARLP  179
            MGQGTPGG+ +Q  LPGDRK       DKK++KFEP A P+RVGRKQRKQKG EAAARLP
Sbjct  1    MGQGTPGGMGKQGGLPGDRKPGDGGAGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLP  60

Query  180  TVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVG  359
             V PL+KC+LRLLK+ER+KDYLLMEEEFV +QERL+P E+KTEEDRSKVDDLRGTPMSVG
Sbjct  61   AVAPLSKCRLRLLKLERVKDYLLMEEEFVVSQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  360  NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPM  539
            +LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPM
Sbjct  121  SLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPM  180

Query  540  VSVMKVEKAPLESYADIGGLDAQIQ  614
            VSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  VSVMKVEKAPLESYADIGGLDAQIQ  205



>dbj|BAA04615.1| rice homologue of Tat binding protein [Oryza sativa Japonica 
Group]
Length=448

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 5/203 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRK---NDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTV  185
            MGQGTPGG+ +Q   PGDRK   + DKK++KFEP+A P+RVGRKQRKQKG EAAARLP V
Sbjct  1    MGQGTPGGMGKQGGAPGDRKPGGDGDKKDRKFEPSAAPSRVGRKQRKQKGPEAAARLPNV  60

Query  186  TPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNL  365
             PL+KC+LRLLK+ER+KDYLLMEEEFVA QERL+P E+KTEEDRSKVDDLRGTPMSVG+L
Sbjct  61   APLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPTEDKTEEDRSKVDDLRGTPMSVGSL  120

Query  366  EELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVS  545
            EE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVS
Sbjct  121  EEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVS  180

Query  546  VMKVEKAPLESYADIGGLDAQIQ  614
            VMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  VMKVEKAPLESYADIGGLDAQIQ  203



>ref|NP_001060719.1| Os07g0691800 [Oryza sativa Japonica Group]
 ref|XP_006658170.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Oryza brachyantha]
 sp|P46466.2|PRS4_ORYSJ RecName: Full=26S protease regulatory subunit 4 homolog; AltName: 
Full=Tat-binding protein homolog 2 [Oryza sativa Japonica 
Group]
 dbj|BAC75555.1| 26S proteasome regulatory subunit 4 homolog [Oryza sativa Japonica 
Group]
 dbj|BAF22633.1| Os07g0691800 [Oryza sativa Japonica Group]
 gb|EAY95233.1| hypothetical protein OsI_17051 [Oryza sativa Indica Group]
 dbj|BAG94028.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97398.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86657.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 187/203 (92%), Gaps = 5/203 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRK---NDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTV  185
            MGQGTPGG+ +Q   PGDRK   + DKK++KFEP A P+RVGRKQRKQKG EAAARLP V
Sbjct  1    MGQGTPGGMGKQGGAPGDRKPGGDGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLPNV  60

Query  186  TPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNL  365
             PL+KC+LRLLK+ER+KDYLLMEEEFVA QERL+P E+KTEEDRSKVDDLRGTPMSVG+L
Sbjct  61   APLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPTEDKTEEDRSKVDDLRGTPMSVGSL  120

Query  366  EELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVS  545
            EE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVS
Sbjct  121  EEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVS  180

Query  546  VMKVEKAPLESYADIGGLDAQIQ  614
            VMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  VMKVEKAPLESYADIGGLDAQIQ  203



>ref|XP_002966632.1| hypothetical protein SELMODRAFT_267030 [Selaginella moellendorffii]
 ref|XP_002978110.1| hypothetical protein SELMODRAFT_271301 [Selaginella moellendorffii]
 gb|EFJ20767.1| hypothetical protein SELMODRAFT_271301 [Selaginella moellendorffii]
 gb|EFJ32659.1| hypothetical protein SELMODRAFT_267030 [Selaginella moellendorffii]
Length=444

 Score =   318 bits (815),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 185/200 (93%), Gaps = 3/200 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG   G  RQ   PGDR+ +DKKEKK+EPAAPP RVGRKQRKQKG EAAARLP VTP 
Sbjct  1    MGQGQ-SGFPRQGGPPGDRRQEDKKEKKYEPAAPPTRVGRKQRKQKGPEAAARLPFVTPA  59

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            TKCKLRLLK+ER+KDYLLMEEE+V NQERLKPQE+K EEDRSKVDDLRG+PMSVG+LEE+
Sbjct  60   TKCKLRLLKLERVKDYLLMEEEYVTNQERLKPQEDKNEEDRSKVDDLRGSPMSVGSLEEI  119

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  120  IDENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  179

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQ+Q
Sbjct  180  VEKAPLESYADIGGLDAQVQ  199



>gb|EMS67713.1| 26S protease regulatory subunit 4-like protein [Triticum urartu]
Length=450

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 189/205 (92%), Gaps = 7/205 (3%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRK-----NDDkkekkfepaappaRVGRKQRKQKGSEAAARLP  179
            MGQG+PGG+ +Q  LPGDRK       DKK+KKFEP A P+RVGRKQRKQ+G EAAARLP
Sbjct  1    MGQGSPGGMGKQGGLPGDRKPGDGAAGDKKDKKFEPPAAPSRVGRKQRKQRGPEAAARLP  60

Query  180  TVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVG  359
             V PL+KC+LRLLK++R+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRGTPMSVG
Sbjct  61   PVAPLSKCRLRLLKLDRVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  360  NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPM  539
            +LEE+IDE+HAIVSSSVGPEYYVS+LSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPM
Sbjct  121  SLEEIIDESHAIVSSSVGPEYYVSVLSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPM  180

Query  540  VSVMKVEKAPLESYADIGGLDAQIQ  614
            VSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  VSVMKVEKAPLESYADIGGLDAQIQ  205



>ref|XP_001752421.1| predicted protein [Physcomitrella patens]
 gb|EDQ82660.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 179/201 (89%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPG-DRKNDDkkekkfepaapp--aRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGL +Q PG DR   + ++K+ +   P    RVGRKQRKQKGSEAAARLP VTP
Sbjct  1    MGQGQSGGLPKQGPGGDRNKGNGEKKEKKYDPPAPPTRVGRKQRKQKGSEAAARLPVVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKCKLRLLK++R+KDYLLMEEEFV NQERLKPQE+K EEDRSKVDDLRG+PMSVGNLEE
Sbjct  61   ATKCKLRLLKLDRVKDYLLMEEEFVTNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            +IDENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM
Sbjct  121  IIDENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLD QIQ
Sbjct  181  KVEKAPLESYADIGGLDPQIQ  201



>ref|XP_003558120.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Brachypodium 
distachyon]
Length=450

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 187/205 (91%), Gaps = 7/205 (3%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRK-----NDDkkekkfepaappaRVGRKQRKQKGSEAAARLP  179
            MGQGTPGG+ +Q  LPGDRK       DKK+KKFEP A P+RVGRKQR+QKG + AARLP
Sbjct  1    MGQGTPGGMGKQGGLPGDRKPGDGNAGDKKDKKFEPPAAPSRVGRKQRRQKGPDVAARLP  60

Query  180  TVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVG  359
             V PL+KC+LRLLK++R+KDYLLMEEEFV +QERL+P E+KTEEDRSKVDDLRGTPMSVG
Sbjct  61   PVAPLSKCRLRLLKLDRVKDYLLMEEEFVVSQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  360  NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPM  539
            +LEE+IDE+HAIVSSSVGPEYYVSILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPM
Sbjct  121  SLEEIIDESHAIVSSSVGPEYYVSILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPM  180

Query  540  VSVMKVEKAPLESYADIGGLDAQIQ  614
            VSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  VSVMKVEKAPLESYADIGGLDAQIQ  205



>ref|XP_001754191.1| predicted protein [Physcomitrella patens]
 gb|EDQ81092.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   313 bits (802),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVGRKQRKQKGSEAAARLP VTP TKCKLRLLK+ER+KDYLLMEEEFV NQERLKPQE+K
Sbjct  38   RVGRKQRKQKGSEAAARLPVVTPATKCKLRLLKLERVKDYLLMEEEFVTNQERLKPQEDK  97

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EEDRSKVDDLRG+PMSVGNLEE+IDENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAIL
Sbjct  98   NEEDRSKVDDLRGSPMSVGNLEEIIDENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAIL  157

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD QIQ
Sbjct  158  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDPQIQ  201



>ref|XP_010684990.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVGRKQRKQKG +AAAR+P VTPLTKCKLRLLK+ER+KDYLLMEEEFVANQERLKPQEEK
Sbjct  37   RVGRKQRKQKGPDAAARIPVVTPLTKCKLRLLKLERVKDYLLMEEEFVANQERLKPQEEK  96

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
            TEEDRSKVDD+RG+PMSVG+LEELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+IL
Sbjct  97   TEEDRSKVDDIRGSPMSVGSLEELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSIL  156

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            MHNKVLSVVGLLQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  157  MHNKVLSVVGLLQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQ  200



>dbj|BAK03283.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   311 bits (797),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 177/204 (87%), Gaps = 6/204 (3%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRKNDDkkekkfepa----appaRVGRKQRKQKGSEAAARLPT  182
            MGQGTPGG+ +    PGDR        K +      A P+RVGRKQR+QKG EAAARLP 
Sbjct  1    MGQGTPGGMGKPGGAPGDRNKPGGDGDKKDKKFEPPAAPSRVGRKQRRQKGPEAAARLPN  60

Query  183  VTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGN  362
            V PL+KC+LRLLK++R+KDYLLMEEEFVA QERL+P EEKTEEDRSKVDDLRGTPMSVG+
Sbjct  61   VAPLSKCRLRLLKLDRVKDYLLMEEEFVAAQERLRPTEEKTEEDRSKVDDLRGTPMSVGS  120

Query  363  LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  542
            LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMV
Sbjct  121  LEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV  180

Query  543  SVMKVEKAPLESYADIGGLDAQIQ  614
            SVMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  SVMKVEKAPLESYADIGGLDAQIQ  204



>ref|XP_010233630.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Brachypodium 
distachyon]
Length=450

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 186/205 (91%), Gaps = 7/205 (3%)
 Frame = +3

Query  21   MGQGTPGGLNRQL---PGDRK----NDDkkekkfepaappaRVGRKQRKQKGSEAAARLP  179
            MGQGTPGG+ +Q    PGDR     + DKK++KFEP A P+RVGRKQR+QKG EAAARLP
Sbjct  1    MGQGTPGGMGKQGGGAPGDRNKPGGDGDKKDRKFEPPAAPSRVGRKQRRQKGPEAAARLP  60

Query  180  TVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVG  359
             V PL+KC+LRLLK+ER+KDYLLMEEEFVA QERL+P EEKTEEDRSKVDDLRGTPMSVG
Sbjct  61   HVAPLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPTEEKTEEDRSKVDDLRGTPMSVG  120

Query  360  NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPM  539
            +LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPM
Sbjct  121  SLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPM  180

Query  540  VSVMKVEKAPLESYADIGGLDAQIQ  614
            VSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  VSVMKVEKAPLESYADIGGLDAQIQ  205



>gb|AAL73395.1|AF432345_1 26S proteasome regulatory subunit IV [Syntrichia ruralis]
Length=446

 Score =   306 bits (784),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 179/201 (89%), Gaps = 3/201 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND---DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQG  GGL +Q PG  +N     KKEKK+EPAAPP RVGRKQRKQKGSEAAARLP VTP
Sbjct  1    MGQGQSGGLPKQGPGGERNKGDGQKKEKKYEPAAPPTRVGRKQRKQKGSEAAARLPVVTP  60

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
             TKC LRLLK++R KDYLLM+EEFV  Q+RL PQE+KTE+DRSKVDDLRG+PMSVGNLEE
Sbjct  61   ATKCNLRLLKLDRAKDYLLMKEEFVRTQKRLNPQEDKTEKDRSKVDDLRGSPMSVGNLEE  120

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            +IDENHAIVSSSVGPEYYV+ILSFVDKDQ  PGCAILMHNKVLSVVGLLQDDVDPMVSVM
Sbjct  121  IIDENHAIVSSSVGPEYYVNILSFVDKDQPGPGCAILMHNKVLSVVGLLQDDVDPMVSVM  180

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLD QIQ
Sbjct  181  KVEKAPLESYADIGGLDPQIQ  201



>ref|XP_004958786.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Setaria 
italica]
Length=447

 Score =   305 bits (782),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 185/204 (91%), Gaps = 8/204 (4%)
 Frame = +3

Query  21   MGQGTPGGLNRQL------PGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPT  182
            MGQGTPGG+ +Q       PGD    DKK+KKFEP A P+RVGRKQRKQKG+EAAARLP 
Sbjct  1    MGQGTPGGMGKQGGAGDRKPGD--GADKKDKKFEPPAAPSRVGRKQRKQKGAEAAARLPN  58

Query  183  VTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGN  362
            V PL+KC+LRLLK+ER+KDYLLMEEEFVA QERL+PQE+K EEDRSKVDDLRGTPMSVG+
Sbjct  59   VAPLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPQEDKAEEDRSKVDDLRGTPMSVGS  118

Query  363  LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  542
            LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMV
Sbjct  119  LEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV  178

Query  543  SVMKVEKAPLESYADIGGLDAQIQ  614
            SVMKVEKAPLESYADIGGLDAQIQ
Sbjct  179  SVMKVEKAPLESYADIGGLDAQIQ  202



>ref|XP_008653527.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Zea mays]
 tpg|DAA64239.1| TPA: hypothetical protein ZEAMMB73_409330 [Zea mays]
Length=447

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 185/204 (91%), Gaps = 8/204 (4%)
 Frame = +3

Query  21   MGQGTPGGLNRQL------PGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPT  182
            MGQGTPGG+ +Q       PGD    DKK+KKFEP A P+RVGRKQRKQKG+EAAARLP 
Sbjct  1    MGQGTPGGMGKQGGAGDRKPGD--AGDKKDKKFEPPAAPSRVGRKQRKQKGAEAAARLPN  58

Query  183  VTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGN  362
            V PL+KC+LRLLK++R+KDYLLMEEEFVA QERL+PQE+K EEDRSKVDDLRGTPMSVG+
Sbjct  59   VAPLSKCRLRLLKLDRVKDYLLMEEEFVAAQERLRPQEDKAEEDRSKVDDLRGTPMSVGS  118

Query  363  LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  542
            LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMV
Sbjct  119  LEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV  178

Query  543  SVMKVEKAPLESYADIGGLDAQIQ  614
            SVMKVEKAPLESYADIGGLDAQIQ
Sbjct  179  SVMKVEKAPLESYADIGGLDAQIQ  202



>ref|XP_002463440.1| hypothetical protein SORBIDRAFT_02g043840 [Sorghum bicolor]
 gb|EER99961.1| hypothetical protein SORBIDRAFT_02g043840 [Sorghum bicolor]
Length=447

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVGRKQRKQKG+EAAARLP V PL+KC+LRLLK+ER+KDYLLMEEEFVA QERL+PQE+K
Sbjct  39   RVGRKQRKQKGAEAAARLPNVAPLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPQEDK  98

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EEDRSKVDDLRGTPMSVG+LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+IL
Sbjct  99   AEEDRSKVDDLRGTPMSVGSLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSIL  158

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            MHNKVLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  159  MHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQ  202



>gb|EMT04844.1| 26S protease regulatory subunit 4-like protein [Aegilops tauschii]
Length=655

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 181/235 (77%), Gaps = 37/235 (16%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRKNDDkkekkfepa-----appaRVGRKQRKQKGSEAAARLP  179
            MGQG+PGG+ +Q  LPGDR        K +       A P+RVGRKQRKQ+G EAAARLP
Sbjct  1    MGQGSPGGMGKQGGLPGDRTRAGGAPAKKKDRKSGPPAAPSRVGRKQRKQRGPEAAARLP  60

Query  180  TVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVG  359
             V PL+KC+LRLLK++R+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRGTPMSVG
Sbjct  61   PVAPLSKCRLRLLKLDRVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  360  NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK---------------  494
            +LEE+IDE+HAIVSSSVGPEYYVS+LSFVDKDQLEPGC+ILMHNK               
Sbjct  121  SLEEIIDESHAIVSSSVGPEYYVSVLSFVDKDQLEPGCSILMHNKLGHFDDIETCGMGAM  180

Query  495  ---------------VLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
                           VLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  181  GQNMGIEMNVAIACSVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQ  235



>ref|XP_009592455.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like, 
partial [Nicotiana tomentosiformis]
Length=159

 Score =   284 bits (727),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/159 (97%), Positives = 157/159 (99%), Gaps = 1/159 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQGTPGGLNRQLPGDRKND DKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT
Sbjct  1    MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK  494
            DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNK
Sbjct  121  DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNK  159



>gb|KJB18717.1| hypothetical protein B456_003G066800 [Gossypium raimondii]
Length=411

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 172/201 (86%), Gaps = 25/201 (12%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  +KKEKKFEPAAPPARVGRKQRKQKG E          
Sbjct  1    MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPE----------  50

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
                        RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  51   ------------RIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  98

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  99   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  158

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  159  KVEKAPLESYADIGGLDAQIQ  179



>gb|KJB18718.1| hypothetical protein B456_003G066800 [Gossypium raimondii]
Length=424

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 172/201 (86%), Gaps = 25/201 (12%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTP  191
            MGQGTPGGLNRQ LPGDRK D  +KKEKKFEPAAPPARVGRKQRKQKG E          
Sbjct  1    MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPE----------  50

Query  192  LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEE  371
                        RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEE
Sbjct  51   ------------RIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  98

Query  372  LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  551
            LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  99   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  158

Query  552  KVEKAPLESYADIGGLDAQIQ  614
            KVEKAPLESYADIGGLDAQIQ
Sbjct  159  KVEKAPLESYADIGGLDAQIQ  179



>emb|CBI37252.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 167/200 (84%), Gaps = 29/200 (15%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKND-DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  GGLNRQ LPGDRKND DKKEKKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1    MGQGASGGLNRQGLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
            +K                           LKPQEEKTEEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61   SK---------------------------LKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  93

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  94   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  153

Query  555  VEKAPLESYADIGGLDAQIQ  614
            VEKAPLESYADIGGLDAQIQ
Sbjct  154  VEKAPLESYADIGGLDAQIQ  173



>ref|NP_001229616.1| proteasome 26S subunit subunit 4 ATPase-like [Strongylocentrotus 
purpuratus]
Length=443

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG + A++LP VTP TKC+LRLLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  35   RVGKKKRRTKGPDTASKLPQVTPHTKCRLRLLKMERIKDYLLMEEEFIRNQERLKPQEEK  94

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG+LEE+ID+NHAIVS+SVG EYYVSILSFVDKDQLEPGC +L
Sbjct  95   DEEERSKVDDLRGTPMSVGSLEEIIDDNHAIVSASVGSEYYVSILSFVDKDQLEPGCTVL  154

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KVL++VG+L DD DPMVSVMK+EKAP ESYADIGGLD QIQ
Sbjct  155  LNHKVLAIVGVLGDDTDPMVSVMKLEKAPQESYADIGGLDTQIQ  198



>gb|ACH56913.1| 26S proteasome regulatory complex ATPase RPT2 [Simulium vittatum]
Length=228

 Score =   265 bits (678),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP +TP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKRKTKGPDAAMKLPQITPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGSPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>gb|ERL96197.1| hypothetical protein D910_01383, partial [Dendroctonus ponderosae]
Length=334

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG + A +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  40   RVGKKKRRTKGPDTALKLPAVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEEK  99

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  100  NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  159

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  160  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  203



>gb|ERL96126.1| hypothetical protein D910_01116, partial [Dendroctonus ponderosae]
Length=324

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG + A +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKRRTKGPDTALKLPAVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>gb|AHH81783.1| 26S protease regulatory subunit 4-like protein, partial [Biomphalaria 
glabrata]
Length=244

 Score =   263 bits (672),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  3    RVGKRKKKSKGPDAATKLPQVTPYTRCRLKLLKLERIKDYLLMEEEFIKNQERLKPQEEK  62

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVD+LRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  63   HEEERSKVDELRGSPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  122

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  123  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDNQIQ  166



>gb|EHJ78448.1| putative 26S protease regulatory subunit 4 [Danaus plexippus]
Length=377

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  31   RVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   IEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMVSVMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLGDDTDPMVSVMKLEKAPQETYADIGGLDTQIQ  194



>dbj|BAN20514.1| proteasome 26S subunit subunit 4 ATPase [Riptortus pedestris]
Length=440

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+++ KG +AA +LP VTP TKC+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKKRTKGPDAATKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>ref|XP_011550572.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
4 [Plutella xylostella]
Length=448

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  31   RVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   IEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMVSVMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLGDDTDPMVSVMKLEKAPQETYADIGGLDIQIQ  194



>gb|AEE62840.1| unknown [Dendroctonus ponderosae]
 gb|ENN73080.1| hypothetical protein YQE_10284, partial [Dendroctonus ponderosae]
Length=438

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG + A +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKRRTKGPDTALKLPAVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>ref|XP_001655853.1| AAEL012095-PA [Aedes aegypti]
 gb|ABF18346.1| 26S proteasome regulatory chain 4 [Aedes aegypti]
 gb|EAT35749.1| AAEL012095-PA [Aedes aegypti]
Length=438

 Score =   267 bits (683),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQ+EK
Sbjct  30   RVGKKKRKNKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQDEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>ref|XP_010548707.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
 ref|XP_010548708.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
Length=436

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 162/198 (82%), Gaps = 7/198 (4%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLTK  200
            MGQG     +RQ  GDRK D   +K+ +   P  RVGRKQRK KG EAAARLPTVTP  K
Sbjct  1    MGQGP----SRQ--GDRKPDGGDKKERKFQPPA-RVGRKQRKLKGPEAAARLPTVTPSAK  53

Query  201  CKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELID  380
            C LR LK+ERI +YLLMEE+F+ +QERLKPQEEK EEDRSKVDD+RGTPM VG L+ELID
Sbjct  54   CMLRFLKLERIIEYLLMEEDFIESQERLKPQEEKAEEDRSKVDDIRGTPMEVGKLKELID  113

Query  381  ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  560
            ENHAIVSSS   EYYV ILSFVDKDQLEPGC+ILMH+KV SVVG+LQD+VDPMVS+MKV 
Sbjct  114  ENHAIVSSSHDREYYVGILSFVDKDQLEPGCSILMHSKVRSVVGILQDEVDPMVSMMKVV  173

Query  561  KAPLESYADIGGLDAQIQ  614
            KAP ESYADIGGL+ QIQ
Sbjct  174  KAPSESYADIGGLEDQIQ  191



>dbj|BAM19425.1| proteasome 26S subunit subunit 4 ATPase, partial [Papilio xuthus]
Length=441

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP TKC+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  33   RVGKKKRKAKGPDAALKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  92

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSF DKDQLEPGC++L
Sbjct  93   IEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFEDKDQLEPGCSVL  152

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMVSVMK+EKAP E+YADIGGLD QIQ
Sbjct  153  LNHKVHAVVGVLGDDTDPMVSVMKLEKAPQETYADIGGLDTQIQ  196



>ref|XP_001861875.1| 26S protease regulatory subunit 4 [Culex quinquefasciatus]
 gb|EDS36214.1| 26S protease regulatory subunit 4 [Culex quinquefasciatus]
Length=438

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQ+EK
Sbjct  30   RVGKKKRKAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQDEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>ref|XP_002959240.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ39700.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=444

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +3

Query  123  RVGRKQRKQ-KGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEE  299
            RVG+KQ+K+   +   A+LPTV P  KCKLRLLK+ERIKDYLLMEEEFV NQE+LKPQEE
Sbjct  35   RVGKKQKKRDTAASLGAKLPTVYPTAKCKLRLLKLERIKDYLLMEEEFVQNQEQLKPQEE  94

Query  300  KTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAI  479
            + EEDRSKVDDLRGTP+SVG LEE+IDENHAIVSSSVGPEYYV ILSFVDK QLEPGC++
Sbjct  95   RNEEDRSKVDDLRGTPLSVGTLEEIIDENHAIVSSSVGPEYYVCILSFVDKTQLEPGCSV  154

Query  480  LMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            L+H K +SVVG+L D+ DPMVSVMKVEKAPLESYAD+GGL+AQIQ
Sbjct  155  LLHYKSMSVVGILSDETDPMVSVMKVEKAPLESYADVGGLEAQIQ  199



>emb|CCA21636.1| 26S proteasome AAAATPase subunit RPT2a putative [Albugo laibachii 
Nc14]
Length=442

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLTK  200
            MGQ +  GL R+    ++ DD ++KK +       +  K+RK+KG  AA R+PTV P  K
Sbjct  1    MGQ-SQSGLPREAARKKQQDDAEKKKKKFEPRSGAMTHKRRKKKGPSAAVRIPTVYPTAK  59

Query  201  CKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELID  380
            CKLRLLK+ERIKD+LLME+EF+ NQE +KP+ EK EE+RSKVDDLRG PMSVG LEE+ID
Sbjct  60   CKLRLLKLERIKDFLLMEQEFIQNQEVMKPKHEKDEEERSKVDDLRGNPMSVGTLEEIID  119

Query  381  ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  560
            +NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV+SVVG+L DD DPMVSVMKV+
Sbjct  120  DNHAIVSSSVGPEYYVSVMSFVNQDMLETGCSVLLHNKVMSVVGILSDDTDPMVSVMKVD  179

Query  561  KAPLESYADIGGLDAQIQ  614
            KAPLESYADIGGLDAQIQ
Sbjct  180  KAPLESYADIGGLDAQIQ  197



>ref|XP_974859.1| PREDICTED: 26S protease regulatory subunit 4 [Tribolium castaneum]
 gb|EFA06741.1| hypothetical protein TcasGA2_TC009675 [Tribolium castaneum]
Length=438

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG + A +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKRRTKGPDTALKLPVVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>ref|XP_012150316.1| PREDICTED: 26S protease regulatory subunit 4 [Megachile rotundata]
Length=440

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFITNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>gb|ETN59541.1| 26S protease regulatory subunit 4 [Anopheles darlingi]
 gb|ETN59542.1| 26S protease regulatory subunit 4 [Anopheles darlingi]
Length=438

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   IEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>gb|KDR19574.1| 26S protease regulatory subunit 4 [Zootermopsis nevadensis]
Length=440

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKRRRTKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   IEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>ref|XP_003696714.1| PREDICTED: 26S protease regulatory subunit 4-like [Apis florea]
 ref|XP_006623398.1| PREDICTED: 26S protease regulatory subunit 4-like [Apis dorsata]
Length=440

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>ref|XP_623527.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Apis 
mellifera]
Length=440

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>ref|XP_003395819.1| PREDICTED: 26S protease regulatory subunit 4-like [Bombus terrestris]
 ref|XP_003489177.1| PREDICTED: 26S protease regulatory subunit 4-like [Bombus impatiens]
Length=440

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>ref|XP_004523315.1| PREDICTED: 26S protease regulatory subunit 4-like [Ceratitis 
capitata]
Length=439

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>gb|KFB53205.1| hypothetical protein ZHAS_00021511 [Anopheles sinensis]
Length=438

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>ref|XP_011051171.1| PREDICTED: 26S protease regulatory subunit 4 [Acromyrmex echinatior]
 ref|XP_011167793.1| PREDICTED: 26S protease regulatory subunit 4 [Solenopsis invicta]
 ref|XP_011686647.1| PREDICTED: 26S protease regulatory subunit 4 [Wasmannia auropunctata]
 ref|XP_011882329.1| PREDICTED: 26S protease regulatory subunit 4 [Vollenhovia emeryi]
Length=440

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQ  195



>ref|XP_001982075.1| GG12390 [Drosophila erecta]
 ref|XP_002070237.1| GK11948 [Drosophila willistoni]
 ref|XP_002099325.1| GE10845 [Drosophila yakuba]
 gb|EDV53945.1| GG12390 [Drosophila erecta]
 gb|EDW81223.1| GK11948 [Drosophila willistoni]
 gb|EDW99037.1| GE10845 [Drosophila yakuba]
Length=439

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>gb|EGI70823.1| 26S protease regulatory subunit 4, partial [Acromyrmex echinatior]
Length=439

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  31   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQ  194



>ref|XP_011185945.1| PREDICTED: 26S protease regulatory subunit 4 [Bactrocera cucurbitae]
 ref|XP_011212656.1| PREDICTED: 26S protease regulatory subunit 4 [Bactrocera dorsalis]
Length=439

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPLVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>ref|XP_001993700.1| GH19692 [Drosophila grimshawi]
 gb|EDV94436.1| GH19692 [Drosophila grimshawi]
Length=439

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>ref|XP_001690446.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP05705.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
Length=443

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  123  RVGRKQRKQ-KGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEE  299
            RVG+KQ+K+   +   A+LPTV P  KCKLRLLK+ERIKDYLLMEEEFV NQE+LKPQEE
Sbjct  34   RVGKKQKKRDTAASLGAKLPTVYPTAKCKLRLLKLERIKDYLLMEEEFVQNQEQLKPQEE  93

Query  300  KTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAI  479
            + EEDRSKVDDLRGTP+SVG LEE+IDENHAIVSSSVGPEYYV ILSFVDK QLEPGC++
Sbjct  94   RNEEDRSKVDDLRGTPLSVGTLEEIIDENHAIVSSSVGPEYYVCILSFVDKTQLEPGCSV  153

Query  480  LMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            L+H K +SVVG+L D+ DPMVSVMKVEKAPLESYAD+GGL+ QIQ
Sbjct  154  LLHYKSMSVVGILSDETDPMVSVMKVEKAPLESYADVGGLEPQIQ  198



>ref|XP_001622029.1| hypothetical protein NEMVEDRAFT_v1g176351 [Nematostella vectensis]
 gb|EDO29929.1| predicted protein [Nematostella vectensis]
Length=295

 Score =   259 bits (663),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++Q+K KG +AA +LP VTP   C+L+LLK++RIKD+LLMEEEF+ NQERLKPQEEK
Sbjct  33   RVGKRQKKAKGPDAANKLPVVTPHRNCRLKLLKLDRIKDFLLMEEEFIQNQERLKPQEEK  92

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC +L
Sbjct  93   HEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCTVL  152

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP ESYADIGGLD QIQ
Sbjct  153  LNHKVHAVVGVLSDDADPMVTVMKLEKAPQESYADIGGLDTQIQ  196



>ref|NP_524469.2| regulatory particle triple-A ATPase 2, isoform A [Drosophila 
melanogaster]
 ref|NP_001287493.1| regulatory particle triple-A ATPase 2, isoform B [Drosophila 
melanogaster]
 ref|XP_002032413.1| GM23527 [Drosophila sechellia]
 ref|XP_002104626.1| GD18337 [Drosophila simulans]
 sp|P48601.2|PRS4_DROME RecName: Full=26S protease regulatory subunit 4; Short=P26s4 
[Drosophila melanogaster]
 gb|AAF56205.1| regulatory particle triple-A ATPase 2, isoform A [Drosophila 
melanogaster]
 gb|AAL13988.1| SD02658p [Drosophila melanogaster]
 gb|EDW43399.1| GM23527 [Drosophila sechellia]
 gb|EDX14129.1| GD18337 [Drosophila simulans]
 gb|ACL90655.1| Pros26.4-PA [synthetic construct]
 gb|AHN57492.1| regulatory particle triple-A ATPase 2, isoform B [Drosophila 
melanogaster]
Length=439

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>ref|XP_002000888.1| GI22277 [Drosophila mojavensis]
 gb|EDW16349.1| GI22277 [Drosophila mojavensis]
Length=439

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPLVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>ref|XP_001358781.1| GA18789 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL27924.1| GA18789 [Drosophila pseudoobscura pseudoobscura]
Length=439

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPLVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>ref|XP_001953861.1| GF17023 [Drosophila ananassae]
 gb|EDV42422.1| GF17023 [Drosophila ananassae]
Length=446

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  38   RVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  97

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  98   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  157

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  158  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  201



>ref|XP_002053771.1| GJ24070 [Drosophila virilis]
 gb|EDW67291.1| GJ24070 [Drosophila virilis]
Length=444

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  36   RVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  95

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  96   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  155

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  156  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  199



>ref|XP_312923.4| AGAP003215-PA [Anopheles gambiae str. PEST]
 ref|XP_312924.4| AGAP003216-PA [Anopheles gambiae str. PEST]
 gb|EAA08386.4| AGAP003215-PA [Anopheles gambiae str. PEST]
 gb|EAA08387.4| AGAP003216-PA [Anopheles gambiae str. PEST]
Length=438

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   IEEERSKVDDLRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  193



>gb|ACI68459.1| 26S protease regulatory subunit 4 [Salmo salar]
Length=233

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQ  195



>ref|XP_005838339.1| 26S proteasome regulatory complex, ATPase RPT2 [Guillardia theta 
CCMP2712]
 gb|EKX51359.1| 26S proteasome regulatory complex, ATPase RPT2 [Guillardia theta 
CCMP2712]
Length=440

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            R GRK+ K KG ++ ARLP VTP  KC+LRLLK+ER+KDYLLMEEEF+ NQERLKPQEEK
Sbjct  33   RTGRKKVK-KGPDSNARLPAVTPNAKCRLRLLKLERVKDYLLMEEEFIQNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
            ++E+R+KVDDLRG+PM VGNLEE+ID+NHAIVSSSVGPEYYV+I+SFVD+D LEPGC++L
Sbjct  92   SQEERAKVDDLRGSPMGVGNLEEMIDDNHAIVSSSVGPEYYVNIMSFVDRDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             HNKVLS+VG+L DD DP+VSVMKV+KAPLE+YADIGGL+ QIQ
Sbjct  152  THNKVLSIVGILADDTDPLVSVMKVDKAPLETYADIGGLEPQIQ  195



>ref|XP_011640062.1| PREDICTED: 26S protease regulatory subunit 4 [Pogonomyrmex barbatus]
Length=440

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRIKGPDAALKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQ  195



>ref|XP_002900803.1| 26S protease regulatory subunit 4 [Phytophthora infestans T30-4]
 gb|EEY59610.1| 26S protease regulatory subunit 4 [Phytophthora infestans T30-4]
Length=445

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  132  RKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEE  311
            RK+RK+KG  AA R+PTV P  KCKLRLLKMERIKD+LLME+EF+ NQE +KP++EK EE
Sbjct  40   RKRRKKKGPSAAVRIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQEVMKPKQEKDEE  99

Query  312  DRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHN  491
            +RSKVDDLRGTPM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D LEPGC++L+HN
Sbjct  100  ERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDMLEPGCSVLLHN  159

Query  492  KVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            KV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL++QIQ
Sbjct  160  KVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLESQIQ  200



>ref|XP_009521651.1| hypothetical protein PHYSODRAFT_354148 [Phytophthora sojae]
 gb|EGZ26363.1| hypothetical protein PHYSODRAFT_354148 [Phytophthora sojae]
Length=445

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  132  RKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEE  311
            RK+RK+KG  AA R+PTV P  KCKLRLLKMERIKD+LLME+EF+ NQE +KP++EK EE
Sbjct  40   RKRRKKKGPAAAVRIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQEVMKPKQEKDEE  99

Query  312  DRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHN  491
            +RSKVDDLRGTPM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D LEPGC++L+HN
Sbjct  100  ERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDMLEPGCSVLLHN  159

Query  492  KVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            KV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL++QIQ
Sbjct  160  KVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLESQIQ  200



>ref|XP_008550534.1| PREDICTED: 26S protease regulatory subunit 4 [Microplitis demolitor]
Length=440

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG + A +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDVAVKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>ref|XP_001604655.1| PREDICTED: 26S protease regulatory subunit 4 [Nasonia vitripennis]
Length=464

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDVQIQ  195



>ref|XP_005179926.1| PREDICTED: 26S protease regulatory subunit 4 [Musca domestica]
Length=439

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+++ KG +AA +LP VTP T+C+L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKKRSKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>gb|AII16487.1| 26S protease regulatory subunit 4, partial [Paracyclopina nana]
Length=439

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++  KG + A++LP +TP TKC+LRLLK ERIKDYLLMEEEF++NQERLKPQEEK
Sbjct  31   RVGKKRKAAKGPDTASKLPLITPHTKCRLRLLKQERIKDYLLMEEEFISNQERLKPQEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVAVMKLEKAPQETYADIGGLDQQIQ  194



>ref|XP_011260462.1| PREDICTED: 26S protease regulatory subunit 4 [Camponotus floridanus]
 gb|EFN65701.1| 26S protease regulatory subunit 4 [Camponotus floridanus]
Length=440

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQ  195



>emb|CCI47533.1| unnamed protein product [Albugo candida]
Length=442

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLTK  200
            MGQ +  GL R+    +K DD ++KK +       +  K+RK+KG  AA R+PTV P  K
Sbjct  1    MGQ-SQSGLPREGARKKKPDDAEKKKKKFEPRSGVMTHKRRKKKGPSAAVRIPTVYPTAK  59

Query  201  CKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELID  380
            CKLRLLK+ERIKD+LLME+EF+ NQE +KP+ EK EE+RSKVDDLRG PM VG LEE+ID
Sbjct  60   CKLRLLKLERIKDFLLMEQEFIQNQEVMKPKHEKDEEERSKVDDLRGNPMGVGTLEEIID  119

Query  381  ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  560
            +NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV+SVVG+L DD DPMVSVMKV+
Sbjct  120  DNHAIVSSSVGPEYYVSVMSFVNQDMLETGCSVLLHNKVMSVVGILSDDTDPMVSVMKVD  179

Query  561  KAPLESYADIGGLDAQIQ  614
            KAPLESYADIGGLDAQIQ
Sbjct  180  KAPLESYADIGGLDAQIQ  197



>ref|XP_011400256.1| 26S proteasome regulatory subunit 4-like protein B [Auxenochlorella 
protothecoides]
 gb|KFM27289.1| 26S proteasome regulatory subunit 4-like protein B [Auxenochlorella 
protothecoides]
Length=420

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = +3

Query  27   QGTPGGLNRQLPGDRKNDDkkekkfepaappaRVGRKQRKQ-KGSEAAARLPTVTPLTKC  203
            Q  PG   +  PGD++N  +K+KK+EP APP RVG+KQRK+  G+   ++LPT+TP +KC
Sbjct  5    QSAPGS-GQGGPGDKQNGQEKKKKYEPPAPPPRVGKKQRKRGAGAGLGSKLPTITPTSKC  63

Query  204  KLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDE  383
            KLRLLK+ER+KD+LLMEEE+V NQERL PQEE+ EEDR+KVDDLRG+P+SVG LEELIDE
Sbjct  64   KLRLLKLERVKDWLLMEEEYVTNQERLAPQEERNEEDRTKVDDLRGSPLSVGTLEELIDE  123

Query  384  NHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEK  563
            NH IVSS+VGPEYYV+I+SFVDK QLEPGC++L+HNK + VVGLL D+ DP VSVMKVE 
Sbjct  124  NHGIVSSAVGPEYYVTIMSFVDKTQLEPGCSVLLHNKGMHVVGLLTDESDPAVSVMKVEH  183

Query  564  APLESYADIGGLDAQIQ  614
            AP ESYAD+GGLD QIQ
Sbjct  184  APTESYADVGGLDQQIQ  200



>ref|XP_011146352.1| PREDICTED: 26S protease regulatory subunit 4 [Harpegnathos saltator]
Length=439

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  31   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQ  194



>ref|XP_008896011.1| 26S protease regulatory subunit 4 [Phytophthora parasitica INRA-310]
 gb|ETI36337.1| 26S protease regulatory subunit 4 [Phytophthora parasitica P1569]
 gb|ETK76564.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETL30007.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETL83228.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETM36448.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETN18319.1| 26S protease regulatory subunit 4 [Phytophthora parasitica INRA-310]
 gb|ETO65058.1| 26S protease regulatory subunit 4 [Phytophthora parasitica P1976]
 gb|ETP06177.1| 26S protease regulatory subunit 4 [Phytophthora parasitica CJ01A1]
Length=445

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +3

Query  132  RKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEE  311
            RK+RK+KG  AA R+PTV P  KCKLRLLKMERIKD+LLME+EF+ NQE +KP++EK EE
Sbjct  40   RKRRKKKGPSAAVRIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQEVMKPKQEKDEE  99

Query  312  DRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHN  491
            +RSKVDDLRGTPM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D LEPGC++L+HN
Sbjct  100  ERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDMLEPGCSVLLHN  159

Query  492  KVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            KV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL+ QIQ
Sbjct  160  KVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLETQIQ  200



>ref|XP_011343804.1| PREDICTED: 26S protease regulatory subunit 4 [Cerapachys biroi]
 gb|EZA51286.1| 26S protease regulatory subunit [Cerapachys biroi]
Length=440

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQ  195



>ref|XP_011303495.1| PREDICTED: 26S protease regulatory subunit 4 [Fopius arisanus]
Length=440

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG + A +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDVALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  195



>gb|EFN79932.1| 26S protease regulatory subunit 4 [Harpegnathos saltator]
Length=486

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  78   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  137

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  138  NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  197

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQ
Sbjct  198  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQ  241



>gb|ACO07775.1| 26S protease regulatory subunit 4 [Oncorhynchus mykiss]
Length=266

 Score =   256 bits (654),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQ  195



>ref|XP_002402795.1| ATPase, putative [Ixodes scapularis]
 gb|EEC06041.1| ATPase, putative [Ixodes scapularis]
Length=280

 Score =   256 bits (655),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+++++ +G E A++LP VTP T+C+L+LLK ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  8    RVGKRKKRTRGPEPASKLPLVTPHTRCRLKLLKQERIKDYLLMEEEFLRNQERLKPQEEK  67

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVS+LSFVDKDQLEPGC++L
Sbjct  68   HEEERSKVDDLRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSMLSFVDKDQLEPGCSVL  127

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  128  LNHKVHAVVGVLSDDADPMVAVMKLEKAPQETYADIGGLDQQIQ  171



>ref|XP_005710517.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
 emb|CDF40223.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
Length=441

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVGRK +K++G E AA+LP +TP  KC+LR+LK+ER+KDYLLMEEEFV NQER KP+EE+
Sbjct  34   RVGRK-KKRRGPEVAAKLPNITPTAKCRLRMLKLERVKDYLLMEEEFVTNQERYKPREER  92

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
            TEEDRSKV+D+RGTPM VG LEE+ID++HAIVSS+VGPEYYV I SFVDKDQLEPG ++L
Sbjct  93   TEEDRSKVEDIRGTPMGVGTLEEIIDDDHAIVSSAVGPEYYVYITSFVDKDQLEPGSSVL  152

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H KVLSVVG+L DD DPMVSVMKV+KAPLESYADIGGL+ QIQ
Sbjct  153  LHQKVLSVVGMLADDADPMVSVMKVDKAPLESYADIGGLEDQIQ  196



>ref|XP_005106466.1| PREDICTED: 26S protease regulatory subunit 4-like [Aplysia californica]
Length=441

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +3

Query  66   DRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYL  245
            + K DDK++K+      P RVG+++++ KG +AA +LP VTP T+C+L++LK++RIKDYL
Sbjct  14   NEKGDDKEKKRKYEPPVPTRVGKRKKRTKGPDAATKLPQVTPYTRCRLKMLKLDRIKDYL  73

Query  246  LMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYY  425
            LMEEEF+ NQERLKPQEEK EE+RSKVD+LRG+PMSVGNLEE+ID+NHAIVS+SVG E+Y
Sbjct  74   LMEEEFIKNQERLKPQEEKHEEERSKVDELRGSPMSVGNLEEIIDDNHAIVSTSVGSEHY  133

Query  426  VSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDA  605
            VSILSFVDKDQLEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD 
Sbjct  134  VSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDT  193

Query  606  QIQ  614
            QIQ
Sbjct  194  QIQ  196



>gb|ETP34278.1| 26S protease regulatory subunit 4 [Phytophthora parasitica P10297]
Length=445

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +3

Query  132  RKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEE  311
            RK+RK+KG  AA  +PTV P  KCKLRLLKMERIKD+LLME+EF+ NQE +KP++EK EE
Sbjct  40   RKRRKKKGPSAAVHIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQEVMKPKQEKDEE  99

Query  312  DRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHN  491
            +RSKVDDLRGTPM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D LEPGC++L+HN
Sbjct  100  ERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDMLEPGCSVLLHN  159

Query  492  KVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            KV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL+ QIQ
Sbjct  160  KVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLETQIQ  200



>gb|KFH72195.1| 26S protease regulatory subunit 4 [Mortierella verticillata NRRL 
6337]
Length=440

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+ + KG +A+++LP V P T+C+L++LKMERIKDYLLMEEEFV NQERLKPQEEK
Sbjct  33   RVGKKKVR-KGPDASSKLPAVFPTTRCRLKMLKMERIKDYLLMEEEFVVNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
            T+E+RSKVDDLRGTPMSVG LEE+ID++HAIVS+S GPEYYVSILSFVDKD LEPGC+IL
Sbjct  92   TQEERSKVDDLRGTPMSVGTLEEIIDDDHAIVSTSNGPEYYVSILSFVDKDLLEPGCSIL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K +SV+G+L DD DPMVSVMK+EKAP ESYADIGGL+ QIQ
Sbjct  152  LHHKTMSVIGVLADDADPMVSVMKLEKAPTESYADIGGLETQIQ  195



>ref|XP_005705264.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME28744.1| AAA-type ATPase [Galdieria sulphuraria]
Length=413

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            R+G K+RK  G EAA RLP +TP  +C+LR+LK+ER+KDYLL+EEEF+  QE+++P+EEK
Sbjct  40   RIGHKKRKSSGPEAATRLPPITPSARCRLRMLKLERVKDYLLIEEEFITKQEKIRPREEK  99

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDD+RGTP+ VG LEE++D+NHAIVSS+VGPEYYV++ SFVD+DQ+EPGC +L
Sbjct  100  HEEERSKVDDIRGTPVGVGTLEEIVDDNHAIVSSAVGPEYYVNMCSFVDRDQIEPGCTVL  159

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +HNKVLSVVG+L DDVDPMVSVMKV+KAPLESYADIGGL+ QIQ
Sbjct  160  LHNKVLSVVGVLADDVDPMVSVMKVDKAPLESYADIGGLEKQIQ  203



>ref|XP_011504351.1| PREDICTED: 26S protease regulatory subunit 4 [Ceratosolen solmsi 
marchali]
Length=440

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+C+L+LLK++RIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLDRIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   NEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGL+ QIQ
Sbjct  152  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLEVQIQ  195



>emb|CDQ64506.1| unnamed protein product [Oncorhynchus mykiss]
Length=275

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  11   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  70

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  71   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  130

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  131  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  174



>ref|XP_005773763.1| hypothetical protein EMIHUDRAFT_444500 [Emiliania huxleyi CCMP1516]
 gb|EOD21334.1| hypothetical protein EMIHUDRAFT_444500 [Emiliania huxleyi CCMP1516]
Length=441

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVGRK+RK+ G  A++RLPTV P TKCKLRLLK+ER+KDYLLMEEEFVA QE++KPQEE 
Sbjct  33   RVGRKKRKKAGPAASSRLPTVVPATKCKLRLLKLERVKDYLLMEEEFVARQEQVKPQEES  92

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +++R+KV+D+RGTP+ V  LEE++D+NHAI+SSS+GPEYYV+ILSFVDKDQLEPGC++L
Sbjct  93   AQQERTKVEDIRGTPLGVATLEEMVDDNHAIISSSIGPEYYVNILSFVDKDQLEPGCSLL  152

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             HNKV S+VGLL D+ DPM SVMKV+KAP+ESYADIGGL+ QIQ
Sbjct  153  THNKVNSIVGLLADEADPMGSVMKVDKAPVESYADIGGLETQIQ  196



>ref|XP_008605817.1| 26S proteasome regulatory subunit 4 like A [Saprolegnia diclina 
VS20]
 gb|EQC40973.1| 26S proteasome regulatory subunit 4 like A [Saprolegnia diclina 
VS20]
Length=440

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 161/200 (81%), Gaps = 7/200 (4%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  G     LPG++K +  D+  K+ +       + RK++K+KG   A R+P V P 
Sbjct  1    MGQGQSG-----LPGNKKPEKKDEAPKRKKFEPRGGAMTRKRKKKKGPSVATRIPAVFPT  55

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
             KCKLRLLK+ERIKD+LLMEEEF+ NQE +KP++EK EE+RSKVDDLRGTPM VG LEE+
Sbjct  56   AKCKLRLLKLERIKDFLLMEEEFIKNQEVMKPKQEKDEEERSKVDDLRGTPMGVGTLEEM  115

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            ID+NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV++VVG+L +D DPMVSVMK
Sbjct  116  IDDNHAIVSSSVGPEYYVSVMSFVNQDMLEAGCSVLLHNKVMAVVGILSNDTDPMVSVMK  175

Query  555  VEKAPLESYADIGGLDAQIQ  614
            V+KAPLESYADIGGLD QIQ
Sbjct  176  VDKAPLESYADIGGLDQQIQ  195



>gb|AAB34134.1| P26s4 [Drosophila melanogaster]
Length=439

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+ KG +AA +LP VTP T+ +L+LLK+ERIKDYL+ME+EF+ NQERLKPQ+EK
Sbjct  31   RVGKKKRRAKGPDAAMKLPQVTPHTRARLKLLKLERIKDYLMMEDEFIRNQERLKPQDEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  91   NEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV++MK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLSDDTDPMVTMMKLEKAPQETYADIGGLDTQIQ  194



>emb|CDQ81314.1| unnamed protein product [Oncorhynchus mykiss]
Length=302

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  38   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  97

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  98   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  157

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  158  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDQQIQ  201



>gb|KDO27797.1| 26S proteasome regulatory subunit 4 A [Saprolegnia parasitica 
CBS 223.65]
Length=440

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 160/200 (80%), Gaps = 7/200 (4%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKND--DkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  G     LPG +K +  D+  K+ +       + RK++K+KG   A R+P V P 
Sbjct  1    MGQGQSG-----LPGSKKPEKKDEAPKRKKFEPRGGAMTRKRKKKKGPSVATRIPAVFPT  55

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
             KCKLRLLK+ERIKD+LLMEEEF+ NQE +KP++EK EE+RSKVDDLRGTPM VG LEE+
Sbjct  56   AKCKLRLLKLERIKDFLLMEEEFIKNQEVMKPKQEKDEEERSKVDDLRGTPMGVGTLEEM  115

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            ID+NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV++VVG+L +D DPMVSVMK
Sbjct  116  IDDNHAIVSSSVGPEYYVSVMSFVNQDMLEAGCSVLLHNKVMAVVGILSNDTDPMVSVMK  175

Query  555  VEKAPLESYADIGGLDAQIQ  614
            V+KAPLESYADIGGLD QIQ
Sbjct  176  VDKAPLESYADIGGLDQQIQ  195



>gb|KFK40382.1| hypothetical protein AALP_AA3G366200 [Arabis alpina]
Length=376

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +3

Query  222  MERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVS  401
            MERIKDYLLMEEEFV+NQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVS
Sbjct  1    MERIKDYLLMEEEFVSNQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVS  60

Query  402  SSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESY  581
            SSVGPEYYV+ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVEKAPLESY
Sbjct  61   SSVGPEYYVAILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESY  120

Query  582  ADIGGLDAQIQ  614
            ADIGGL+AQIQ
Sbjct  121  ADIGGLEAQIQ  131



>ref|XP_002613460.1| hypothetical protein BRAFLDRAFT_119863 [Branchiostoma floridae]
 gb|EEN69469.1| hypothetical protein BRAFLDRAFT_119863 [Branchiostoma floridae]
Length=441

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG ++A +LP VTP T+C+L+LLK+ERIKDY+LMEEEF+ NQERLKPQ+E+
Sbjct  33   RVGKRRKKGKGPDSANKLPAVTPHTRCRLKLLKLERIKDYMLMEEEFIRNQERLKPQDER  92

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRG+PMSVG+LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  93   VEEERSKVDDLRGSPMSVGSLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  152

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            M++KV ++VG+L DD DPMV+VMK+EKAP ESYADIGGLD QIQ
Sbjct  153  MNHKVHAIVGVLGDDTDPMVTVMKLEKAPKESYADIGGLDQQIQ  196



>ref|XP_009829202.1| 26S protease regulatory subunit 4 [Aphanomyces astaci]
 gb|ETV81344.1| 26S protease regulatory subunit 4 [Aphanomyces astaci]
Length=440

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 160/200 (80%), Gaps = 7/200 (4%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKNDDkkekkfepaappa--RVGRKQRKQKGSEAAARLPTVTPL  194
            MGQG  G     LPG +K D K E   +    P    + RK++K+KG  AA R+P V P 
Sbjct  1    MGQGQSG-----LPGSKKGDKKDEPPKKKKFEPRGGAITRKRKKKKGPSAATRIPAVFPT  55

Query  195  TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEEL  374
             KCKLRLLK+ERIKD+LLMEEEF+ NQE +KP++EK EE+RSKVDDLRGTPM VG LEE+
Sbjct  56   AKCKLRLLKLERIKDFLLMEEEFIKNQEVMKPKQEKDEEERSKVDDLRGTPMGVGTLEEM  115

Query  375  IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  554
            ID+NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV++VVG+L +D DPMVSVMK
Sbjct  116  IDDNHAIVSSSVGPEYYVSVMSFVNQDLLEAGCSVLLHNKVMAVVGILSNDTDPMVSVMK  175

Query  555  VEKAPLESYADIGGLDAQIQ  614
            V+KAPLESYADIGGLD QIQ
Sbjct  176  VDKAPLESYADIGGLDQQIQ  195



>gb|ACO12018.1| 26S protease regulatory subunit 4 [Lepeophtheirus salmonis]
Length=438

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+++ +G +AA +LP VTP TKC+L+LLK+ERIKDYLLMEEEF+ NQE LKPQEEK
Sbjct  30   RVGKKRKRARGPDAANKLPLVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQEVLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG+LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   NEEERSKVDDLRGTPMSVGSLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            ++++V +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHRVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDQQIQ  193



>gb|EYU46362.1| hypothetical protein MIMGU_mgv1a023433mg [Erythranthe guttata]
Length=440

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 168/199 (84%), Gaps = 5/199 (3%)
 Frame = +3

Query  21   MGQGTPGGLNRQ-LPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLT  197
            MGQG P GLNR      +K+ DKKEKKF+PAAPPARVGR+QRKQ+G  AAAR+P VTPL 
Sbjct  1    MGQGAPAGLNRPPRGEKKKDGDKKEKKFKPAAPPARVGRRQRKQRGYGAAARIPAVTPLA  60

Query  198  KCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELI  377
            KCKLRL+K++RIKDYLLMEEEFV +QERL P+ EK   +RS++D  RG+PM VG L E+I
Sbjct  61   KCKLRLMKLDRIKDYLLMEEEFVTSQERLNPRLEKKAINRSRIDIFRGSPMRVGRLAEMI  120

Query  378  DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  557
            DENHAI+S      YYV++LSFVDKDQLEPGC IL+H+K+LSVVGLLQDDVDPMVSVMKV
Sbjct  121  DENHAIISQG----YYVTVLSFVDKDQLEPGCKILLHDKLLSVVGLLQDDVDPMVSVMKV  176

Query  558  EKAPLESYADIGGLDAQIQ  614
            EKAPLE+YADIGGLDAQIQ
Sbjct  177  EKAPLETYADIGGLDAQIQ  195



>gb|EDK98128.1| mCG129012, partial [Mus musculus]
Length=255

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVGRK++K KG +AA++LP VTP T+C L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  12   RVGRKKKKTKGPDAASKLPLVTPHTQCHLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  71

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSIL FVDKD LEPGC +L
Sbjct  72   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILPFVDKDLLEPGCYVL  131

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  132  LNHKVHAVTGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  175



>ref|XP_010880812.1| PREDICTED: 26S protease regulatory subunit 4-like [Esox lucius]
Length=440

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+++RK KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKRKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQ  195



>ref|XP_008875734.1| 26S protease regulatory subunit 4 [Aphanomyces invadans]
 gb|ETV95541.1| 26S protease regulatory subunit 4 [Aphanomyces invadans]
Length=440

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +3

Query  126  VGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKT  305
            + RK++K+KG  AA R+P V P  KCKLRLLK+ERIKD+LLMEEEF+ NQE +KP++EK 
Sbjct  33   ITRKRKKKKGPSAATRIPAVFPTAKCKLRLLKLERIKDFLLMEEEFIKNQEVMKPKQEKD  92

Query  306  EEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILM  485
            EE+RSKVDDLRGTPM VG LEE+ID+NHAIVSSSVGPEYYVS++SFV++D LE GC++L+
Sbjct  93   EEERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVSVMSFVNQDLLEAGCSVLL  152

Query  486  HNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            HNKV++VVG+L +D DPMVSVMKV+KAPLESYADIGGLD QIQ
Sbjct  153  HNKVMAVVGILSNDTDPMVSVMKVDKAPLESYADIGGLDQQIQ  195



>ref|XP_002431748.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
 gb|EEB19010.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
Length=440

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+RK KG +AA +LP VTP T+C+L+LLK ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKRKTKGPDAALKLPPVTPHTRCRLKLLKSERIKDYLLMEEEFIRNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVD+LRGTPMSVG LEE+ID+NHAIVS++VG E+YVSI S VDKDQLEPGC++L
Sbjct  92   NEEERSKVDELRGTPMSVGTLEEIIDDNHAIVSTAVGSEHYVSIFSIVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DP+V+VMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVVGVLSDDTDPLVTVMKLEKAPQETYADIGGLDTQIQ  195



>gb|ACO10548.1| 26S protease regulatory subunit 4 [Caligus rogercresseyi]
Length=440

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQ  195



>gb|ACH85269.1| proteasome (prosome, macropain) 26S subunit, ATPase 1a [Salmo 
salar]
Length=438

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  30   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  90   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQ
Sbjct  150  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQ  193



>gb|ACN10996.1| 26S protease regulatory subunit 4 [Salmo salar]
Length=440

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQ  195



>ref|XP_003746341.1| PREDICTED: 26S protease regulatory subunit 4-like [Metaseiulus 
occidentalis]
Length=438

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+++ KG  AA++LP VTP  +C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  30   RVGKKKKRAKGPVAASKLPLVTPHARCRLKLLKLERIKDYLLMEEEFLRNQERLKPQEEK  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDD RG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  90   HEEERSKVDDHRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  150  LNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDQQIQ  193



>ref|XP_003062555.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53374.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K +K KG + A RLP V P +KC LR LK+ER+KD+LLMEEEFVANQER+KP EE+
Sbjct  35   RVGKKLKK-KGIDGANRLPNVFPASKCLLRKLKLERVKDWLLMEEEFVANQERVKPHEER  93

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKV++LRG+PM+VG LEE+ID+NHAIVSSSVGPEYYV+I+SFVDK QLEPGCA+L
Sbjct  94   AEEERSKVEELRGSPMNVGTLEEIIDDNHAIVSSSVGPEYYVNIMSFVDKSQLEPGCAVL  153

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +HNK LSVVG L DDVDPMVSVMKV+KAPLESYAD+GGL+ QIQ
Sbjct  154  LHNKSLSVVGTLADDVDPMVSVMKVDKAPLESYADVGGLEDQIQ  197



>ref|XP_010780333.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Notothenia 
coriiceps]
 ref|XP_010780334.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Notothenia 
coriiceps]
Length=440

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T+C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKTKGPDAASKLPLVTPHTQCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLDAQIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDAQIQ  195



>gb|ESA02536.1| hypothetical protein GLOINDRAFT_337332 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52664.1| proteasome regulatory particle base subunit RPT2 [Rhizophagus 
irregularis DAOM 197198w]
Length=444

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+R+  G +A ++LP V P T+C+L+LLKMERIKDYLLMEEEFV NQE+LKPQEEK
Sbjct  38   RVGKKKRR--GPDATSKLPAVYPTTRCRLKLLKMERIKDYLLMEEEFVQNQEQLKPQEEK  95

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +E+R +VDDLRG+PM VG LEE+ID++HAIVSSS GPEYYVSILSFVDKD LEPGC+IL
Sbjct  96   AQEERIRVDDLRGSPMGVGTLEEIIDDDHAIVSSSTGPEYYVSILSFVDKDLLEPGCSIL  155

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K +SVVG+LQDD DPMVSVMK+EKAP ESYADIGGL+ QIQ
Sbjct  156  LHHKAMSVVGVLQDDTDPMVSVMKLEKAPTESYADIGGLEQQIQ  199



>ref|XP_010876963.1| PREDICTED: 26S protease regulatory subunit 4 [Esox lucius]
Length=440

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>gb|ACI68908.1| 26S protease regulatory subunit 4 [Salmo salar]
Length=440

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>gb|KIZ04434.1| 26S proteasome regulatory subunit T2 [Monoraphidium neglectum]
Length=461

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 18/181 (10%)
 Frame = +3

Query  123  RVGRKQRKQKGSEA-AARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEE  299
            RVG+KQ+K+  + +   +LPTVTP T+CKLRLLK+ERIKDYLLME EFV NQERLKPQ+E
Sbjct  35   RVGKKQKKRDAAASLGTKLPTVTPSTRCKLRLLKLERIKDYLLMEHEFVQNQERLKPQDE  94

Query  300  KTEEDRSK-----------------VDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYV  428
            + EEDRSK                 VDDLRG+P+SVG+LEE+IDENHAIVSS+VGPEYYV
Sbjct  95   RNEEDRSKASAARLEQGVAQAHGAAVDDLRGSPLSVGSLEEIIDENHAIVSSAVGPEYYV  154

Query  429  SILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQ  608
            +ILSFVDK QLEPGC++L+HNKV+SVVG+LQD+ DPMVSVMKV+KAP ESYAD+GGL+ Q
Sbjct  155  TILSFVDKTQLEPGCSVLLHNKVMSVVGILQDETDPMVSVMKVDKAPTESYADVGGLENQ  214

Query  609  I  611
            I
Sbjct  215  I  215



>gb|ELU12421.1| hypothetical protein CAPTEDRAFT_160726 [Capitella teleta]
Length=439

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  31   RVGKRKKKMKGPDAANKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVS+LSFVDKDQLEPGC++L
Sbjct  91   EEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSVLSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  194



>ref|XP_009065811.1| hypothetical protein LOTGIDRAFT_197242 [Lottia gigantea]
 gb|ESO83556.1| hypothetical protein LOTGIDRAFT_197242 [Lottia gigantea]
Length=440

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  32   RVGKKKKKLKGPDAATKLPQVTPYTRCRLKLLKLERIKDYLLMEEEFIKNQERLKPQEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+R+KVD+LRG+PMSVGN+EE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  92   HEEERTKVDELRGSPMSVGNMEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD+QIQ
Sbjct  152  LNHKVHAVVGVLSDDTDPMVNVMKLEKAPQETYADIGGLDSQIQ  195



>dbj|BAD96388.1| proteasome 26S ATPase subunit 1 variant [Homo sapiens]
Length=440

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+++ KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKKKKRTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>gb|ACH44455.1| putative 26S ATPase complex subunit 4 [Taeniopygia guttata]
Length=208

 Score =   247 bits (630),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 164/198 (83%), Gaps = 3/198 (2%)
 Frame = +3

Query  21   MGQGTPGGLNRQLPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLTK  200
            MGQ   GG     PG  K DDK +KK      P RVG+K++K KG +AA++LP VTP T+
Sbjct  1    MGQSQSGGHG---PGGSKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQ  57

Query  201  CKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELID  380
            C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK EE+RSKVDDLRGTPMSVG LEE+ID
Sbjct  58   CRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIID  117

Query  381  ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  560
            +NHAIVS+SVG E+YVSILSFVDKD LEPGC++L+++KV +V+G+L DD DP+V+VMKVE
Sbjct  118  DNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVE  177

Query  561  KAPLESYADIGGLDAQIQ  614
            KAP E+YADIGGLD QIQ
Sbjct  178  KAPQETYADIGGLDNQIQ  195



>ref|XP_007253845.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X1 
[Astyanax mexicanus]
 ref|XP_007253846.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X2 
[Astyanax mexicanus]
Length=440

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K+++ KG +AA++LP VTP T+C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKKKKRTKGPDAASKLPLVTPHTQCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQ  195



>ref|NP_001002091.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1b [Danio 
rerio]
 gb|AAH71538.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1b [Danio 
rerio]
Length=440

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+++RK KG +AA++LP VTP T+C+L+LLK +RIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKRKSKGPDAASKLPLVTPHTQCRLKLLKQDRIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>ref|XP_004335995.1| 26S proteasome AAAATPase subunit RPT2a, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR13982.1| 26S proteasome AAAATPase subunit RPT2a, putative [Acanthamoeba 
castellanii str. Neff]
Length=445

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +3

Query  129  GRKQRKQKGS-EAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKT  305
            G K++ +KG+ + A R+P VTP TKC+LRLLK+ERIKD+LLMEEEFV NQE LKPQEEK 
Sbjct  38   GSKKKLRKGAGDLATRIPVVTPHTKCRLRLLKLERIKDWLLMEEEFVQNQEVLKPQEEKA  97

Query  306  EEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILM  485
            +E+R+KVD+LRG+PM VG LEE IDENHAIV SSVGPEYYV+I+SFVDKD LEPGC++L+
Sbjct  98   QEERTKVDELRGSPMGVGTLEERIDENHAIVGSSVGPEYYVTIMSFVDKDLLEPGCSVLL  157

Query  486  HNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            HNK LSVVG+L D+VDP+VSVMKV+KAPLESYADIGGL++QIQ
Sbjct  158  HNKALSVVGILSDEVDPLVSVMKVDKAPLESYADIGGLESQIQ  200



>gb|ACN10104.1| 26S protease regulatory subunit 4 [Salmo salar]
 gb|ACN12452.1| 26S protease regulatory subunit 4 [Salmo salar]
Length=440

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+Q Q
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQNQ  195



>ref|XP_004083702.1| PREDICTED: 26S protease regulatory subunit 4 [Oryzias latipes]
Length=440

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP +TP T+C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKTKGPDAASKLPLITPHTQCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>ref|XP_008159924.1| PREDICTED: 26S protease regulatory subunit 4, partial [Eptesicus 
fuscus]
Length=229

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  31   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  91   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  194



>gb|KFZ49324.1| 26S protease regulatory subunit 4, partial [Podiceps cristatus]
Length=277

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  15   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  74

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  75   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  134

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  135  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  178



>gb|ACO07810.1| 26S protease regulatory subunit 4 [Oncorhynchus mykiss]
Length=440

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVGNLEE+ID+NHAIVS+SVG E+ VSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHCVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDQQIQ  195



>ref|XP_002117269.1| 26S proteasome regulatory chain 4 [Trichoplax adhaerens]
 gb|EDV20319.1| 26S proteasome regulatory chain 4 [Trichoplax adhaerens]
Length=413

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            R+G+K+RK +G EAA ++P VTP TKC+L+LLK+ RI+DYL+ME EF+ NQE+L+PQ+EK
Sbjct  4    RIGKKKRKSRGPEAATKVPLVTPHTKCRLKLLKLNRIRDYLIMESEFIENQEQLRPQDEK  63

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+R+++DD+RGTPM+VG LEE+ID+NHAIVS+SVG E+YVSILSFVD+D LEPGC++L
Sbjct  64   NEEERTRLDDIRGTPMAVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDRDLLEPGCSVL  123

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+LQDD DPMVSVMK+EKAP ESYADIGGL++QIQ
Sbjct  124  LNHKVHAVIGVLQDDTDPMVSVMKLEKAPQESYADIGGLESQIQ  167



>ref|XP_004363832.1| proteasome 26S subunit [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91946.1| proteasome 26S subunit [Capsaspora owczarzaki ATCC 30864]
Length=449

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  135  KQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEED  314
            K++K++G E+  RLP V P TKC+LRLLK+ERIKDYLLM+EEF+ NQERLKPQEEK +E+
Sbjct  45   KRKKKRGPESTNRLPAVVPHTKCRLRLLKLERIKDYLLMDEEFILNQERLKPQEEKNQEE  104

Query  315  RSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK  494
            R KVD+LRG+PM VG LEE+ID++HAIVSS++GPE+YV+I+SFVDKDQLEPGC +L+HNK
Sbjct  105  RVKVDELRGSPMLVGTLEEIIDDSHAIVSSAIGPEFYVTIMSFVDKDQLEPGCTVLLHNK  164

Query  495  VLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            + SV+G+L DD DPMV+VMK+EKAP E+YADIGGLD+QIQ
Sbjct  165  LNSVIGVLADDADPMVNVMKIEKAPRETYADIGGLDSQIQ  204



>gb|EAW65462.1| hCG16327, isoform CRA_b [Homo sapiens]
Length=294

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>gb|KFQ75527.1| 26S protease regulatory subunit 4, partial [Phoenicopterus ruber 
ruber]
Length=296

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  31   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  91   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  194



>ref|XP_004294291.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Fragaria vesca subsp. vesca]
Length=446

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 168/204 (82%), Gaps = 9/204 (4%)
 Frame = +3

Query  21   MGQ--GTPGGLNRQLPGDRK-NDDkkekkfepaapp--aRVGRKQRKQKGSEAAARLPTV  185
            MGQ  GT GG N+Q  GD+  N DKKE+K +       ARVG+KQ KQKG +AA RLP+V
Sbjct  1    MGQQLGTQGGSNQQ--GDQNPNGDKKEEKKKYEPAAPPARVGKKQLKQKGPDAATRLPSV  58

Query  186  TPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKV-DDLRGTPMSVGN  362
             PLTKCKLRLLK+ERIKDYLLMEEEFV+NQE+ KP+E   EED+SKV ++LRG+PM VG 
Sbjct  59   RPLTKCKLRLLKLERIKDYLLMEEEFVSNQEQRKPKENAEEEDKSKVVEELRGSPMDVGT  118

Query  363  LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  542
            L+ELID+NHAIVSSS G  +YV I+SFVDKDQLEPGC +L+HNK  SVVGLLQD+VDP+V
Sbjct  119  LQELIDDNHAIVSSSSG-THYVGIMSFVDKDQLEPGCDVLLHNKQHSVVGLLQDEVDPLV  177

Query  543  SVMKVEKAPLESYADIGGLDAQIQ  614
            +VMKVEKAP+ESYADIGGL+ QIQ
Sbjct  178  AVMKVEKAPVESYADIGGLECQIQ  201



>emb|CCG80742.1| 26S protease regulatory subunit 4 [Taphrina deformans PYCC 5710]
Length=445

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  135  KQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEED  314
            K++KQKG ++   LPTVTP T+CKLRLLKM+RI DYLL+EEEFV+NQERL+P +EKT E+
Sbjct  40   KKKKQKGPDSVVSLPTVTPNTRCKLRLLKMQRIHDYLLLEEEFVSNQERLRPTDEKTAEE  99

Query  315  RSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK  494
            RS+VD++RG+PMSVG LEE+ID++HAIVSS+ G EYYVSILSFVDKD LEPGC++L+H+K
Sbjct  100  RSRVDEIRGSPMSVGTLEEIIDDDHAIVSSTSGGEYYVSILSFVDKDLLEPGCSVLLHHK  159

Query  495  VLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             +S+VG+L DDVDPMVSVMK+EKAP ESYADIGGL++QIQ
Sbjct  160  TVSIVGVLGDDVDPMVSVMKLEKAPTESYADIGGLESQIQ  199



>gb|EFX87779.1| hypothetical protein DAPPUDRAFT_306388 [Daphnia pulex]
Length=442

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  EAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLR  338
            EAA +LP VTP T+C+L+LLKMERIKDYLLMEEEF+ NQERLKPQEE+ EE+RSKVDDLR
Sbjct  46   EAATKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEERNEEERSKVDDLR  105

Query  339  GTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLL  518
            GTPMSVG LEE+ID+ HAIVS+SVG E+YVSILSFVDKDQLEPGC++L+++KV ++VG+L
Sbjct  106  GTPMSVGTLEEIIDDTHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAIVGVL  165

Query  519  QDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  166  SDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ  197



>ref|XP_004924561.1| PREDICTED: 26S protease regulatory subunit 4-like, partial [Bombyx 
mori]
Length=392

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  174  LPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMS  353
            LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK EE+RSKVDDLRGTPMS
Sbjct  1    LPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKIEEERSKVDDLRGTPMS  60

Query  354  VGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVD  533
            VGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L+++KV +VVG+L DD D
Sbjct  61   VGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTD  120

Query  534  PMVSVMKVEKAPLESYADIGGLDAQIQ  614
            PMVSVMK+EKAP E+YADIGGLD QIQ
Sbjct  121  PMVSVMKLEKAPQETYADIGGLDTQIQ  147



>ref|XP_011410414.1| PREDICTED: 26S protease regulatory subunit 4-like [Amphimedon 
queenslandica]
Length=419

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K +K +G E+  +LP VTP T+C+LR+LK+ERIKD+LLME+EF+ NQERLKPQEEK
Sbjct  27   RVGKK-KKSRGPESTNKLPQVTPHTRCRLRMLKLERIKDFLLMEQEFIQNQERLKPQEEK  85

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +E+RSKVDDLRG+PM+VG LEE+ID+NHAIVS+SVG EYYV++LSFVDKD +EPGC +L
Sbjct  86   NQEERSKVDDLRGSPMAVGTLEEIIDDNHAIVSNSVGSEYYVNMLSFVDKDLIEPGCTVL  145

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            ++NK+ +VVG+L DD DPMVSVMK+EKAP ESYADIGGLD QIQ
Sbjct  146  LNNKLHAVVGVLMDDTDPMVSVMKLEKAPSESYADIGGLDTQIQ  189



>gb|AAX25706.2| SJCHGC04846 protein [Schistosoma japonicum]
Length=198

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = +3

Query  72   KNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLM  251
            K DDK +++      P R+G K ++ KG ++  +LP VTP T+CKLRLLKMERIKD+LLM
Sbjct  12   KKDDKTKRREFDPPVPTRMG-KHKRSKGPDSTNKLPQVTPHTRCKLRLLKMERIKDFLLM  70

Query  252  EEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVS  431
            EEEF+ NQERLK  EE+ EE+RSKVDDLRGTPMSVG LEE+ID+NH +VS+SVG E+YVS
Sbjct  71   EEEFIKNQERLKTDEERHEEERSKVDDLRGTPMSVGTLEEIIDDNHVVVSTSVGSEHYVS  130

Query  432  ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQI  611
            ILSFVDK  LEPGC++L+++KV +VVG+L D+ DPMV+VMK+EKAP E+YADIGGLD QI
Sbjct  131  ILSFVDKGMLEPGCSVLLNHKVHAVVGVLTDETDPMVTVMKLEKAPQETYADIGGLDVQI  190

Query  612  Q  614
            Q
Sbjct  191  Q  191



>gb|EMD34033.1| hypothetical protein CERSUDRAFT_117543 [Ceriporiopsis subvermispora 
B]
Length=447

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQ---  293
            RVG+K+R +KG  A+++LP + P T+C+LRLLKMERIKDYLL+EEEF+ NQERLKP+   
Sbjct  36   RVGKKKRTKKGPAASSKLPAIHPTTRCRLRLLKMERIKDYLLLEEEFIVNQERLKPEATR  95

Query  294  EEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGC  473
            EEK EEDRS+VDDLRG+PM+VG LEE+ID++HAIVS++ GPE+YVSI+SFVDKD LEP C
Sbjct  96   EEKNEEDRSRVDDLRGSPMAVGTLEEIIDDDHAIVSTASGPEFYVSIMSFVDKDLLEPSC  155

Query  474  AILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             +L+H+K  +V+G+LQDD DPMVSVMK++KAP ESYADIGGL+ QIQ
Sbjct  156  QVLLHHKTQAVIGVLQDDTDPMVSVMKLDKAPTESYADIGGLEQQIQ  202



>ref|XP_011425280.1| PREDICTED: 26S protease regulatory subunit 4 [Crassostrea gigas]
Length=441

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG + A++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEEK
Sbjct  33   RVGKKKKKMKGPDTASKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEK  92

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+R+KVD+LRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L
Sbjct  93   HEEERTKVDELRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVL  152

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQ
Sbjct  153  LNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDQQIQ  196



>emb|CDH57868.1| 26s proteasome subunit p45 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=437

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
             VGR  RK++G + +++LP V P T+C+L+ LKMERIKDYLL+EEEFV NQERLKP EE+
Sbjct  31   HVGR--RKKRGPDTSSKLPPVYPNTRCRLKTLKMERIKDYLLLEEEFVQNQERLKPAEER  88

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +E+R++VDDLRG+PM+VG LEE+ID++H IVSSSVGPEYYVS++SFVDKDQLEPGC++L
Sbjct  89   DQEERTRVDDLRGSPMAVGTLEEIIDDDHVIVSSSVGPEYYVSVMSFVDKDQLEPGCSVL  148

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K ++VVG+LQDD DPMVSVMK+EKAP ESYADIGGL+ QIQ
Sbjct  149  LHHKTMAVVGVLQDDTDPMVSVMKLEKAPTESYADIGGLETQIQ  192



>emb|CDH57869.1| 26s proteasome subunit p45 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS06375.1| Putative Probable RPT2-26S proteasomeFT regulatory subunit [Absidia 
idahoensis var. thermophila]
Length=439

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
             VGR  RK++G + +++LP V P T+C+L+ LKMERIKDYLL+EEEFV NQERLKP EE+
Sbjct  33   HVGR--RKKRGPDTSSKLPPVYPNTRCRLKTLKMERIKDYLLLEEEFVQNQERLKPAEER  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +E+R++VDDLRG+PM+VG LEE+ID++H IVSSSVGPEYYVS++SFVDKDQLEPGC++L
Sbjct  91   DQEERTRVDDLRGSPMAVGTLEEIIDDDHVIVSSSVGPEYYVSVMSFVDKDQLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K ++VVG+LQDD DPMVSVMK+EKAP ESYADIGGL+ QIQ
Sbjct  151  LHHKTMAVVGVLQDDTDPMVSVMKLEKAPTESYADIGGLETQIQ  194



>ref|XP_009100602.1| PREDICTED: 26S protease regulatory subunit 4 [Serinus canaria]
Length=451

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = +3

Query  3    ICRRRIMGQGTPGGLNRQLPGDRKNDDkkekkfepaappaRVGRKQRKQKGSEAAARLPT  182
            IC   + GQ   GG     PG  K DDK +KK      P RVG+K++K KG +AA++LP 
Sbjct  6    ICMMVVWGQSQSGGHG---PGGSKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPL  62

Query  183  VTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVGN  362
            VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK EE+RSKVDDLRGTPMSVG 
Sbjct  63   VTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGT  122

Query  363  LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  542
            LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L+++KV +V+G+L DD DP+V
Sbjct  123  LEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLV  182

Query  543  SVMKVEKAPLESYADIGGLDAQIQ  614
            +VMKVEKAP E+YADIGGLD QIQ
Sbjct  183  TVMKVEKAPQETYADIGGLDNQIQ  206



>emb|CDJ05993.1| proteasome 26s subunit subunit 4 atpase [Echinococcus multilocularis]
 emb|CDS43275.1| proteasome 26s subunit subunit 4 atpase [Echinococcus multilocularis]
Length=436

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            R+G K ++ KG + A +LP VTP T+CKLRLLK+ERIKDYLLMEEEF+ NQERLK  EEK
Sbjct  29   RMG-KHKRSKGPDTANKLPQVTPHTRCKLRLLKLERIKDYLLMEEEFIKNQERLKTDEEK  87

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NH IVS+SVG E+YVSILSFVDK  LEPGC++L
Sbjct  88   NEEERSKVDDLRGTPMSVGTLEEIIDDNHVIVSTSVGSEHYVSILSFVDKGMLEPGCSVL  147

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLDAQIQ
Sbjct  148  LNHKVHAVVGVLTDDTDPMVTVMKLEKAPQETYADIGGLDAQIQ  191



>dbj|BAK63819.1| 26S protease regulatory subunit 4 [Pan troglodytes]
Length=349

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>ref|XP_002501620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62878.1| predicted protein [Micromonas sp. RCC299]
Length=444

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K +K KG + A RLP V P +KC LR LK+ER+KD+LLMEEEFV NQER+KP  E+
Sbjct  37   RVGKKLKK-KGIDGATRLPDVAPASKCLLRKLKLERVKDWLLMEEEFVTNQERIKPHTER  95

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
              +D+SKVD+LRG+PMSVGNLEE+ID+NH IVSSS GPEYYVSI+SFVDK QLEPGC++L
Sbjct  96   AADDQSKVDELRGSPMSVGNLEEIIDDNHCIVSSSSGPEYYVSIMSFVDKSQLEPGCSVL  155

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +HNK  +VVG+L DDVDPMVSVMKV+KAPLESYAD+GGL+ QIQ
Sbjct  156  LHNKTNAVVGVLADDVDPMVSVMKVDKAPLESYADVGGLEEQIQ  199



>emb|CDS33761.1| proteasome 26s subunit subunit 4 atpase [Hymenolepis microstoma]
Length=436

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            R+G K ++ KG + A +LP VTP T+CKLRLLK+ERIKDYLLMEEEF+ NQERLK  EEK
Sbjct  29   RMG-KHKRSKGPDTANKLPQVTPHTRCKLRLLKLERIKDYLLMEEEFIKNQERLKTDEEK  87

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NH IVS+SVG E+YVSILSFVDK  LEPGC++L
Sbjct  88   NEEERSKVDDLRGTPMSVGTLEEIIDDNHVIVSTSVGSEHYVSILSFVDKGMLEPGCSVL  147

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLDAQIQ
Sbjct  148  LNHKVHAVVGVLTDDTDPMVTVMKLEKAPQETYADIGGLDAQIQ  191



>emb|CEG65804.1| Putative 26s protease regulatory subunit 4 [Rhizopus microsporus]
Length=438

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K  K++G +  A+LP V P T+C+L++LKMERIKDYLL+EEEFV NQERLKPQEE+
Sbjct  32   RVGKK--KKRGPDTTAKLPQVFPTTRCRLKMLKMERIKDYLLLEEEFVQNQERLKPQEER  89

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +E+R++VDDLRG+PM+VG+LEE+ID++H IVSS+ GPEYYVS++SFVDKD LEPGC++L
Sbjct  90   DQEERTRVDDLRGSPMTVGSLEEIIDDDHVIVSSATGPEYYVSVMSFVDKDLLEPGCSVL  149

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K +SVVG+L DD DPMVSVMK+EKAP ESYADIGGL+ QIQ
Sbjct  150  LHHKTMSVVGVLADDTDPMVSVMKLEKAPTESYADIGGLEKQIQ  193



>ref|XP_005847625.1| 26S proteasome AAA-ATPase subunit RPT2a [Chlorella variabilis]
 gb|EFN55523.1| 26S proteasome AAA-ATPase subunit RPT2a [Chlorella variabilis]
Length=443

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEA-AARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEE  299
            RVG+KQR++  + +   +LPT+TP  KCKLRLLK+ER+KD+LLMEEEFV NQERLKP +E
Sbjct  34   RVGKKQRRRAAASSLGTKLPTITPTAKCKLRLLKLERVKDWLLMEEEFVQNQERLKPADE  93

Query  300  KTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAI  479
            + EE+R+KVDDLRGTP+SVG LEE+IDENHAIVSS+VGPEYYV+I+SFVDK QLEPG  +
Sbjct  94   RNEEERTKVDDLRGTPLSVGTLEEMIDENHAIVSSAVGPEYYVTIMSFVDKTQLEPGSTV  153

Query  480  LMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            L+HNK   VVG+L D+ DP VSVMKVE+AP ESYAD+GGLD QIQ
Sbjct  154  LLHNKGNQVVGILTDEADPAVSVMKVEQAPSESYADVGGLDQQIQ  198



>ref|XP_002165829.1| PREDICTED: 26S protease regulatory subunit 4-like [Hydra vulgaris]
Length=441

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +3

Query  123  RVGRK-QRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEE  299
            RVG+K ++K +G + A +LP VTP   C+L+LLK+ERIKD+LLMEEEF+ NQERLKPQEE
Sbjct  32   RVGKKAKKKNRGPDTANKLPQVTPHRNCRLKLLKLERIKDFLLMEEEFIQNQERLKPQEE  91

Query  300  KTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAI  479
            K EE+RSKVDDLRGTPMSVG+LEE+ID+NHAIVS+SVG E+YV+ILSFVDKD LEPGC++
Sbjct  92   KHEEERSKVDDLRGTPMSVGSLEEIIDDNHAIVSTSVGSEHYVNILSFVDKDLLEPGCSV  151

Query  480  LMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            L+++KV +VVG+L +D DPMVSVMK+EKAP E+YADIGGLD QIQ
Sbjct  152  LLNHKVHAVVGVLGEDTDPMVSVMKLEKAPTETYADIGGLDTQIQ  196



>ref|XP_005769175.1| hypothetical protein EMIHUDRAFT_355962 [Emiliania huxleyi CCMP1516]
 ref|XP_005772179.1| hypothetical protein EMIHUDRAFT_369395 [Emiliania huxleyi CCMP1516]
 gb|EOD16746.1| hypothetical protein EMIHUDRAFT_355962 [Emiliania huxleyi CCMP1516]
 gb|EOD19750.1| hypothetical protein EMIHUDRAFT_369395 [Emiliania huxleyi CCMP1516]
Length=436

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 143/164 (87%), Gaps = 5/164 (3%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVGRK+RK+ G  A++RLPTV P TKCKLRLLK+ER+KDYLLMEEEFVA QE++KPQEE 
Sbjct  33   RVGRKKRKKAGPAASSRLPTVVPATKCKLRLLKLERVKDYLLMEEEFVARQEQVKPQEES  92

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +++R+KV+D+RGTP+ V  LEE++D+NHAI+SSS+GPEYYV+ILSFVDKDQLEPGC++L
Sbjct  93   AQQERTKVEDIRGTPLGVATLEEMVDDNHAIISSSIGPEYYVNILSFVDKDQLEPGCSLL  152

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             HNKV S+VGLL D+ DPM     V+KAP+ESYADIGGL+ QIQ
Sbjct  153  THNKVNSIVGLLADEADPM-----VDKAPVESYADIGGLETQIQ  191



>ref|XP_007318478.1| hypothetical protein SERLADRAFT_348772 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN91920.1| hypothetical protein SERLA73DRAFT_80029 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO24459.1| hypothetical protein SERLADRAFT_348772 [Serpula lacrymans var. 
lacrymans S7.9]
Length=442

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 147/167 (88%), Gaps = 5/167 (3%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQ---  293
            RVG+K  K++G + A++LP V P T+C+LRLLKMERIKDYLLMEEEFV NQER+KP+   
Sbjct  33   RVGKK--KKRGPDTASKLPAVFPATRCRLRLLKMERIKDYLLMEEEFVQNQERMKPETTR  90

Query  294  EEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGC  473
            EEK EEDR+KVDDLRG+PM+VG LEE+ID++HAIVS++ GPEYYVSI+SFVDKD++EPGC
Sbjct  91   EEKNEEDRTKVDDLRGSPMAVGTLEEIIDDDHAIVSTASGPEYYVSIMSFVDKDRIEPGC  150

Query  474  AILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             +L+H+K  +VVG+LQDD DPMVSVMK++KAP ESYADIGGL+ QIQ
Sbjct  151  QVLLHHKTQAVVGVLQDDADPMVSVMKLDKAPTESYADIGGLENQIQ  197



>ref|XP_003322501.1| 26S protease regulatory subunit 4 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP78082.1| 26S protease regulatory subunit 4 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=439

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG K +K++G  A  +LPTV P ++CKL+LLKMERIKD+LL+EEEFV NQERLKP+EEK
Sbjct  32   RVG-KAKKKRGPSAVNKLPTVFPTSRCKLKLLKMERIKDHLLLEEEFVINQERLKPKEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             E +RS+VDDLRG+PM VG LEE+ID++HAIVSS+ GPEYYV+ILSFVDKD LEPGC++L
Sbjct  91   AERERSEVDDLRGSPMGVGTLEEIIDDDHAIVSSATGPEYYVNILSFVDKDLLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQI  611
            +H+KV+SVVG+L DD DPMVSVMK++KAP ESYADIGGLD QI
Sbjct  151  LHHKVMSVVGVLGDDTDPMVSVMKLDKAPTESYADIGGLDQQI  193



>ref|XP_006793170.1| PREDICTED: 26S protease regulatory subunit 4-like [Neolamprologus 
brichardi]
Length=356

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKQERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>gb|ETE70436.1| 26S protease regulatory subunit 4 [Ophiophagus hannah]
Length=389

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>gb|EEE58887.1| hypothetical protein OsJ_10505 [Oryza sativa Japonica Group]
Length=460

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 163/239 (68%), Gaps = 65/239 (27%)
 Frame = +3

Query  21   MGQGTPGGLNRQ--LPGDRK-----NDDkkekkfepaappaRVGRKQRKQKGSEAAARLP  179
            MGQGTPGG+ +Q  LPGDRK       DKK++KFEP A P+RVGRKQRKQKG EAAARLP
Sbjct  1    MGQGTPGGMGKQGGLPGDRKPGDGGAGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLP  60

Query  180  TVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGTPMSVG  359
             V PL                         NQERL+P E+KTEEDRSKVDDLRGTPMSVG
Sbjct  61   AVAPLF------------------------NQERLRPSEDKTEEDRSKVDDLRGTPMSVG  96

Query  360  NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK---------------  494
            +LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNK               
Sbjct  97   SLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKWDWKHHTNTSVVHGL  156

Query  495  -------------------VLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
                               VLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQ
Sbjct  157  VIGSKRQSDQMVHIRYLQMVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQ  215



>ref|XP_006042318.1| PREDICTED: 26S protease regulatory subunit 4 [Bubalus bubalis]
Length=440

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA+RLP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  32   RVGKKKKKTKGPDAASRLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  91

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  92   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  151

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  152  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  195



>gb|KFW63950.1| 26S protease regulatory subunit 4, partial [Pygoscelis adeliae]
Length=438

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  31   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  90

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  91   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  150

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  151  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  194



>gb|EPB87829.1| 26S protease regulatory subunit 4 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=431

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K  K++G +  A+LP V P T+C+L++LKMERIKDYLL+EEEFV NQERLKPQEE+
Sbjct  25   RVGKK--KKRGPDTTAKLPQVFPTTRCRLKMLKMERIKDYLLLEEEFVQNQERLKPQEER  82

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +E+R++VDDLRG+PM+VG+LEE+ID++H IVSS+ GPEYYVS++SFVDKD LEPGC++L
Sbjct  83   DQEERTRVDDLRGSPMTVGSLEEIIDDDHVIVSSATGPEYYVSVMSFVDKDLLEPGCSVL  142

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K +SVVG+L DD DPMVSVMK+EKAP ESYADIGGL+ Q+Q
Sbjct  143  LHHKTMSVVGVLGDDTDPMVSVMKLEKAPTESYADIGGLEQQVQ  186



>ref|XP_007330473.1| hypothetical protein AGABI1DRAFT_114231 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78613.1| hypothetical protein AGABI1DRAFT_114231 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=446

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 146/167 (87%), Gaps = 5/167 (3%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQ---  293
            RVG+K+R+  G  AA++LP + P T+C+L+LLKMERIKDYLLMEEEFV NQERLKP+   
Sbjct  37   RVGKKKRR--GPSAASKLPAIYPTTRCRLKLLKMERIKDYLLMEEEFVHNQERLKPETTR  94

Query  294  EEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGC  473
            EEK EEDRSKVDDLRG+PM+VG LEE+ID++HAI+S++ GPE+YVSI+S+VDKD LEPGC
Sbjct  95   EEKNEEDRSKVDDLRGSPMAVGTLEEIIDDDHAIISTASGPEFYVSIMSYVDKDLLEPGC  154

Query  474  AILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             +L+H+K  SVVG+LQDD DPMVSVMK++KAP ESYADIGGL+ QIQ
Sbjct  155  QVLLHHKTQSVVGVLQDDADPMVSVMKLDKAPTESYADIGGLEQQIQ  201



>ref|XP_004376827.1| PREDICTED: 26S protease regulatory subunit 4 [Trichechus manatus 
latirostris]
Length=421

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  58   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  117

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  118  QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  177

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  178  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  221



>ref|XP_006459243.1| hypothetical protein AGABI2DRAFT_191249 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV49166.1| hypothetical protein AGABI2DRAFT_191249 [Agaricus bisporus var. 
bisporus H97]
Length=446

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 146/167 (87%), Gaps = 5/167 (3%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQ---  293
            RVG+K+R+  G  AA++LP + P T+C+L+LLKMERIKDYLLMEEEFV NQERLKP+   
Sbjct  37   RVGKKKRR--GPSAASKLPAIYPTTRCRLKLLKMERIKDYLLMEEEFVHNQERLKPETTR  94

Query  294  EEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGC  473
            EEK EEDRSKVDDLRG+PM+VG LEE+ID++HAI+S++ GPE+YVSI+S+VDKD LEPGC
Sbjct  95   EEKNEEDRSKVDDLRGSPMAVGTLEEIIDDDHAIISTASGPEFYVSIMSYVDKDLLEPGC  154

Query  474  AILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
             +L+H+K  SVVG+LQDD DPMVSVMK++KAP ESYADIGGL+ QIQ
Sbjct  155  QVLLHHKTQSVVGVLQDDADPMVSVMKLDKAPTESYADIGGLEQQIQ  201



>ref|XP_001416670.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94963.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=443

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K  G E + RLP V P +KCKLR+LK+ER+KDYLLMEEEFV NQERLKP+EE+
Sbjct  36   RVGKKKKKT-GIEGSTRLPNVAPQSKCKLRMLKLERVKDYLLMEEEFVGNQERLKPREER  94

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             E+++SK+D++RG PMSVG+LEE+ID+ H IVSSS+GPEYYV+I SFVDK QLEPGCA+L
Sbjct  95   DEDEQSKIDEMRGAPMSVGSLEEIIDDTHGIVSSSIGPEYYVNIASFVDKSQLEPGCAVL  154

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K  +VVG L DDVDPMVSVMKV+KAPLESYAD+GGL+ QIQ
Sbjct  155  LHHKNSAVVGTLADDVDPMVSVMKVDKAPLESYADVGGLEDQIQ  198



>gb|KFR12490.1| 26S protease regulatory subunit 4, partial [Opisthocomus hoazin]
Length=419

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K++K KG +AA++LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE++KP EEK
Sbjct  13   RVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK  72

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             EE+RSKVDDLRGTPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L
Sbjct  73   QEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL  132

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQ
Sbjct  133  LNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQ  176



>emb|CEP14990.1| hypothetical protein [Parasitella parasitica]
Length=447

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +3

Query  123  RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEK  302
            RVG+K  K++G +  A+LP V P T+C+L++LKMERIKDYLL+EEEFV NQERLKPQEE+
Sbjct  41   RVGKK--KKRGPDTTAKLPQVFPTTRCRLKMLKMERIKDYLLLEEEFVQNQERLKPQEER  98

Query  303  TEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  482
             +E+R++VDDLRG+PM+VG+LEE+ID++H IVSS+ GPEYYVS++SFVDKD LEPGC++L
Sbjct  99   DQEERTRVDDLRGSPMTVGSLEEIIDDDHVIVSSATGPEYYVSVMSFVDKDLLEPGCSVL  158

Query  483  MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQ  614
            +H+K +SVVG+L DD DPMVSVMK+EKAP ESYADIGGL+ Q+Q
Sbjct  159  LHHKTMSVVGVLGDDTDPMVSVMKLEKAPTESYADIGGLEQQVQ  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889770574917