BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13226

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011082747.1|  PREDICTED: tRNA dimethylallyltransferase 9         166   1e-44   Sesamum indicum [beniseed]
ref|XP_010279080.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    156   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010279079.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    157   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_002283012.1|  PREDICTED: tRNA dimethylallyltransferase 9         153   5e-40   Vitis vinifera
emb|CBI20214.3|  unnamed protein product                                151   3e-39   Vitis vinifera
ref|XP_004137218.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    151   3e-39   Cucumis sativus [cucumbers]
ref|XP_006451736.1|  hypothetical protein CICLE_v10008222mg             151   4e-39   
gb|KDO48345.1|  hypothetical protein CISIN_1g012837mg                   150   4e-39   Citrus sinensis [apfelsine]
ref|XP_008451715.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    151   5e-39   Cucumis melo [Oriental melon]
ref|XP_012078558.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    150   5e-39   
ref|XP_006451735.1|  hypothetical protein CICLE_v10008222mg             150   6e-39   
ref|XP_006451734.1|  hypothetical protein CICLE_v10008222mg             150   6e-39   Citrus clementina [clementine]
ref|XP_006485669.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    150   7e-39   Citrus sinensis [apfelsine]
gb|KDO48344.1|  hypothetical protein CISIN_1g012837mg                   150   7e-39   Citrus sinensis [apfelsine]
ref|XP_012078557.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    150   1e-38   Jatropha curcas
gb|EYU45007.1|  hypothetical protein MIMGU_mgv1a0264151mg               141   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_004251888.1|  PREDICTED: tRNA dimethylallyltransferase 9         148   3e-38   Solanum lycopersicum
ref|XP_006358949.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    147   3e-38   Solanum tuberosum [potatoes]
ref|XP_008386239.1|  PREDICTED: tRNA dimethylallyltransferase 9         147   8e-38   
ref|XP_006358948.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    145   3e-37   Solanum tuberosum [potatoes]
ref|XP_009760198.1|  PREDICTED: tRNA dimethylallyltransferase 9         145   4e-37   Nicotiana sylvestris
ref|XP_009587099.1|  PREDICTED: tRNA dimethylallyltransferase 9         145   5e-37   Nicotiana tomentosiformis
ref|XP_009340250.1|  PREDICTED: tRNA dimethylallyltransferase 9         144   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_002300421.2|  hypothetical protein POPTR_0001s38570g             143   3e-36   
ref|XP_008226503.1|  PREDICTED: tRNA dimethylallyltransferase 9         143   3e-36   Prunus mume [ume]
ref|XP_004294141.2|  PREDICTED: tRNA dimethylallyltransferase 9         143   4e-36   Fragaria vesca subsp. vesca
ref|XP_007213909.1|  hypothetical protein PRUPE_ppa005482mg             142   7e-36   Prunus persica
ref|XP_011006723.1|  PREDICTED: tRNA dimethylallyltransferase 9         141   1e-35   Populus euphratica
ref|XP_010108266.1|  tRNA dimethylallyltransferase 9                    141   1e-35   
gb|KJB61645.1|  hypothetical protein B456_009G372500                    141   1e-35   Gossypium raimondii
gb|KJB61644.1|  hypothetical protein B456_009G372500                    141   1e-35   Gossypium raimondii
emb|CDY45111.1|  BnaA02g04650D                                          136   1e-35   Brassica napus [oilseed rape]
ref|XP_003543220.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    140   2e-35   Glycine max [soybeans]
ref|XP_008451716.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    140   2e-35   
gb|KEH38634.1|  tRNA dimethylallyltransferase                           139   5e-35   Medicago truncatula
ref|XP_006400569.1|  hypothetical protein EUTSA_v10013462mg             139   8e-35   Eutrema salsugineum [saltwater cress]
gb|KHG00135.1|  tRNA dimethylallyltransferase 9 -like protein           138   2e-34   Gossypium arboreum [tree cotton]
ref|XP_010520596.1|  PREDICTED: tRNA dimethylallyltransferase 9         137   3e-34   Tarenaya hassleriana [spider flower]
emb|CDX70907.1|  BnaC03g09910D                                          137   3e-34   
emb|CDX88863.1|  BnaA03g07860D                                          137   4e-34   
ref|XP_007149408.1|  hypothetical protein PHAVU_005G067800g             137   4e-34   Phaseolus vulgaris [French bean]
ref|XP_010941327.1|  PREDICTED: tRNA dimethylallyltransferase 9         137   5e-34   Elaeis guineensis
ref|XP_002524264.1|  ATP binding protein, putative                      137   5e-34   Ricinus communis
ref|XP_009131765.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    137   6e-34   Brassica rapa
ref|XP_004489048.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    136   8e-34   Cicer arietinum [garbanzo]
ref|XP_010454297.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010420834.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007021670.1|  Isopentenyltransferase 9 isoform 2                 134   1e-33   
ref|XP_010493096.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    135   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007021669.1|  Isopentenyltransferase 9 isoform 1                 135   2e-33   Theobroma cacao [chocolate]
ref|XP_010060664.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    134   5e-33   
ref|XP_010060666.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    134   5e-33   
gb|KFK26250.1|  hypothetical protein AALP_AA8G222700                    134   6e-33   Arabis alpina [alpine rockcress]
gb|EPS66580.1|  hypothetical protein M569_08195                         132   9e-33   Genlisea aurea
ref|XP_006287693.1|  hypothetical protein CARUB_v10000903mg             133   1e-32   Capsella rubella
ref|XP_002873979.1|  ATIPT9                                             133   1e-32   
ref|XP_009126411.1|  PREDICTED: tRNA dimethylallyltransferase 9         131   7e-32   Brassica rapa
emb|CDP05986.1|  unnamed protein product                                130   1e-31   Coffea canephora [robusta coffee]
ref|XP_008811471.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    129   4e-31   
ref|XP_008811477.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    129   4e-31   
ref|XP_008811509.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    129   5e-31   Phoenix dactylifera
ref|XP_008811501.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    128   5e-31   Phoenix dactylifera
ref|XP_008811491.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    128   5e-31   Phoenix dactylifera
ref|XP_008811484.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    128   5e-31   Phoenix dactylifera
ref|NP_568390.2|  tRNA isopentenyltransferase AtIPT9                    127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190344.1|  tRNA isopentenyltransferase AtIPT9                 127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675404.1|  PREDICTED: tRNA dimethylallyltransferase 9         127   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_851043.1|  tRNA isopentenyltransferase AtIPT9                    127   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63091.1|  IPP transferase-like protein                            126   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KCW67467.1|  hypothetical protein EUGRSUZ_F01210                     124   2e-29   Eucalyptus grandis [rose gum]
ref|NP_001058651.2|  Os06g0729800                                       122   5e-29   
dbj|BAD62118.1|  putative tRNA isopentenyltransferase                   122   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009394407.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    121   2e-28   
ref|XP_009394389.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    121   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006852479.1|  PREDICTED: tRNA dimethylallyltransferase 9         120   3e-28   Amborella trichopoda
gb|EMT06411.1|  tRNA Delta(2)-isopentenylpyrophosphate transferase      117   4e-27   
emb|CAN83244.1|  hypothetical protein VITISV_000817                     117   7e-27   Vitis vinifera
gb|EMS61041.1|  tRNA dimethylallyltransferase 9                         116   7e-27   Triticum urartu
ref|XP_006656524.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    116   8e-27   Oryza brachyantha
dbj|BAJ89736.1|  predicted protein                                      116   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004963310.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    113   8e-26   Setaria italica
ref|XP_003563223.2|  PREDICTED: tRNA dimethylallyltransferase 9         113   1e-25   Brachypodium distachyon [annual false brome]
gb|ERN20129.1|  hypothetical protein AMTR_s00066p00067810               107   1e-25   Amborella trichopoda
ref|XP_002463348.1|  hypothetical protein SORBIDRAFT_02g042160          112   2e-25   
ref|NP_001127753.1|  isopentenyl transferase                            112   2e-25   
ref|XP_008647277.1|  PREDICTED: isopentenyl transferase isoform X1      112   2e-25   
ref|XP_002437643.1|  hypothetical protein SORBIDRAFT_10g031125          111   4e-25   
dbj|BAG68561.1|  isopentenyl transferase                                107   7e-24   Physcomitrella patens
ref|XP_001767747.1|  predicted protein                                  109   7e-24   
ref|XP_002985201.1|  hypothetical protein SELMODRAFT_424359             106   2e-23   
ref|XP_002970127.1|  hypothetical protein SELMODRAFT_410898             106   2e-23   
gb|ABP88738.1|  tRNA-isopentenyltransferase                             107   3e-23   Physcomitrella patens
ref|XP_005708069.1|  tRNA dimethylallyltransferase isoform 1            103   2e-22   Galdieria sulphuraria
ref|XP_005708068.1|  tRNA dimethylallyltransferase isoform 2            103   3e-22   Galdieria sulphuraria
ref|XP_005702563.1|  tRNA dimethylallyltransferase isoform 2            103   3e-22   Galdieria sulphuraria
ref|XP_005702562.1|  tRNA dimethylallyltransferase isoform 1            103   3e-22   Galdieria sulphuraria
ref|WP_035254811.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    102   3e-22   
ref|WP_022416972.1|  tRNA dimethylallyltransferase                      102   4e-22   
ref|XP_005539056.1|  tRNA isopentenyltransferase                        102   1e-21   Cyanidioschyzon merolae strain 10D
ref|WP_018673937.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    100   1e-21   Brevibacillus laterosporus
ref|WP_022226282.1|  tRNA dimethylallyltransferase                      100   1e-21   
ref|WP_042239754.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    100   2e-21   
ref|WP_044882520.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    100   2e-21   
gb|KIC73229.1|  tRNA dimethylallyltransferase                           100   2e-21   Neochlamydia sp. EPS4
ref|WP_039384140.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    100   2e-21   Neochlamydia sp. TUME1
gb|KIC76632.1|  tRNA dimethylallyltransferase                           100   2e-21   Neochlamydia sp. TUME1
ref|WP_007440312.1|  tRNA dimethylallyltransferase                    94.7    3e-21   
ref|WP_041941869.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    100   3e-21   
gb|ADI38731.1|  tRNA delta-2-isopentenylpyrophosphate transferase       100   3e-21   Waddlia chondrophila WSU 86-1044
dbj|GAE48255.1|  tRNA dimethylallyltransferase                        94.7    4e-21   Bacillus boroniphilus JCM 21738
ref|WP_005806270.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  99.4    4e-21   Candidatus Arthromitus sp. SFB-mouse [segmented filamentous bacteria]
ref|WP_031538266.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.4    5e-21   Bacillus
ref|WP_024028344.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.4    5e-21   Bacillus vireti
ref|WP_034434342.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.4    5e-21   Clostridiales bacterium S5-A14a
gb|AGC04673.1|  tRNA-isopentenyltransferase                             100   5e-21   Physcomitrella patens
ref|WP_003337167.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.0    5e-21   Brevibacillus laterosporus
ref|WP_045505564.1|  hypothetical protein                             99.0    5e-21   
ref|WP_029099052.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.0    6e-21   Brevibacillus thermoruber
ref|WP_035343862.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.0    6e-21   Bacillus hemicellulosilyticus
ref|WP_015042677.1|  MULTISPECIES: tRNA dimethylallyltransferase      99.0    6e-21   Dehalobacter
ref|WP_007417850.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.0    6e-21   Pedosphaera parvula
ref|WP_035297419.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  99.0    6e-21   Bacillales
ref|WP_008514501.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.0    6e-21   Dethiobacter alkaliphilus
ref|WP_006844981.1|  transposase                                      99.0    6e-21   Weissella koreensis
ref|WP_013989634.1|  transposase                                      98.6    6e-21   Weissella koreensis
ref|WP_034741144.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  99.0    7e-21   Bacillus wakoensis
ref|WP_004514052.1|  tRNA dimethylallyltransferase                    98.6    7e-21   Geobacter metallireducens
ref|WP_031413818.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  98.6    7e-21   Brevibacillus laterosporus
ref|WP_015898907.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  98.6    8e-21   Persephonella marina
ref|WP_045057306.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.4    8e-21   
ref|WP_040933766.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  98.6    8e-21   
ref|WP_040943176.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  98.2    9e-21   
ref|WP_022166100.1|  tRNA dimethylallyltransferase                    98.2    1e-20   
ref|WP_041018636.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  98.2    1e-20   
ref|WP_040574403.1|  tRNA dimethylallyltransferase                    98.2    1e-20   
ref|WP_028399069.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  98.2    1e-20   Bacillus panaciterrae
ref|WP_013275984.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.8    1e-20   Thermosediminibacter oceani
ref|WP_020492526.1|  tRNA dimethylallyltransferase                    97.8    1e-20   Dehalobacter sp. FTH1
ref|WP_018661648.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.8    1e-20   Thermobrachium celere
ref|WP_034658493.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.8    1e-20   
ref|WP_010282246.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.8    1e-20   Bacillus timonensis
emb|CDR35057.1|  tRNA dimethylallyltransferase                        98.2    1e-20   Criblamydia sequanensis CRIB-18
ref|WP_031556857.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.8    1e-20   Lachnospiraceae bacterium FD2005
ref|WP_021619401.1|  tRNA dimethylallyltransferase                    97.8    2e-20   Aneurinibacillus aneurinilyticus
ref|WP_042294598.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   Candidatus Arthromitus sp. SFB-mouse-NL
ref|WP_029505954.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   Lachnospiraceae bacterium AC2012
ref|WP_022849697.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   Geovibrio sp. L21-Ace-BES
ref|WP_003350092.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   Bacillus methanolicus
ref|XP_008382159.1|  PREDICTED: tRNA dimethylallyltransferase 9-like  93.6    2e-20   
ref|WP_022584478.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   Brevibacillus laterosporus
ref|WP_012529413.1|  tRNA dimethylallyltransferase 1                  97.4    2e-20   Geobacter bemidjiensis
ref|WP_026842367.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   Geobacter bremensis
ref|WP_041419427.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   
ref|WP_029565656.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.4    2e-20   
ref|WP_031502739.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.1    3e-20   Pseudothermotoga hypogea
ref|WP_031305817.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  97.1    3e-20   Brevibacillus panacihumi
ref|WP_027439081.1|  hypothetical protein                             97.1    3e-20   Lachnospiraceae bacterium AC2031
ref|WP_027436413.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    3e-20   Lachnospiraceae bacterium AB2028
gb|EST52454.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    96.7    3e-20   Brevibacillus panacihumi W25
ref|WP_019225370.1|  tRNA dimethylallyltransferase                    96.7    3e-20   Dehalobacter
ref|WP_025205660.1|  tRNA dimethylallyltransferase                    96.7    3e-20   Dehalobacter restrictus
ref|WP_014812426.1|  tRNA isopentenyltransferase MiaA                 96.7    4e-20   Desulfomonile tiedjei
ref|WP_035411705.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    4e-20   Bacillus sp. SJS
emb|CCB89591.1|  tRNA dimethylallyltransferase                        96.7    4e-20   Simkania negevensis Z
ref|WP_034698953.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    4e-20   Enterococcus hirae
ref|WP_027432968.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    4e-20   Lachnospiraceae bacterium MD2004
ref|WP_006953801.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    4e-20   Idiomarina baltica
ref|WP_025601390.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    4e-20   
emb|CCO09346.1|  tRNA dimethylallyltransferase                        96.7    4e-20   Desulfotomaculum hydrothermale Lam5 = DSM 18033
ref|WP_042103588.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    4e-20   
ref|WP_042491656.1|  transposase                                      96.3    4e-20   Weissella hellenica
ref|WP_035408737.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.3    4e-20   Exiguobacterium sp. RIT341
ref|WP_023346603.1|  tRNA dimethylallyltransferase                    96.3    5e-20   Firmicutes bacterium ASF500
ref|WP_026574979.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.3    5e-20   Bacillus sp. UNC438CL73TsuS30
ref|WP_027938231.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.3    5e-20   Anaeroarcus burkinensis
ref|WP_022119788.1|  tRNA dimethylallyltransferase                    96.3    5e-20   
ref|WP_029341237.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  96.3    5e-20   Exiguobacterium
ref|WP_018704354.1|  hypothetical protein                             96.3    5e-20   Anaeromusa acidaminophila
ref|WP_021978227.1|  tRNA dimethylallyltransferase                    96.3    5e-20   
ref|WP_044664332.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.3    6e-20   Syntrophaceticus schinkii
emb|CEO88093.1|  tRNA dimethylallyltransferase                        96.3    6e-20   Syntrophaceticus schinkii
ref|WP_012727998.1|  tRNA dimethylallyltransferase                    96.3    6e-20   Chlamydia trachomatis
ref|WP_023467752.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    6e-20   Exiguobacterium
ref|WP_003776707.1|  tRNA dimethylallyltransferase                    95.9    6e-20   Alloiococcus otitis
ref|WP_034265185.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    6e-20   Bacillus
ref|WP_027347297.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    6e-20   Helcococcus sueciensis
ref|WP_002463888.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    6e-20   
ref|WP_033579840.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    7e-20   Bacillus aryabhattai
ref|WP_045519456.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    7e-20   Bacillus niacini
ref|WP_013778391.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    7e-20   Tepidanaerobacter acetatoxydans
gb|KIO58884.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    95.9    7e-20   Bacillus thermoamylovorans
ref|WP_026106681.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    7e-20   Bacillus megaterium
ref|WP_028411375.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    7e-20   Bacillus sp. 278922_107
ref|WP_045817386.1|  hypothetical protein                             95.9    7e-20   Cellvibrionaceae bacterium 1162T.S.0a.05
ref|WP_025173040.1|  hypothetical protein                             92.4    7e-20   
gb|KIO74218.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    95.9    7e-20   Bacillus thermoamylovorans
ref|WP_041845208.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    7e-20   Bacillus thermoamylovorans
ref|WP_023495426.1|  tRNA dimethylallyltransferase MiaA               95.9    7e-20   Methyloglobulus morosus
ref|WP_037559111.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    7e-20   
ref|WP_014458499.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    8e-20   Bacillus megaterium
ref|WP_034769974.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    8e-20   Bacillus thermoamylovorans
ref|WP_017365173.1|  tRNA dimethylallyltransferase                    95.5    8e-20   Methylococcus capsulatus
ref|WP_021953070.1|  tRNA dimethylallyltransferase                    95.5    8e-20   
ref|WP_034654991.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    8e-20   Bacillus megaterium
gb|EOB27113.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    8e-20   Streptococcus pneumoniae 357
ref|WP_026566589.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    8e-20   Bacillus sp. UNC41MFS5
ref|WP_010960949.1|  tRNA dimethylallyltransferase                    95.5    8e-20   Methylococcus capsulatus
ref|WP_041966639.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    9e-20   Bacillus selenatarsenatis
ref|WP_035048460.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    9e-20   Anoxybacillus
ref|WP_025746645.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    1e-19   Caldicoprobacter
ref|WP_043976720.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    1e-19   Bacillus megaterium
ref|WP_015721776.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    1e-19   Geobacter sp. M18
ref|WP_044894154.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    1e-19   Bacillus alveayuensis
ref|WP_045614123.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Streptococcus infantis
ref|WP_025908612.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    1e-19   Bacillus
ref|WP_010898520.1|  tRNA dimethylallyltransferase                    95.1    1e-19   Bacillus halodurans
ref|WP_045290249.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Bacillus aryabhattai
ref|WP_032099554.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   
ref|WP_040934518.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   
ref|WP_013058792.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  95.1    1e-19   Bacillus
ref|WP_003349182.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   
ref|WP_040189931.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Leuconostoc citreum
ref|WP_038541321.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Bacillus sp. X1(2014)
ref|WP_025750259.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Bacillus
ref|WP_013084737.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Bacillus megaterium
ref|WP_015739879.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Ammonifex degensii
ref|WP_007786918.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Brevibacillus sp. CF112
ref|WP_029281153.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   
ref|WP_018946838.1|  hypothetical protein                             95.1    1e-19   Thioalkalivibrio sp. AKL17
ref|WP_004903209.1|  tRNA dimethylallyltransferase                    95.1    1e-19   Leuconostoc citreum
ref|WP_004909098.1|  tRNA dimethylallyltransferase                    95.1    1e-19   Leuconostoc citreum
ref|WP_023614788.1|  hypothetical protein                             95.1    1e-19   Bacillus sp. 17376
ref|WP_035240320.1|  tRNA dimethylallyltransferase                    95.1    1e-19   
ref|WP_008907915.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Caloramator australicus
ref|WP_005835646.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  95.1    1e-19   Bacillales
ref|WP_025083957.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Lactobacillus fuchuensis
ref|WP_040176650.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    1e-19   Leuconostoc citreum
ref|WP_004905757.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    1e-19   Leuconostoc citreum
ref|WP_003385748.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Brevibacillus borstelensis
dbj|GAE91531.1|  tRNA dimethylallyltransferase                        91.7    1e-19   Gracilibacillus boraciitolerans JCM 21714
ref|WP_013842002.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    1e-19   Desulfotomaculum ruminis
gb|EPE61515.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    95.1    1e-19   Exiguobacterium sp. S17
ref|WP_024983805.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Brevibacillus borstelensis
ref|WP_008398174.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    1e-19   Clostridium sp. M62/1
emb|CBK77990.1|  tRNA isopentenyltransferase (miaA) [ [               95.1    2e-19   [Clostridium] cf. saccharolyticum K10
ref|WP_035386423.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Exiguobacterium sp. S17
ref|WP_021966577.1|  tRNA dimethylallyltransferase                    95.1    2e-19   
ref|WP_021067303.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Exiguobacterium chiriqhucha
gb|EKQ69151.1|  tRNA isopentenyltransferase MiaA                      95.1    2e-19   Oscillatoriales cyanobacterium JSC-12
ref|WP_026674201.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Bacillus bogoriensis
ref|WP_026010780.1|  hypothetical protein                             90.1    2e-19   
sp|O84771.2|MIAA_CHLTR  RecName: Full=tRNA dimethylallyltransfera...  94.7    2e-19   Chlamydia trachomatis D/UW-3/CX
ref|WP_022359507.1|  tRNA dimethylallyltransferase                    94.7    2e-19   
ref|XP_001780492.1|  predicted protein                                97.4    2e-19   
ref|WP_010725336.1|  tRNA dimethylallyltransferase                    94.7    2e-19   Chlamydia trachomatis
ref|WP_017753841.1|  hypothetical protein                             94.7    2e-19   Bacillus oryziterrae
ref|WP_007208821.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Enterococcus italicus
ref|WP_045425585.1|  hypothetical protein                             94.4    2e-19   
ref|WP_033829006.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Bacillus andreraoultii
ref|WP_012526372.1|  tRNA dimethylallyltransferase                    94.4    2e-19   Anaeromyxobacter sp. K
ref|WP_009873209.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Chlamydia trachomatis
ref|WP_032121610.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.4    2e-19   Clostridium amazonitimonense
dbj|GAO04651.1|  tRNA dimethylallyltransferase                        94.4    2e-19   Anaeromyxobacter sp. PSR-1
ref|WP_011324858.1|  tRNA dimethylallyltransferase                    94.7    2e-19   Chlamydia trachomatis
ref|WP_028394465.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.4    2e-19   Bacillus sp. FJAT-14578
ref|WP_012728187.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Chlamydia trachomatis
ref|WP_020967085.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Chlamydia trachomatis
ref|WP_009872146.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.7    2e-19   Chlamydia trachomatis
gb|AHC17631.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    94.4    2e-19   Chlamydia trachomatis C/TW-3
ref|WP_009872913.1|  tRNA dimethylallyltransferase                    94.4    2e-19   Chlamydia trachomatis
gb|EPD52638.1|  tRNA dimethylallyltransferase                         94.4    2e-19   Staphylococcus sp. HGB0015
ref|WP_006420153.1|  tRNA isopentenyltransferase                      94.4    2e-19   delta proteobacterium NaphS2
ref|WP_022291597.1|  tRNA dimethylallyltransferase                    94.4    2e-19   
ref|WP_024476792.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  94.4    2e-19   
gb|AGK53141.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    94.4    2e-19   Bacillus sp. 1NLA3E
ref|WP_021888294.1|  tRNA dimethylallyltransferase                    94.4    3e-19   
gb|EJG45039.1|  IPP transferase family protein                        92.0    3e-19   Streptococcus pneumoniae 2070335
ref|WP_016290860.1|  tRNA dimethylallyltransferase                    94.4    3e-19   Lachnospiraceae bacterium 28-4
ref|WP_027158038.1|  tRNA dimethylallyltransferase                    94.0    3e-19   Methylobacter luteus
ref|WP_005875719.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_040373168.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_012546758.1|  MULTISPECIES: tRNA dimethylallyltransferase      94.0    3e-19   
ref|WP_012575113.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
gb|ERS93145.1|  hypothetical protein SSIM_07630                       92.0    3e-19   
ref|WP_025846031.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_034777424.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_019021769.1|  hypothetical protein                             94.0    3e-19   
ref|WP_022351866.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
ref|WP_010044172.1|  tRNA isopentenyltransferase                      94.0    3e-19   
ref|WP_040205140.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  94.0    3e-19   
ref|WP_006318277.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_003398136.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_019589774.1|  MULTISPECIES: hypothetical protein               94.0    3e-19   
ref|WP_012633582.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
ref|WP_045592163.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_045616869.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    3e-19   
ref|WP_008826229.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_036068063.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    3e-19   
ref|WP_026487610.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_033169130.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_012159407.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
ref|WP_010892637.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
ref|WP_015949355.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
emb|CDZ80405.1|  tRNA dimethylallyltransferase                        94.0    3e-19   
ref|WP_044639771.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_028410865.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  94.0    3e-19   
ref|WP_004087674.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
ref|WP_035419876.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    3e-19   
ref|WP_000850209.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    3e-19   
ref|WP_038211447.1|  tRNA dimethylallyltransferase                    94.0    3e-19   
gb|KIA58924.1|  tRNA dimethylallyltransferase                         94.0    4e-19   
ref|WP_029462488.1|  hypothetical protein                             94.0    4e-19   
gb|ETD95403.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    93.6    4e-19   
ref|WP_024748970.1|  tRNA dimethylallyltransferase                    94.0    4e-19   
ref|WP_004085557.1|  tRNA dimethylallyltransferase                    94.0    4e-19   
gb|ETE01251.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    93.6    4e-19   
ref|WP_045476418.1|  tRNA dimethylallyltransferase                    94.0    4e-19   
ref|WP_031222742.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_015743927.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_027447909.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_010472008.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_034109791.1|  tRNA dimethylallyltransferase                    94.0    4e-19   
ref|WP_015010158.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_015749101.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_013974907.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_045530971.1|  tRNA dimethylallyltransferase                    94.0    4e-19   
ref|WP_028459364.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_040344264.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_014704974.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_031579827.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_036616297.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_026675797.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_015838519.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_022819784.1|  tRNA dimethylallyltransferase                    93.6    4e-19   
ref|WP_019119215.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_024370277.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_029335209.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_034804775.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_013102723.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    4e-19   
ref|WP_038357375.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  89.0    4e-19   
ref|WP_042356647.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_042456655.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.6    4e-19   
ref|WP_000850183.1|  hypothetical protein                             88.6    5e-19   
ref|WP_002827801.1|  transposase                                      93.6    5e-19   
ref|WP_011938667.1|  tRNA dimethylallyltransferase 2                  93.6    5e-19   
gb|KFE42815.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    93.6    5e-19   
ref|WP_014974687.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    5e-19   
ref|WP_028078029.1|  transposase                                      93.2    5e-19   
ref|WP_010753070.1|  tRNA dimethylallyltransferase                    93.2    5e-19   
ref|WP_012097100.1|  tRNA dimethylallyltransferase                    93.2    5e-19   
ref|WP_020468294.1|  hypothetical protein                             93.2    5e-19   
ref|WP_021094613.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  93.2    5e-19   
ref|WP_022434977.1|  tRNA dimethylallyltransferase                    93.2    5e-19   
gb|AGA34416.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    93.2    5e-19   
ref|WP_024328709.1|  tRNA dimethylallyltransferase                    93.2    5e-19   
ref|WP_019640996.1|  hypothetical protein                             93.2    5e-19   
ref|WP_008982373.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    5e-19   
ref|WP_017249236.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    5e-19   
ref|WP_027408788.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    5e-19   
ref|WP_033377435.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    5e-19   
pdb|2QGN|A  Chain A, Crystal Structure Of Trna Isopentenylpyropho...  93.2    5e-19   
ref|WP_039645958.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    5e-19   
ref|WP_042750922.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_045077957.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_012656802.1|  tRNA dimethylallyltransferase                    93.2    6e-19   
ref|WP_033678888.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_014094654.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_006524921.1|  transposase                                      93.2    6e-19   
ref|WP_027097866.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_000850201.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    6e-19   
ref|WP_019552986.1|  hypothetical protein                             93.2    6e-19   
ref|WP_021946503.1|  tRNA dimethylallyltransferase                    92.8    6e-19   
ref|WP_033679996.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    6e-19   
ref|WP_011420568.1|  tRNA dimethylallyltransferase                    92.8    6e-19   
ref|WP_020932243.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
gb|AGC04674.1|  tRNA-isopentenyltransferase                           95.1    6e-19   
ref|XP_003061927.1|  predicted protein                                93.2    6e-19   
ref|WP_021802075.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_021962032.1|  tRNA dimethylallyltransferase                    92.8    6e-19   
ref|WP_033655623.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  89.4    6e-19   
ref|WP_020162458.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
gb|ETE05712.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.8    6e-19   
gb|EMY89405.1|  hypothetical protein PNI0197_01823                    89.0    6e-19   
ref|WP_034672895.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_035436712.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    6e-19   
ref|WP_036817521.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_012583441.1|  tRNA dimethylallyltransferase                    93.2    7e-19   
ref|XP_001754594.1|  predicted protein                                95.1    7e-19   
ref|WP_034815305.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    7e-19   
ref|WP_029055425.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  93.2    7e-19   
ref|WP_000850198.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_033685347.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_033677656.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_000850178.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_004256128.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_024057898.1|  tRNA dimethylallyltransferase                    92.8    7e-19   
ref|WP_000850207.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_040880596.1|  hypothetical protein                             92.8    7e-19   
gb|EMY83131.1|  hypothetical protein PNI0212_02058                    89.0    7e-19   
ref|WP_016390008.1|  tRNA dimethylallyltransferase                    92.8    7e-19   
ref|WP_007719112.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_025209428.1|  hypothetical protein                             92.8    7e-19   
emb|CDQ35763.1|  tRNA dimethylallyltransferase                        92.8    7e-19   
gb|ETD98312.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.8    7e-19   
ref|WP_031237063.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_002597820.1|  tRNA dimethylallyltransferase                    92.8    7e-19   
ref|WP_045607269.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_022517462.1|  tRNA dimethylallyltransferase                    92.8    7e-19   
emb|CEY29232.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.8    7e-19   
ref|WP_001862725.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_015006359.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    7e-19   
ref|WP_020902452.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
ref|WP_000850191.1|  tRNA dimethylallyltransferase                    92.8    8e-19   
ref|WP_019378498.1|  hypothetical protein                             92.8    8e-19   
gb|EGL84868.1|  tRNA dimethylallyltransferase                         92.8    8e-19   
ref|WP_033631032.1|  tRNA dimethylallyltransferase                    92.8    8e-19   
ref|WP_000850190.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
ref|WP_011958038.1|  tRNA dimethylallyltransferase                    92.8    8e-19   
ref|WP_028491388.1|  tRNA dimethylallyltransferase                    92.8    8e-19   
ref|WP_042282692.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
ref|WP_032495850.1|  tRNA dimethylallyltransferase                    92.8    8e-19   
ref|WP_033686602.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
ref|WP_000850189.1|  tRNA dimethylallyltransferase                    92.8    8e-19   
ref|WP_038057067.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
emb|CEX84605.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.8    8e-19   
ref|WP_025490081.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
ref|WP_021633888.1|  tRNA dimethylallyltransferase                    92.8    8e-19   
gb|ETD96943.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.8    8e-19   
ref|WP_000850200.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    8e-19   
ref|WP_019591101.1|  hypothetical protein                             92.8    8e-19   
ref|WP_018870353.1|  hypothetical protein                             92.8    8e-19   
ref|WP_007083877.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
ref|WP_026520647.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    8e-19   
emb|CEV71369.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.4    8e-19   
ref|WP_000850199.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    8e-19   
ref|WP_019569610.1|  hypothetical protein                             92.8    8e-19   
ref|WP_000850187.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    8e-19   
ref|WP_039359474.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    9e-19   
ref|WP_031227725.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_000850197.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_021774291.1|  tRNA dimethylallyltransferase                    92.8    9e-19   
emb|CEX46133.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.4    9e-19   
ref|WP_000850184.1|  tRNA dimethylallyltransferase                    92.4    9e-19   
gb|KIC71336.1|  tRNA dimethylallyltransferase                         92.8    9e-19   
ref|WP_024478087.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_001863870.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_000850212.1|  tRNA dimethylallyltransferase                    92.4    9e-19   
ref|WP_010151127.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_026518943.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
emb|CEW34061.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.4    9e-19   
ref|WP_000850206.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_045479122.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
gb|ACO19658.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    9e-19   
gb|EDK79857.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    9e-19   
emb|CEY51383.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.4    9e-19   
ref|WP_010976455.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_033681586.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_000850192.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
dbj|GAF63564.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.4    9e-19   
ref|WP_006099226.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_026512298.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
gb|ACB89880.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    9e-19   
ref|WP_024864741.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_000850188.1|  tRNA dimethylallyltransferase                    92.4    9e-19   
ref|WP_000850186.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_028315231.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_022312491.1|  tRNA dimethylallyltransferase                    92.8    9e-19   
ref|WP_011175793.1|  tRNA dimethylallyltransferase                    92.8    9e-19   
ref|WP_000850193.1|  tRNA dimethylallyltransferase                    92.4    9e-19   
ref|WP_000850185.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_000850196.1|  tRNA dimethylallyltransferase                    92.4    9e-19   
ref|WP_027422784.1|  hypothetical protein                             92.4    9e-19   
ref|WP_016398766.1|  tRNA dimethylallyltransferase                    92.4    9e-19   
ref|XP_005643818.1|  isopentenyl transferase                          92.4    9e-19   
ref|WP_000850194.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    9e-19   
ref|WP_020156152.1|  hypothetical protein                             92.4    9e-19   
gb|EDK73571.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    9e-19   
ref|WP_042901278.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_016397964.1|  tRNA dimethylallyltransferase                    92.4    1e-18   
ref|WP_044788789.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_013537259.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
gb|EDK76617.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    1e-18   
gb|EDK66670.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    1e-18   
ref|WP_022090530.1|  tRNA dimethylallyltransferase                    92.4    1e-18   
ref|WP_026767567.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_026760298.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_026692392.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_000850195.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_021828623.1|  MULTISPECIES: tRNA dimethylallyltransferase      92.4    1e-18   
ref|WP_019391928.1|  hypothetical protein                             92.4    1e-18   
ref|XP_001782787.1|  predicted protein                                95.1    1e-18   
ref|WP_044745316.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
gb|ACO15914.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    92.4    1e-18   
ref|WP_037354415.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_010334332.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_006340845.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.8    1e-18   
ref|WP_041274572.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  92.4    1e-18   
ref|WP_012164789.1|  tRNA dimethylallyltransferase                    92.4    1e-18   
gb|KIA77950.1|  tRNA dimethylallyltransferase                         92.8    1e-18   
dbj|BAL56921.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   92.4    1e-18   



>ref|XP_011082747.1| PREDICTED: tRNA dimethylallyltransferase 9 [Sesamum indicum]
Length=464

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  25   GGVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPT  204
            GG+RMSCLR    AE PL+R  +  +  R   RLF+TSCSA+     G+++KV+VISGPT
Sbjct  8    GGLRMSCLRLPYAAEAPLVRPSFQPSRLRRRSRLFSTSCSAAAPRKKGERQKVVVISGPT  67

Query  205  GAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGI  384
            GAGKS+LALELAKRLNGEI+SADSVQVYRGLDIGSAKPS SER+EVPHHL+DILHPSE  
Sbjct  68   GAGKSRLALELAKRLNGEIVSADSVQVYRGLDIGSAKPSFSERQEVPHHLVDILHPSEEY  127

Query  385  AI  390
            ++
Sbjct  128  SV  129



>ref|XP_010279080.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Nelumbo 
nucifera]
Length=370

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R   LR   TAE PL R P  L+F R  RR  AT C+   K    KKEKV+VISGPTG
Sbjct  6    GLRAWGLRLVSTAERPLPRCP-TLSFSR--RRTLATCCTLDLKQ-KRKKEKVLVISGPTG  61

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            AGKS+LALELAKRLNGEIISADSVQVYRGLDIGSAKPSLS+RKEVPHHL+DILHPSE  +
Sbjct  62   AGKSRLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSDRKEVPHHLVDILHPSEEYS  121

Query  388  I  390
            +
Sbjct  122  V  122



>ref|XP_010279079.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Nelumbo 
nucifera]
Length=455

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R   LR   TAE PL R P  L+F R  RR  AT C+   K    KKEKV+VISGPTG
Sbjct  6    GLRAWGLRLVSTAERPLPRCP-TLSFSR--RRTLATCCTLDLKQ-KRKKEKVLVISGPTG  61

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            AGKS+LALELAKRLNGEIISADSVQVYRGLDIGSAKPSLS+RKEVPHHL+DILHPSE  +
Sbjct  62   AGKSRLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSDRKEVPHHLVDILHPSEEYS  121

Query  388  I  390
            +
Sbjct  122  V  122



>ref|XP_002283012.1| PREDICTED: tRNA dimethylallyltransferase 9 [Vitis vinifera]
Length=447

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 94/125 (75%), Gaps = 7/125 (6%)
 Frame = +1

Query  19   LSGGVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSAS-TKPVAGKKEKVIVIS  195
            +S GV    LR     E PLLR P    F    RRLF T+CS S TK     KEKVIVIS
Sbjct  1    MSWGV--CSLRSLYAPEMPLLRSP--PFFFVRSRRLFGTTCSVSGTK--KKNKEKVIVIS  54

Query  196  GPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPS  375
            GPTGAGKS+LALELAKRLNGEIISADSVQVYRGLD+GSAKPSL +RKEVPHHL+DILHPS
Sbjct  55   GPTGAGKSRLALELAKRLNGEIISADSVQVYRGLDVGSAKPSLMDRKEVPHHLVDILHPS  114

Query  376  EGIAI  390
            E  ++
Sbjct  115  EDYSV  119



>emb|CBI20214.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 87/107 (81%), Gaps = 5/107 (5%)
 Frame = +1

Query  73   PLLRGPYGLTFHRGGRRLFATSCSAS-TKPVAGKKEKVIVISGPTGAGKSKLALELAKRL  249
            PLLR P    F    RRLF T+CS S TK     KEKVIVISGPTGAGKS+LALELAKRL
Sbjct  2    PLLRSP--PFFFVRSRRLFGTTCSVSGTK--KKNKEKVIVISGPTGAGKSRLALELAKRL  57

Query  250  NGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            NGEIISADSVQVYRGLD+GSAKPSL +RKEVPHHL+DILHPSE  ++
Sbjct  58   NGEIISADSVQVYRGLDVGSAKPSLMDRKEVPHHLVDILHPSEDYSV  104



>ref|XP_004137218.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Cucumis 
sativus]
 gb|KGN53595.1| hypothetical protein Csa_4G083690 [Cucumis sativus]
Length=482

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 97/131 (74%), Gaps = 7/131 (5%)
 Frame = +1

Query  10   NQMLSGGVR---MSCLRFRCTAETPLLRGPYGLTFHRGG-RRLFATSCSASTKPVAGKKE  177
            ++M + GVR     CLR     E PL   P  +++ R   RRLFAT CSA+  P   +K 
Sbjct  13   SRMFNNGVRSLHTCCLRSPFAVERPL---PQSISYRRTRCRRLFATFCSAAAIPNKERKS  69

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            KVIVISGPTG+GKS+LA+ELAKRLNGEIISADSVQVY+GLDIGSAKPS  +RKEVPHHLI
Sbjct  70   KVIVISGPTGSGKSRLAMELAKRLNGEIISADSVQVYQGLDIGSAKPSARDRKEVPHHLI  129

Query  358  DILHPSEGIAI  390
            DIL PS+  ++
Sbjct  130  DILRPSDEYSV  140



>ref|XP_006451736.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
 gb|ESR64976.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
Length=460

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = +1

Query  67   ETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKR  246
            E PLLR      F R  RRLFATSCS ++     KKEKVIVISGPTGAGKS+LALELAKR
Sbjct  18   EKPLLR-----QFARR-RRLFATSCSVAS----SKKEKVIVISGPTGAGKSRLALELAKR  67

Query  247  LNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            LNGEIISADSVQVYRGLDIGSAKPS S+RKEVPHHLIDILHP E  ++
Sbjct  68   LNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSV  115



>gb|KDO48345.1| hypothetical protein CISIN_1g012837mg [Citrus sinensis]
Length=430

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = +1

Query  67   ETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKR  246
            E PLLR      F R  RRLFATSCS ++     KKEKVIVISGPTGAGKS+LALELAKR
Sbjct  18   EKPLLR-----QFARR-RRLFATSCSVAS----SKKEKVIVISGPTGAGKSQLALELAKR  67

Query  247  LNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            LNGEIISADSVQVYRGLDIGSAKPS S+RKEVPHHLIDILHP E  ++
Sbjct  68   LNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSV  115



>ref|XP_008451715.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Cucumis 
melo]
Length=482

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 98/131 (75%), Gaps = 7/131 (5%)
 Frame = +1

Query  10   NQMLSGGVR---MSCLRFRCTAETPLLRGPYGLTFHRGG-RRLFATSCSASTKPVAGKKE  177
            ++ML  G+R     CLR     E PLL+    +++ R   RRLFAT CSA+  P   +K 
Sbjct  13   SRMLDNGIRSLHTCCLRSPFAPERPLLQS---ISYRRTRCRRLFATFCSAAPTPNKERKS  69

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            KVIVISGPTG+GKS+LA+ELAKRLNGEIISADSVQVY+GLDIGSAKPS  +RKEVPHHLI
Sbjct  70   KVIVISGPTGSGKSRLAMELAKRLNGEIISADSVQVYQGLDIGSAKPSARDRKEVPHHLI  129

Query  358  DILHPSEGIAI  390
            DIL PS+  ++
Sbjct  130  DILRPSDEYSV  140



>ref|XP_012078558.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Jatropha 
curcas]
Length=431

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 92/121 (76%), Gaps = 9/121 (7%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R  CLRF   +  P  R       HR  R LFAT+ + S  PVA KKEKVIVISGPTG
Sbjct  8    GLRSRCLRFFLPSPIPPPR-------HRSCR-LFATTTTCSF-PVASKKEKVIVISGPTG  58

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            AGKS+LALELAKRLNGEIISADSVQVYRGLD+GSAKP  SERKEVPHHLIDIL PSE  +
Sbjct  59   AGKSRLALELAKRLNGEIISADSVQVYRGLDVGSAKPLPSERKEVPHHLIDILDPSEDYS  118

Query  388  I  390
            +
Sbjct  119  V  119



>ref|XP_006451735.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
 gb|ESR64975.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
Length=456

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = +1

Query  67   ETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKR  246
            E PLLR      F R  RRLFATSCS ++     KKEKVIVISGPTGAGKS+LALELAKR
Sbjct  18   EKPLLR-----QFARR-RRLFATSCSVAS----SKKEKVIVISGPTGAGKSRLALELAKR  67

Query  247  LNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            LNGEIISADSVQVYRGLDIGSAKPS S+RKEVPHHLIDILHP E  ++
Sbjct  68   LNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSV  115



>ref|XP_006451734.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
 gb|ESR64974.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
Length=455

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = +1

Query  67   ETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKR  246
            E PLLR      F R  RRLFATSCS ++     KKEKVIVISGPTGAGKS+LALELAKR
Sbjct  18   EKPLLR-----QFARR-RRLFATSCSVAS----SKKEKVIVISGPTGAGKSRLALELAKR  67

Query  247  LNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            LNGEIISADSVQVYRGLDIGSAKPS S+RKEVPHHLIDILHP E  ++
Sbjct  68   LNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSV  115



>ref|XP_006485669.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Citrus sinensis]
Length=455

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = +1

Query  67   ETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKR  246
            E PLLR      F R  RRLFATSCS ++     KKEKVIVISGPTGAGKS+LALELAKR
Sbjct  18   EKPLLR-----QFARR-RRLFATSCSVAS----SKKEKVIVISGPTGAGKSRLALELAKR  67

Query  247  LNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            LNGEIISADSVQVYRGLDIGSAKPS S+RKEVPHHLIDILHP E  ++
Sbjct  68   LNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSV  115



>gb|KDO48344.1| hypothetical protein CISIN_1g012837mg [Citrus sinensis]
Length=455

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = +1

Query  67   ETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKR  246
            E PLLR      F R  RRLFATSCS ++     KKEKVIVISGPTGAGKS+LALELAKR
Sbjct  18   EKPLLR-----QFARR-RRLFATSCSVAS----SKKEKVIVISGPTGAGKSQLALELAKR  67

Query  247  LNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            LNGEIISADSVQVYRGLDIGSAKPS S+RKEVPHHLIDILHP E  ++
Sbjct  68   LNGEIISADSVQVYRGLDIGSAKPSSSDRKEVPHHLIDILHPCEDYSV  115



>ref|XP_012078557.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Jatropha 
curcas]
 gb|KDP32503.1| hypothetical protein JCGZ_14706 [Jatropha curcas]
Length=455

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 92/121 (76%), Gaps = 9/121 (7%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R  CLRF   +  P  R       HR  R LFAT+ + S  PVA KKEKVIVISGPTG
Sbjct  8    GLRSRCLRFFLPSPIPPPR-------HRSCR-LFATTTTCSF-PVASKKEKVIVISGPTG  58

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            AGKS+LALELAKRLNGEIISADSVQVYRGLD+GSAKP  SERKEVPHHLIDIL PSE  +
Sbjct  59   AGKSRLALELAKRLNGEIISADSVQVYRGLDVGSAKPLPSERKEVPHHLIDILDPSEDYS  118

Query  388  I  390
            +
Sbjct  119  V  119



>gb|EYU45007.1| hypothetical protein MIMGU_mgv1a0264151mg, partial [Erythranthe 
guttata]
Length=134

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  124  LFATSCSASTKPV-AGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLD  300
            LFAT+CSA+  P   G+++KVIVISGPTGAGKS+L+LELAKRLNGEIISADSVQVY+GLD
Sbjct  1    LFATTCSAAPPPKRKGERQKVIVISGPTGAGKSRLSLELAKRLNGEIISADSVQVYKGLD  60

Query  301  IGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            IGSAKPS+ ER+EVPHHL+DILHPSE  ++
Sbjct  61   IGSAKPSIDERQEVPHHLVDILHPSEDYSV  90



>ref|XP_004251888.1| PREDICTED: tRNA dimethylallyltransferase 9 [Solanum lycopersicum]
Length=449

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 93/124 (75%), Gaps = 18/124 (15%)
 Frame = +1

Query  22   SGGVRMSC-LRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISG  198
            +GGVR+S  LR   T ET L R           RRLF TSCSAS+      KEKVIVISG
Sbjct  7    TGGVRISSYLRLPYTVETLLRR-----------RRLF-TSCSASST-----KEKVIVISG  49

Query  199  PTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSE  378
            PTGAGKSKLALELAKR+NGEIISADSVQVYRGLD+GSAKPS  ERKEV HHL+DILHPSE
Sbjct  50   PTGAGKSKLALELAKRINGEIISADSVQVYRGLDVGSAKPSFDERKEVVHHLVDILHPSE  109

Query  379  GIAI  390
              ++
Sbjct  110  DYSV  113



>ref|XP_006358949.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X2 [Solanum 
tuberosum]
Length=368

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 92/124 (74%), Gaps = 17/124 (14%)
 Frame = +1

Query  22   SGGVRMSCLRFRCTAETPLLRGPYGL-TFHRGGRRLFATSCSASTKPVAGKKEKVIVISG  198
            +GGVR+S            LR PY + T  R   RLF TSCSAS+      KEKVIVISG
Sbjct  7    TGGVRIS----------SYLRLPYTVETLLRRRCRLF-TSCSASST-----KEKVIVISG  50

Query  199  PTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSE  378
            PTGAGKSKLALELAKRLNGEIISADSVQVYRGLD+GSAKPS  ERKEV HHL+DILHPSE
Sbjct  51   PTGAGKSKLALELAKRLNGEIISADSVQVYRGLDVGSAKPSFDERKEVVHHLVDILHPSE  110

Query  379  GIAI  390
              ++
Sbjct  111  DYSV  114



>ref|XP_008386239.1| PREDICTED: tRNA dimethylallyltransferase 9 [Malus domestica]
Length=465

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   SGGVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGP  201
            S  VR  C R   +++  +LR    LTF    RRL  T+CS S      +KEKVIV+SGP
Sbjct  5    SSCVRTFCPRLPSSSKKHVLRTAGLLTFTLRRRRL-TTACSVSATK-NKEKEKVIVVSGP  62

Query  202  TGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEG  381
            TG+GK++LALELAKRLNGEIISADSVQVYRGLDIGSAKPSLS+R+EVPHHL+DILHPSE 
Sbjct  63   TGSGKTRLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSDRQEVPHHLVDILHPSED  122

Query  382  IAI  390
             ++
Sbjct  123  YSV  125



>ref|XP_006358948.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X1 [Solanum 
tuberosum]
Length=450

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 92/124 (74%), Gaps = 17/124 (14%)
 Frame = +1

Query  22   SGGVRMSC-LRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISG  198
            +GGVR+S  LR   T ET L R            RLF TSCSAS+      KEKVIVISG
Sbjct  7    TGGVRISSYLRLPYTVETLLRRRC----------RLF-TSCSASST-----KEKVIVISG  50

Query  199  PTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSE  378
            PTGAGKSKLALELAKRLNGEIISADSVQVYRGLD+GSAKPS  ERKEV HHL+DILHPSE
Sbjct  51   PTGAGKSKLALELAKRLNGEIISADSVQVYRGLDVGSAKPSFDERKEVVHHLVDILHPSE  110

Query  379  GIAI  390
              ++
Sbjct  111  DYSV  114



>ref|XP_009760198.1| PREDICTED: tRNA dimethylallyltransferase 9 [Nicotiana sylvestris]
Length=463

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 97/124 (78%), Gaps = 8/124 (6%)
 Frame = +1

Query  22   SGGVRMSC-LRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISG  198
            +GGVR+S  LR   TAETPLL     + F R   R F TSCSAS+      K+KVIVISG
Sbjct  7    TGGVRISSYLRLPYTAETPLLLP--NVLFFRRCSRRFFTSCSASST-----KQKVIVISG  59

Query  199  PTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSE  378
            PTGAGKSKLALELAKRLNGEIISADS+QVYRGLD+GSAKPS+ ER+EV HHL+DILHPSE
Sbjct  60   PTGAGKSKLALELAKRLNGEIISADSIQVYRGLDVGSAKPSIHEREEVVHHLVDILHPSE  119

Query  379  GIAI  390
              ++
Sbjct  120  DYSV  123



>ref|XP_009587099.1| PREDICTED: tRNA dimethylallyltransferase 9 [Nicotiana tomentosiformis]
Length=463

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 97/124 (78%), Gaps = 8/124 (6%)
 Frame = +1

Query  22   SGGVRMSC-LRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISG  198
            +GGVR+S  LR   TAETPLL     + F R   R F TSCSAS+      K+KVIVISG
Sbjct  7    TGGVRISSYLRLSYTAETPLLLP--NVLFFRRCSRRFFTSCSASST-----KQKVIVISG  59

Query  199  PTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSE  378
            PTGAGKSKLALELAK+LNGEIISADSVQVYRGLD+GSAKPS+ ER+EV HHL+DILHPSE
Sbjct  60   PTGAGKSKLALELAKQLNGEIISADSVQVYRGLDVGSAKPSIREREEVVHHLVDILHPSE  119

Query  379  GIAI  390
              ++
Sbjct  120  DYSV  123



>ref|XP_009340250.1| PREDICTED: tRNA dimethylallyltransferase 9 [Pyrus x bretschneideri]
Length=465

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   SGGVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGP  201
            S  VR    R   +++  + R    LTF    RRL  T+CS S      +KEKVIV+SGP
Sbjct  5    SSCVRTFYPRLPSSSKKRVFRTAELLTFTLRRRRL-TTACSVSATK-NKEKEKVIVVSGP  62

Query  202  TGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEG  381
            TG+GKS+LALELAKRLNGEIISADSVQVYRGLDIGSAKPSLS+R+EVPHHL+DILHPSE 
Sbjct  63   TGSGKSRLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSDRQEVPHHLVDILHPSED  122

Query  382  IAI  390
             ++
Sbjct  123  YSV  125



>ref|XP_002300421.2| hypothetical protein POPTR_0001s38570g [Populus trichocarpa]
 gb|EEE85226.2| hypothetical protein POPTR_0001s38570g [Populus trichocarpa]
Length=445

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 93/121 (77%), Gaps = 10/121 (8%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R  CL F       LLR     +F R GR+ FAT+ + S  PV  KKEK+IVISGPTG
Sbjct  8    GLRTRCLHF-------LLRSS-SSSFCRHGRQ-FATTTTCSI-PVPNKKEKLIVISGPTG  57

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            +GK++LALELAKRLNGEI+SADSVQVYRGLD+GSAKP+ SERKEV HHL+DILHPSE  +
Sbjct  58   SGKTRLALELAKRLNGEIVSADSVQVYRGLDVGSAKPTESERKEVRHHLLDILHPSEDYS  117

Query  388  I  390
            +
Sbjct  118  V  118



>ref|XP_008226503.1| PREDICTED: tRNA dimethylallyltransferase 9 [Prunus mume]
Length=456

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   SGGVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGP  201
            S  VR  C R   +++   LR    +TF    RRL +T+CS S    + +KEKVIV+SGP
Sbjct  5    SSCVRTFCPRLPSSSKKRALRTAALVTFTIRRRRL-STACSVSATK-SKEKEKVIVVSGP  62

Query  202  TGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEG  381
            TGAGKS+LALELAKRLNGEIISADSVQVYRGLDIGSAKPS  +R+EVPHHL+DILHPSE 
Sbjct  63   TGAGKSRLALELAKRLNGEIISADSVQVYRGLDIGSAKPSPGDRQEVPHHLVDILHPSED  122

Query  382  IAI  390
             ++
Sbjct  123  YSV  125



>ref|XP_004294141.2| PREDICTED: tRNA dimethylallyltransferase 9 [Fragaria vesca subsp. 
vesca]
Length=463

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 90/125 (72%), Gaps = 3/125 (2%)
 Frame = +1

Query  16   MLSGGVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVIS  195
            ++S  VR    RF  ++E  LLR     TF    R   AT CS S      KKEKVIV+S
Sbjct  2    IISSSVRTCFPRFPSSSEKRLLRSAVKFTFTPRWRPS-ATFCSVSA--TQKKKEKVIVVS  58

Query  196  GPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPS  375
            GPTGAGKS+LALELAK LNGEIISADSVQVY+GLDIGSAKPS  +RKEVPHHL+DILHPS
Sbjct  59   GPTGAGKSRLALELAKLLNGEIISADSVQVYQGLDIGSAKPSPGDRKEVPHHLVDILHPS  118

Query  376  EGIAI  390
            E  ++
Sbjct  119  EDYSV  123



>ref|XP_007213909.1| hypothetical protein PRUPE_ppa005482mg [Prunus persica]
 gb|EMJ15108.1| hypothetical protein PRUPE_ppa005482mg [Prunus persica]
Length=458

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +1

Query  22   SGGVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGP  201
            S  VR  C R   +++   LR    +TF    RRL +T+CS S    + +KEKVIV+SGP
Sbjct  5    SSCVRTFCPRLPSSSKKRALRTAALVTFTIRRRRL-STACSVSATK-SKEKEKVIVVSGP  62

Query  202  TGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEG  381
            TGAGKS+LA ELAKRLNGEIISADSVQVYRGLDIGSAKPS  +R+EVPHHL+DILHPSE 
Sbjct  63   TGAGKSRLAFELAKRLNGEIISADSVQVYRGLDIGSAKPSPGDRQEVPHHLVDILHPSED  122

Query  382  IAI  390
             ++
Sbjct  123  YSV  125



>ref|XP_011006723.1| PREDICTED: tRNA dimethylallyltransferase 9 [Populus euphratica]
 ref|XP_011006725.1| PREDICTED: tRNA dimethylallyltransferase 9 [Populus euphratica]
 ref|XP_011006726.1| PREDICTED: tRNA dimethylallyltransferase 9 [Populus euphratica]
Length=445

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 93/121 (77%), Gaps = 10/121 (8%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R  CL F       LLR     +F R GR+ FAT+ + S  PV  KK+K+IVISGPTG
Sbjct  8    GLRTRCLHF-------LLRSS-SSSFCRHGRQ-FATTTTCSI-PVPKKKDKLIVISGPTG  57

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            +GK++LALELAKRLNGEI+SADSVQVYRGLD+GSAKP+ SERKEV HHL+DILHPSE  +
Sbjct  58   SGKTRLALELAKRLNGEIVSADSVQVYRGLDVGSAKPTESERKEVRHHLVDILHPSEDYS  117

Query  388  I  390
            +
Sbjct  118  V  118



>ref|XP_010108266.1| tRNA dimethylallyltransferase 9 [Morus notabilis]
 gb|EXC18506.1| tRNA dimethylallyltransferase 9 [Morus notabilis]
Length=444

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            RRLFAT CSA+      +KEKV+VISGPTGAGK++LALELAK LNGEIISADSVQVYRGL
Sbjct  25   RRLFATKCSAAGPTRKKEKEKVVVISGPTGAGKTRLALELAKLLNGEIISADSVQVYRGL  84

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            D+GSAKPS S+RK VPHHLIDILHPSE  ++
Sbjct  85   DVGSAKPSPSDRKVVPHHLIDILHPSEEYSV  115



>gb|KJB61645.1| hypothetical protein B456_009G372500 [Gossypium raimondii]
Length=447

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +1

Query  109  RGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVY  288
            R GR+   TS ++ +  V  KKEKVIVISGPTGAGK++LALELAKRLNGEIISADSVQVY
Sbjct  24   RNGRKTLVTSSTSVS--VNQKKEKVIVISGPTGAGKTRLALELAKRLNGEIISADSVQVY  81

Query  289  RGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            RGLD+GSAKPS S+R+EVPHHLIDILHPSE  ++
Sbjct  82   RGLDVGSAKPSPSDRQEVPHHLIDILHPSEDYSV  115



>gb|KJB61644.1| hypothetical protein B456_009G372500 [Gossypium raimondii]
Length=446

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +1

Query  109  RGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVY  288
            R GR+   TS ++ +  V  KKEKVIVISGPTGAGK++LALELAKRLNGEIISADSVQVY
Sbjct  24   RNGRKTLVTSSTSVS--VNQKKEKVIVISGPTGAGKTRLALELAKRLNGEIISADSVQVY  81

Query  289  RGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            RGLD+GSAKPS S+R+EVPHHLIDILHPSE  ++
Sbjct  82   RGLDVGSAKPSPSDRQEVPHHLIDILHPSEDYSV  115



>emb|CDY45111.1| BnaA02g04650D [Brassica napus]
Length=220

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 80/95 (84%), Gaps = 4/95 (4%)
 Frame = +1

Query  118  RRLF---ATSCSASTK-PVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQV  285
            RR F   AT+CS S       +KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQV
Sbjct  26   RRRFSGAATTCSVSLNGKRNSEKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQV  85

Query  286  YRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            Y+GLD+GSAKPS S+RKEVPHHLIDILHPS+  ++
Sbjct  86   YKGLDVGSAKPSASDRKEVPHHLIDILHPSQDYSV  120



>ref|XP_003543220.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X1 [Glycine 
max]
 gb|KHN36873.1| tRNA dimethylallyltransferase 9 [Glycine soja]
Length=448

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 92/127 (72%), Gaps = 13/127 (10%)
 Frame = +1

Query  16   MLSGGV--RMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIV  189
            M+S GV    +CLRF      PL R P  L      R+ F  + S + K     KEKVIV
Sbjct  1    MISNGVCTLRTCLRF---PARPLFREPPRLF---SCRQRFLVTASETKK-----KEKVIV  49

Query  190  ISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILH  369
            ISGPTG+GKS+LALELAKRLNGEI+SADSVQVYRGLD+GSAKPS +ERKEVPHHL+DILH
Sbjct  50   ISGPTGSGKSRLALELAKRLNGEIVSADSVQVYRGLDVGSAKPSPNERKEVPHHLVDILH  109

Query  370  PSEGIAI  390
            PSE  ++
Sbjct  110  PSEDYSV  116



>ref|XP_008451716.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Cucumis 
melo]
Length=479

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 95/131 (73%), Gaps = 10/131 (8%)
 Frame = +1

Query  10   NQMLSGGVR---MSCLRFRCTAETPLLRGPYGLTFHRGG-RRLFATSCSASTKPVAGKKE  177
            ++ML  G+R     CLR     E PLL+    +++ R   RRLFAT CSA+  P   +K 
Sbjct  13   SRMLDNGIRSLHTCCLRSPFAPERPLLQS---ISYRRTRCRRLFATFCSAAPTPNKERKS  69

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            KVIVISGPTG+GKS+LA+ELAKRLNGEIISADSVQ   GLDIGSAKPS  +RKEVPHHLI
Sbjct  70   KVIVISGPTGSGKSRLAMELAKRLNGEIISADSVQ---GLDIGSAKPSARDRKEVPHHLI  126

Query  358  DILHPSEGIAI  390
            DIL PS+  ++
Sbjct  127  DILRPSDEYSV  137



>gb|KEH38634.1| tRNA dimethylallyltransferase [Medicago truncatula]
Length=449

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 14/128 (11%)
 Frame = +1

Query  16   MLSGGVR--MSCLRFRCTAETPLLRG-PYGLTFHRGGRRLFATSCSASTKPVAGKKEKVI  186
            M++ GV    +CLR     E P+ R  P    F    RR F  + S + K    KKEKVI
Sbjct  1    MINNGVHSLRTCLRL---PEHPIFRATPLSYNF----RRRFFVTASLTEK----KKEKVI  49

Query  187  VISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDIL  366
            VISGPTG+GKS+LA+ELAK +NGEI+SADSVQVY+GLD+GSAKPSL++RKEVPHHL+DIL
Sbjct  50   VISGPTGSGKSRLAMELAKSINGEIVSADSVQVYKGLDVGSAKPSLNDRKEVPHHLVDIL  109

Query  367  HPSEGIAI  390
            HPSE  ++
Sbjct  110  HPSEDYSV  117



>ref|XP_006400569.1| hypothetical protein EUTSA_v10013462mg [Eutrema salsugineum]
 gb|ESQ42022.1| hypothetical protein EUTSA_v10013462mg [Eutrema salsugineum]
Length=466

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 80/99 (81%), Gaps = 8/99 (8%)
 Frame = +1

Query  118  RRLF--ATSCSASTKPVAGK------KEKVIVISGPTGAGKSKLALELAKRLNGEIISAD  273
            RR F  AT+CS S      K      KEKVIVISGPTGAGKS+LALELAKRLNGEIISAD
Sbjct  25   RRRFCGATACSVSLNGTTSKNKKSSGKEKVIVISGPTGAGKSRLALELAKRLNGEIISAD  84

Query  274  SVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            SVQVYRGLD+GSAKPS S+RKEVPHHLIDILHPS+  ++
Sbjct  85   SVQVYRGLDVGSAKPSASDRKEVPHHLIDILHPSQDYSV  123



>gb|KHG00135.1| tRNA dimethylallyltransferase 9 -like protein [Gossypium arboreum]
Length=446

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 2/93 (2%)
 Frame = +1

Query  112  GGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYR  291
             GR+   TS ++ +  V  KKEKVIVISGPTGAGK++LALELAKRLNGEIISADSVQVYR
Sbjct  25   NGRKTLVTSSTSVS--VNQKKEKVIVISGPTGAGKTRLALELAKRLNGEIISADSVQVYR  82

Query  292  GLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            GLD+GSAKPS ++R+EVPHHLIDILHPSE  ++
Sbjct  83   GLDVGSAKPSPADRQEVPHHLIDILHPSEDYSV  115



>ref|XP_010520596.1| PREDICTED: tRNA dimethylallyltransferase 9 [Tarenaya hassleriana]
Length=462

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 80/99 (81%), Gaps = 8/99 (8%)
 Frame = +1

Query  118  RRLF--ATSCSASTKPVAGK------KEKVIVISGPTGAGKSKLALELAKRLNGEIISAD  273
            RR F  AT+CS S      K      KEKVIVISGPTGAGKS+LA+ELAKRLNGEIISAD
Sbjct  25   RRRFCGATACSVSMNEAGSKRTKKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISAD  84

Query  274  SVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            SVQVY+GLD+GSAKPS S+RKEVPHHLIDILHPS+  ++
Sbjct  85   SVQVYQGLDVGSAKPSASDRKEVPHHLIDILHPSQDYSV  123



>emb|CDX70907.1| BnaC03g09910D [Brassica napus]
Length=463

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 86/117 (74%), Gaps = 9/117 (8%)
 Frame = +1

Query  61   TAETPLLR-GPYGLTFHRGGRRLFATSCS------ASTKPVAGKKEKVIVISGPTGAGKS  219
            TA T  LR  P  L   R  R   AT+CS       S K     KEKVIVISGPTGAGKS
Sbjct  10   TARTCCLRLQPPSLVLRR--RLCGATACSVSLNGNTSNKKRNSDKEKVIVISGPTGAGKS  67

Query  220  KLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            +LALELAKRLNGEIISADSVQVY+GLD+GSAKPS S+RKEVPHHLIDILHPS+  ++
Sbjct  68   RLALELAKRLNGEIISADSVQVYKGLDVGSAKPSASDRKEVPHHLIDILHPSQDYSV  124



>emb|CDX88863.1| BnaA03g07860D [Brassica napus]
Length=463

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 7/98 (7%)
 Frame = +1

Query  118  RRLF-ATSCS------ASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADS  276
            RRL  AT+CS       S K    +KEKVIVISGPTGAGKS+LALELAKRLNGEIISADS
Sbjct  27   RRLCGATACSVSLNGNTSNKKRNSEKEKVIVISGPTGAGKSRLALELAKRLNGEIISADS  86

Query  277  VQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            VQVY+GLD+GSAKPS S+RKEVPHHLIDILHPS+  ++
Sbjct  87   VQVYKGLDVGSAKPSASDRKEVPHHLIDILHPSQDYSV  124



>ref|XP_007149408.1| hypothetical protein PHAVU_005G067800g [Phaseolus vulgaris]
 gb|ESW21402.1| hypothetical protein PHAVU_005G067800g [Phaseolus vulgaris]
Length=445

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 89/127 (70%), Gaps = 13/127 (10%)
 Frame = +1

Query  16   MLSGGV--RMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIV  189
            M++ GV    +C RF    E  L R P    F    RR F  + S   K     KEKVIV
Sbjct  1    MINNGVCTLRTCFRF---PERSLFR-PRQCLF--TSRRQFLVTASERKK-----KEKVIV  49

Query  190  ISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILH  369
            ISGPTG+GKS+LALELAKRLNGEI+SADSVQVYRGLD+GSAKPS  ERKEVPHHL+DILH
Sbjct  50   ISGPTGSGKSRLALELAKRLNGEIVSADSVQVYRGLDVGSAKPSPDERKEVPHHLVDILH  109

Query  370  PSEGIAI  390
            PSE  ++
Sbjct  110  PSEDYSV  116



>ref|XP_010941327.1| PREDICTED: tRNA dimethylallyltransferase 9 [Elaeis guineensis]
Length=470

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            R    TSCSA+ +    KK KVIVISGPTGAGKS+LALE+AKRL+GEIISADSVQVYRGL
Sbjct  49   RNNLTTSCSAADQ---NKKSKVIVISGPTGAGKSRLALEIAKRLDGEIISADSVQVYRGL  105

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            DIGSAKPS+++R+EVPHHLIDILHPSE  +
Sbjct  106  DIGSAKPSVTDRREVPHHLIDILHPSEDYS  135



>ref|XP_002524264.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF38103.1| ATP binding protein, putative [Ricinus communis]
Length=446

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 7/92 (8%)
 Frame = +1

Query  118  RRLFATS-CSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRG  294
            RRLFAT+ CSA+      K+EKV+VISGPTGAGKS+LALELAKRLNGEIISADSVQVYRG
Sbjct  27   RRLFATTTCSAT------KREKVLVISGPTGAGKSRLALELAKRLNGEIISADSVQVYRG  80

Query  295  LDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            LD+GSAKPS +ERKEV HHLID+ HPSE  ++
Sbjct  81   LDVGSAKPSPTERKEVRHHLIDVSHPSEDYSV  112



>ref|XP_009131765.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Brassica rapa]
Length=463

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 7/98 (7%)
 Frame = +1

Query  118  RRLF-ATSCS------ASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADS  276
            RRL  AT+CS       S K     KEKVIVISGPTGAGKS+LALELAKRLNGEIISADS
Sbjct  27   RRLCGATACSVSLNGNTSNKKRNSDKEKVIVISGPTGAGKSRLALELAKRLNGEIISADS  86

Query  277  VQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            VQVY+GLD+GSAKPS S+RKEVPHHLIDILHPS+  ++
Sbjct  87   VQVYKGLDVGSAKPSASDRKEVPHHLIDILHPSQDYSV  124



>ref|XP_004489048.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Cicer arietinum]
Length=448

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 12/118 (10%)
 Frame = +1

Query  40   SCLRFRCTAETPLLRG-PYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGK  216
            +CLR     E  + R  P    F    RR F  + S + K    KKEKVIVISGPTG+GK
Sbjct  10   TCLRL---PEQSIFRSTPLSFRF----RRRFLVTASLTEK----KKEKVIVISGPTGSGK  58

Query  217  SKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            S+LA+ELAK LNGEI+SADSVQVYRGLD+GSAKPSL++RKEVPHHL+DILHP+E  ++
Sbjct  59   SRLAMELAKHLNGEIVSADSVQVYRGLDVGSAKPSLNDRKEVPHHLVDILHPTEDYSV  116



>ref|XP_010454297.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Camelina 
sativa]
Length=462

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 79/96 (82%), Gaps = 5/96 (5%)
 Frame = +1

Query  118  RRLF--ATSCSAS---TKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQ  282
            RR F  AT+CS     T     +KEKVIVISGPTGAGKS+LA+ELAKRLNGEIISADSVQ
Sbjct  25   RRSFCGATACSVPMNGTNKRKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSVQ  84

Query  283  VYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            VYRGLDIGSAKPS  +RKEVPHHLIDILHPSE  ++
Sbjct  85   VYRGLDIGSAKPSDRDRKEVPHHLIDILHPSEEYSV  120



>ref|XP_010420834.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X1 [Camelina 
sativa]
Length=462

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 79/96 (82%), Gaps = 5/96 (5%)
 Frame = +1

Query  118  RRLF--ATSCSAS---TKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQ  282
            RR F  AT+CS     T     +KEKVIVISGPTGAGKS+LA+ELAKRLNGEIISADSVQ
Sbjct  25   RRSFCGATACSVPMNGTNKRKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSVQ  84

Query  283  VYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            VYRGLDIGSAKPS  +RKEVPHHLIDILHPSE  ++
Sbjct  85   VYRGLDIGSAKPSDRDRKEVPHHLIDILHPSEEYSV  120



>ref|XP_007021670.1| Isopentenyltransferase 9 isoform 2 [Theobroma cacao]
 gb|EOY13195.1| Isopentenyltransferase 9 isoform 2 [Theobroma cacao]
Length=336

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KKEKVIVISGPTGAGKS+LALELAKRLNGEIISADSVQVY+GLD+GSAKPS S+RKEVPH
Sbjct  46   KKEKVIVISGPTGAGKSRLALELAKRLNGEIISADSVQVYQGLDVGSAKPSSSDRKEVPH  105

Query  349  HLIDILHPSEGIAI  390
            HLIDILHPSE  ++
Sbjct  106  HLIDILHPSEDYSV  119



>ref|XP_010493096.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Camelina 
sativa]
Length=462

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 79/96 (82%), Gaps = 5/96 (5%)
 Frame = +1

Query  118  RRLF--ATSCSA---STKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQ  282
            RR F  AT+CS     T     +KEKVIVISGPTGAGKS+LA+ELAKRLNGEIISADSVQ
Sbjct  25   RRSFCGATACSVPMNGTNKRKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSVQ  84

Query  283  VYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            VYRGLDIGSAKPS  +RKEVPHHLIDILHPSE  ++
Sbjct  85   VYRGLDIGSAKPSDRDRKEVPHHLIDILHPSEEYSV  120



>ref|XP_007021669.1| Isopentenyltransferase 9 isoform 1 [Theobroma cacao]
 gb|EOY13194.1| Isopentenyltransferase 9 isoform 1 [Theobroma cacao]
Length=449

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KKEKVIVISGPTGAGKS+LALELAKRLNGEIISADSVQVY+GLD+GSAKPS S+RKEVPH
Sbjct  46   KKEKVIVISGPTGAGKSRLALELAKRLNGEIISADSVQVYQGLDVGSAKPSSSDRKEVPH  105

Query  349  HLIDILHPSEGIAI  390
            HLIDILHPSE  ++
Sbjct  106  HLIDILHPSEDYSV  119



>ref|XP_010060664.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010060665.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Eucalyptus 
grandis]
Length=499

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R  CLR   +   PLLR      +    R   A + +A     AG K+KVIVISGPTG
Sbjct  40   GLRTCCLRPLRSPIEPLLRRSTRSRWPPRRRSSSAAAPAACFASSAGAKQKVIVISGPTG  99

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            AGKS+LALELAKRLNGEIISADSVQVYRGLD+GSAKPSL +RKEV HHL+DILHPSE  +
Sbjct  100  AGKSRLALELAKRLNGEIISADSVQVYRGLDVGSAKPSLRDRKEVQHHLVDILHPSEDYS  159

Query  388  I  390
            +
Sbjct  160  V  160



>ref|XP_010060666.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Eucalyptus 
grandis]
Length=498

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R  CLR   +   PLLR      +    R   A + +A     AG K+KVIVISGPTG
Sbjct  40   GLRTCCLRPLRSPIEPLLRRSTRSRWPPRRRSSSAAAPAACFASSAGAKQKVIVISGPTG  99

Query  208  AGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            AGKS+LALELAKRLNGEIISADSVQVYRGLD+GSAKPSL +RKEV HHL+DILHPSE  +
Sbjct  100  AGKSRLALELAKRLNGEIISADSVQVYRGLDVGSAKPSLRDRKEVQHHLVDILHPSEDYS  159

Query  388  I  390
            +
Sbjct  160  V  160



>gb|KFK26250.1| hypothetical protein AALP_AA8G222700 [Arabis alpina]
Length=458

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            RR      ++S    + KKEKVIVISGPTGAGKS+LALELAK LNGEIISADSVQVYRGL
Sbjct  25   RRRLCGVTASSVGTSSKKKEKVIVISGPTGAGKSRLALELAKSLNGEIISADSVQVYRGL  84

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            D+GSAKPS S+RKEVPHHLIDILHPS+  ++
Sbjct  85   DVGSAKPSASDRKEVPHHLIDILHPSQDYSV  115



>gb|EPS66580.1| hypothetical protein M569_08195, partial [Genlisea aurea]
Length=387

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 6/91 (7%)
 Frame = +1

Query  124  LFATS-CSA-STKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            LFAT+ CSA +T P    K+KV+VISGPTGAGKS+LALE+AKRLNGEI+SADSVQVYRGL
Sbjct  1    LFATTACSAEATDP----KKKVLVISGPTGAGKSRLALEIAKRLNGEIVSADSVQVYRGL  56

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            DIGSAKPSL +R+EVPHHLIDILHP+E  ++
Sbjct  57   DIGSAKPSLLDRQEVPHHLIDILHPAEEYSV  87



>ref|XP_006287693.1| hypothetical protein CARUB_v10000903mg [Capsella rubella]
 gb|EOA20591.1| hypothetical protein CARUB_v10000903mg [Capsella rubella]
Length=463

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 6/97 (6%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAG------KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSV  279
            RR F +     + P+ G      +KEKVIVISGPTGAGKS+LA+ELAKRLNGEI+SADSV
Sbjct  25   RRSFCSRTMTCSVPMNGTKKRKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIVSADSV  84

Query  280  QVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            QVY+GLDIGSAKPS  +RKEVPHHLIDILHPSE  ++
Sbjct  85   QVYKGLDIGSAKPSDRDRKEVPHHLIDILHPSEDYSV  121



>ref|XP_002873979.1| ATIPT9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50238.1| ATIPT9 [Arabidopsis lyrata subsp. lyrata]
Length=463

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 6/97 (6%)
 Frame = +1

Query  118  RRLF---ATSCSAS---TKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSV  279
            RR F    T CS     TK    +KEKVIVISGPTGAGKS+LA+ELAKRLNGEIISADSV
Sbjct  25   RRRFCAATTDCSVPLNGTKKRKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSV  84

Query  280  QVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            QVYRGLD+GSAKPS S+RK VPHHLIDILHPS+  ++
Sbjct  85   QVYRGLDVGSAKPSDSDRKVVPHHLIDILHPSQDYSV  121



>ref|XP_009126411.1| PREDICTED: tRNA dimethylallyltransferase 9 [Brassica rapa]
Length=464

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 4/95 (4%)
 Frame = +1

Query  118  RRLF---ATSCSASTK-PVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQV  285
            RR F   AT+CS S       +KEKVIVISG TGAGKSKLALELAKRLNGEIISADSVQV
Sbjct  26   RRRFSGAATTCSVSLNGKRNSEKEKVIVISGTTGAGKSKLALELAKRLNGEIISADSVQV  85

Query  286  YRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            Y+GLD+GSAKPS ++RKEV HHLIDILHPS+  ++
Sbjct  86   YKGLDVGSAKPSATDRKEVAHHLIDILHPSQDYSV  120



>emb|CDP05986.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 97/122 (80%), Gaps = 4/122 (3%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPL-LRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPT  204
            GVRMSCL     A TPL L       FHR   RLF+TSCS+S+     K+EKVIVISGPT
Sbjct  6    GVRMSCLLLPYLAGTPLHLPCFRPFHFHRRIGRLFSTSCSSSS---VDKREKVIVISGPT  62

Query  205  GAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGI  384
            GAGKSKLALELAK LNGEIISADSVQVY+GLD+GSAKPSLSERKEVPHHLIDILHPSE  
Sbjct  63   GAGKSKLALELAKLLNGEIISADSVQVYQGLDVGSAKPSLSERKEVPHHLIDILHPSEDY  122

Query  385  AI  390
            ++
Sbjct  123  SV  124



>ref|XP_008811471.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Phoenix 
dactylifera]
Length=492

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            R    TSCSA+ +    KK KVIVISGPTGAGKS+LALE+AK+L+GEIISADSVQVY  L
Sbjct  50   RNSLTTSCSAADQ---NKKSKVIVISGPTGAGKSRLALEIAKKLDGEIISADSVQVYCAL  106

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            DIGSAKPS+++R+EVPHHLID LHPSE  +
Sbjct  107  DIGSAKPSVTDRREVPHHLIDTLHPSEDYS  136



>ref|XP_008811477.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Phoenix 
dactylifera]
Length=490

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            R    TSCSA+ +    KK KVIVISGPTGAGKS+LALE+AK+L+GEIISADSVQVY  L
Sbjct  48   RNSLTTSCSAADQ---NKKSKVIVISGPTGAGKSRLALEIAKKLDGEIISADSVQVYCAL  104

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            DIGSAKPS+++R+EVPHHLID LHPSE  +
Sbjct  105  DIGSAKPSVTDRREVPHHLIDTLHPSEDYS  134



>ref|XP_008811509.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X6 [Phoenix 
dactylifera]
Length=471

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            R    TSCSA+ +    KK KVIVISGPTGAGKS+LALE+AK+L+GEIISADSVQVY  L
Sbjct  50   RNSLTTSCSAADQ---NKKSKVIVISGPTGAGKSRLALEIAKKLDGEIISADSVQVYCAL  106

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            DIGSAKPS+++R+EVPHHLID LHPSE  +
Sbjct  107  DIGSAKPSVTDRREVPHHLIDTLHPSEDYS  136



>ref|XP_008811501.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X5 [Phoenix 
dactylifera]
Length=473

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            R    TSCSA+ +    KK KVIVISGPTGAGKS+LALE+AK+L+GEIISADSVQVY  L
Sbjct  50   RNSLTTSCSAADQ---NKKSKVIVISGPTGAGKSRLALEIAKKLDGEIISADSVQVYCAL  106

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            DIGSAKPS+++R+EVPHHLID LHPSE  +
Sbjct  107  DIGSAKPSVTDRREVPHHLIDTLHPSEDYS  136



>ref|XP_008811491.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X4 [Phoenix 
dactylifera]
Length=476

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            R    TSCSA+ +    KK KVIVISGPTGAGKS+LALE+AK+L+GEIISADSVQVY  L
Sbjct  50   RNSLTTSCSAADQ---NKKSKVIVISGPTGAGKSRLALEIAKKLDGEIISADSVQVYCAL  106

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            DIGSAKPS+++R+EVPHHLID LHPSE  +
Sbjct  107  DIGSAKPSVTDRREVPHHLIDTLHPSEDYS  136



>ref|XP_008811484.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X3 [Phoenix 
dactylifera]
Length=479

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGL  297
            R    TSCSA+ +    KK KVIVISGPTGAGKS+LALE+AK+L+GEIISADSVQVY  L
Sbjct  50   RNSLTTSCSAADQ---NKKSKVIVISGPTGAGKSRLALEIAKKLDGEIISADSVQVYCAL  106

Query  298  DIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            DIGSAKPS+++R+EVPHHLID LHPSE  +
Sbjct  107  DIGSAKPSVTDRREVPHHLIDTLHPSEDYS  136



>ref|NP_568390.2| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
 dbj|BAB59048.1| tRNA isopentenyltransferase [Arabidopsis thaliana]
 gb|AED92783.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
Length=459

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 6/97 (6%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEK------VIVISGPTGAGKSKLALELAKRLNGEIISADSV  279
            RR F  + +A + P+ G K+K      VIVISGPTGAGKS+LA+ELAKRLNGEIISADSV
Sbjct  25   RRRFCAATTACSVPLNGNKKKKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSV  84

Query  280  QVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            QVY+GLD+GSAKPS S+RK VPHHLIDILHPS+  ++
Sbjct  85   QVYKGLDVGSAKPSDSDRKVVPHHLIDILHPSQDYSV  121



>ref|NP_001190344.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
 gb|AED92784.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
Length=469

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 6/97 (6%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEK------VIVISGPTGAGKSKLALELAKRLNGEIISADSV  279
            RR F  + +A + P+ G K+K      VIVISGPTGAGKS+LA+ELAKRLNGEIISADSV
Sbjct  25   RRRFCAATTACSVPLNGNKKKKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSV  84

Query  280  QVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            QVY+GLD+GSAKPS S+RK VPHHLIDILHPS+  ++
Sbjct  85   QVYKGLDVGSAKPSDSDRKVVPHHLIDILHPSQDYSV  121



>ref|XP_010675404.1| PREDICTED: tRNA dimethylallyltransferase 9 [Beta vulgaris subsp. 
vulgaris]
Length=446

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            VIVISGPTGAGKS+LALELAKRLNGEIISADSVQVYRGLD+GSAKPS S+RKE+PHHL+D
Sbjct  52   VIVISGPTGAGKSRLALELAKRLNGEIISADSVQVYRGLDVGSAKPSPSDRKEIPHHLLD  111

Query  361  ILHPSEGIAI  390
            ILHPSE  ++
Sbjct  112  ILHPSEEYSV  121



>ref|NP_851043.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
 sp|Q9C5J6.1|IPT9_ARATH RecName: Full=tRNA dimethylallyltransferase 9; AltName: Full=Isopentenyl-diphosphate: 
tRNA isopentenyltransferase 9; Short=AtIPT9; 
Short=IPP transferase 9; Short=IPPT 9 [Arabidopsis 
thaliana]
 gb|AAK25918.1|AF360208_1 putative IPP transferase [Arabidopsis thaliana]
 gb|AAK64114.1| putative IPP transferase [Arabidopsis thaliana]
 gb|AED92782.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
Length=463

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 6/97 (6%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEK------VIVISGPTGAGKSKLALELAKRLNGEIISADSV  279
            RR F  + +A + P+ G K+K      VIVISGPTGAGKS+LA+ELAKRLNGEIISADSV
Sbjct  25   RRRFCAATTACSVPLNGNKKKKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSV  84

Query  280  QVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            QVY+GLD+GSAKPS S+RK VPHHLIDILHPS+  ++
Sbjct  85   QVYKGLDVGSAKPSDSDRKVVPHHLIDILHPSQDYSV  121



>gb|AAM63091.1| IPP transferase-like protein [Arabidopsis thaliana]
Length=463

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 6/97 (6%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKKEK------VIVISGPTGAGKSKLALELAKRLNGEIISADSV  279
            RR F  + +A + P+ G K+K      VIVISGPTGAGKS+LA+ELAKRLNGEIISADSV
Sbjct  25   RRRFCAATTACSVPLNGNKKKKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSV  84

Query  280  QVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            QVY+GLD+GSAKPS S+RK VPHHLIDILHPS+  ++
Sbjct  85   QVYKGLDVGSAKPSDSDRKVVPHHLIDILHPSQDYSL  121



>gb|KCW67467.1| hypothetical protein EUGRSUZ_F01210 [Eucalyptus grandis]
Length=498

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 87/135 (64%), Gaps = 17/135 (13%)
 Frame = +1

Query  28   GVRMSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTG  207
            G+R  CLR   +   PLLR      +    R   A + +A     AG K+KVIVISGPTG
Sbjct  9    GLRTCCLRPLRSPIEPLLRRSTRSRWPPRRRSSSAAAPAACFASSAGAKQKVIVISGPTG  68

Query  208  AGKSKLALELAKRLNGEIISADSVQ-----------------VYRGLDIGSAKPSLSERK  336
            AGKS+LALELAKRLNGEIISADSVQ                 VYRGLD+GSAKPSL +RK
Sbjct  69   AGKSRLALELAKRLNGEIISADSVQVFGCFALFCSFEFIAARVYRGLDVGSAKPSLRDRK  128

Query  337  EVPHHLIDILHPSEG  381
            EV HHL+DILHPSEG
Sbjct  129  EVQHHLVDILHPSEG  143



>ref|NP_001058651.2| Os06g0729800 [Oryza sativa Japonica Group]
 dbj|BAE47453.1| prokaryotic tRNA isopentenyltransferase [Oryza sativa Japonica 
Group]
 gb|EAZ02440.1| hypothetical protein OsI_24543 [Oryza sativa Indica Group]
 gb|EEE66431.1| hypothetical protein OsJ_22787 [Oryza sativa Japonica Group]
 dbj|BAF20565.2| Os06g0729800 [Oryza sativa Japonica Group]
Length=417

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +1

Query  112  GGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYR  291
            G RR      S S    A  K KVIVISGPTGAGK++LAL+LAKRL+GEIISADSVQVYR
Sbjct  4    GCRRPAVWKRSWSPAAAAATKNKVIVISGPTGAGKTRLALDLAKRLSGEIISADSVQVYR  63

Query  292  GLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            GLD+GSAKPS S+R  VPHHLIDILH S+  +
Sbjct  64   GLDVGSAKPSSSDRAAVPHHLIDILHASDDYS  95



>dbj|BAD62118.1| putative tRNA isopentenyltransferase [Oryza sativa Japonica Group]
Length=487

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +1

Query  112  GGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYR  291
            G RR      S S    A  K KVIVISGPTGAGK++LAL+LAKRL+GEIISADSVQVYR
Sbjct  74   GCRRPAVWKRSWSPAAAAATKNKVIVISGPTGAGKTRLALDLAKRLSGEIISADSVQVYR  133

Query  292  GLDIGSAKPSLSERKEVPHHLIDILHPSEGIA  387
            GLD+GSAKPS S+R  VPHHLIDILH S+  +
Sbjct  134  GLDVGSAKPSSSDRAAVPHHLIDILHASDDYS  165



>ref|XP_009394407.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394416.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394424.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = +1

Query  136  SCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAK  315
            +CS S    + KK +VIVISGPTGAGKS+LALELAK L+GEI+SADSVQVYRGLD+GSAK
Sbjct  26   TCSVSG---STKKNRVIVISGPTGAGKSRLALELAKALDGEIVSADSVQVYRGLDVGSAK  82

Query  316  PSLSERKEVPHHLIDILHPSEGIA  387
            PS  +R EVPHHLIDIL PS+  +
Sbjct  83   PSTWDRNEVPHHLIDILQPSDDYS  106



>ref|XP_009394389.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394398.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = +1

Query  136  SCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAK  315
            +CS S    + KK +VIVISGPTGAGKS+LALELAK L+GEI+SADSVQVYRGLD+GSAK
Sbjct  51   TCSVSG---STKKNRVIVISGPTGAGKSRLALELAKALDGEIVSADSVQVYRGLDVGSAK  107

Query  316  PSLSERKEVPHHLIDILHPSEGIA  387
            PS  +R EVPHHLIDIL PS+  +
Sbjct  108  PSTWDRNEVPHHLIDILQPSDDYS  131



>ref|XP_006852479.1| PREDICTED: tRNA dimethylallyltransferase 9 [Amborella trichopoda]
 gb|ERN13946.1| hypothetical protein AMTR_s00021p00131420 [Amborella trichopoda]
Length=497

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K++VI+ISGPTGAGK++LALELAK LNG+IISADSVQVY+GLD+GSAKPS S+RKEVPHH
Sbjct  63   KKRVIIISGPTGAGKTRLALELAKELNGQIISADSVQVYQGLDVGSAKPSPSDRKEVPHH  122

Query  352  LIDILHPSEGIAI  390
            L+DIL PSE  ++
Sbjct  123  LLDILDPSEDYSV  135



>gb|EMT06411.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Aegilops 
tauschii]
Length=450

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  157  PVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERK  336
            P A KK KVIVISGPTGAGKS+LALE+A+RL GEIISADSVQVYR LD+GSAKPS SE  
Sbjct  51   PKARKKSKVIVISGPTGAGKSRLALEVARRLGGEIISADSVQVYRSLDVGSAKPSASEMS  110

Query  337  EVPHHLIDILHPSE  378
             VPHHLIDI+H  E
Sbjct  111  MVPHHLIDIMHACE  124



>emb|CAN83244.1| hypothetical protein VITISV_000817 [Vitis vinifera]
Length=563

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 71/89 (80%), Gaps = 5/89 (6%)
 Frame = +1

Query  73   PLLRGPYGLTFHRGGRRLFATSCSAS-TKPVAGKKEKVIVISGPTGAGKSKLALELAKRL  249
            PLLR P    F    RRLF T+CS S TK     KEKVIVISGPTGAGKS+LALELAKRL
Sbjct  2    PLLRSPP--FFFVRSRRLFGTTCSVSGTKK--KNKEKVIVISGPTGAGKSRLALELAKRL  57

Query  250  NGEIISADSVQVYRGLDIGSAKPSLSERK  336
            NGEIISADSVQVYRGLD+GSAKPSL +RK
Sbjct  58   NGEIISADSVQVYRGLDVGSAKPSLMDRK  86



>gb|EMS61041.1| tRNA dimethylallyltransferase 9 [Triticum urartu]
Length=449

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SASTKPVAG--KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAK  315
            +A+T P+A   KK KVIVISGPTGAGKS+LALE+A+RL GEIISADSVQVYR LD+GSAK
Sbjct  43   TATTLPLADVRKKSKVIVISGPTGAGKSRLALEVARRLGGEIISADSVQVYRSLDVGSAK  102

Query  316  PSLSERKEVPHHLIDILH  369
            PS SE   VPHHLIDI+H
Sbjct  103  PSASEMSMVPHHLIDIMH  120



>ref|XP_006656524.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Oryza brachyantha]
Length=418

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 2/87 (2%)
 Frame = +1

Query  127  FATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIG  306
             ++S +AS  P +  K KVIVISGPTGAGK++LAL+LAKRL+GEIISADSVQVYR LD+G
Sbjct  15   LSSSAAASLPPTS--KNKVIVISGPTGAGKTRLALDLAKRLSGEIISADSVQVYRSLDVG  72

Query  307  SAKPSLSERKEVPHHLIDILHPSEGIA  387
            SAKPS S+R  VPH LIDILH SE  +
Sbjct  73   SAKPSPSQRAAVPHRLIDILHASEDYS  99



>dbj|BAJ89736.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 70/89 (79%), Gaps = 5/89 (6%)
 Frame = +1

Query  127  FATSCS--ASTKPV---AGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYR  291
            FA+S    A+T P    A K+ KVIVISGPTGAGKS+LALE+A+RL GEIISADSVQVYR
Sbjct  35   FASSLDVMAATMPAPNQARKRSKVIVISGPTGAGKSRLALEVARRLGGEIISADSVQVYR  94

Query  292  GLDIGSAKPSLSERKEVPHHLIDILHPSE  378
             LD+GSAKPS SE   VPHHLIDI+H  E
Sbjct  95   SLDVGSAKPSASEMSMVPHHLIDIMHACE  123



>ref|XP_004963310.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Setaria italica]
Length=450

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK+ VIVISGPTGAGKS+LALE+AKRL GEIISADSVQVYRGLDIGSAKPS +E   VPH
Sbjct  56   KKDTVIVISGPTGAGKSRLALEVAKRLGGEIISADSVQVYRGLDIGSAKPSAAEMDAVPH  115

Query  349  HLIDILHPSEGIA  387
            HLIDIL  ++  +
Sbjct  116  HLIDILDTTDDYS  128



>ref|XP_003563223.2| PREDICTED: tRNA dimethylallyltransferase 9 [Brachypodium distachyon]
Length=451

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +1

Query  142  SASTKPVAG---KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSA  312
            +AS  P  G    + KVIVISGPTGAGKS+LALE+A+RL GEIISADSVQVYR LDIGSA
Sbjct  44   TASLPPTRGAERNRSKVIVISGPTGAGKSRLALEVARRLGGEIISADSVQVYRSLDIGSA  103

Query  313  KPSLSERKEVPHHLIDILHPSE  378
            KPS  E   VPHHLIDI+H SE
Sbjct  104  KPSALEMNMVPHHLIDIMHASE  125



>gb|ERN20129.1| hypothetical protein AMTR_s00066p00067810 [Amborella trichopoda]
Length=124

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +1

Query  37   MSCLRFRCTAETPLLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGK  216
            +SC R     +    R  YG      G+ +  TS           K+ VI ISGP GAGK
Sbjct  8    LSCPRIAGPLKFQKRRWDYGY-----GKTIGLTSVRCFYSYAKNGKKCVIFISGPIGAGK  62

Query  217  SKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILHPSEGIAI  390
            +KLALEL K LNG+IISADSVQVYRGLD+GSA PS S R EVPHH++ IL PSE  ++
Sbjct  63   TKLALELGKELNGQIISADSVQVYRGLDVGSATPSPSNRNEVPHHMLHILDPSEDYSV  120



>ref|XP_002463348.1| hypothetical protein SORBIDRAFT_02g042160 [Sorghum bicolor]
 gb|EER99869.1| hypothetical protein SORBIDRAFT_02g042160 [Sorghum bicolor]
Length=389

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            VIVISGPTGAGKS+LALE+A+RL GEIISADSVQVYRGLD+GSAKPS +E   VPHHLID
Sbjct  2    VIVISGPTGAGKSRLALEVARRLGGEIISADSVQVYRGLDVGSAKPSATEMGMVPHHLID  61

Query  361  ILHPSEGIAI  390
            ILH S+  ++
Sbjct  62   ILHASDDYSV  71



>ref|NP_001127753.1| isopentenyl transferase [Zea mays]
 gb|ACF17570.1| isopentenyl transferase [Zea mays]
Length=441

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK+ VIVISGPTGAGKS+LALE+A+RL GEIISADSVQVYRGLD+GSAKPS +E   VPH
Sbjct  46   KKDTVIVISGPTGAGKSRLALEVARRLGGEIISADSVQVYRGLDVGSAKPSAAEMSLVPH  105

Query  349  HLIDILHPSE  378
            HLIDIL  S+
Sbjct  106  HLIDILDTSD  115



>ref|XP_008647277.1| PREDICTED: isopentenyl transferase isoform X1 [Zea mays]
 gb|AFW75691.1| isopentenyl transferase [Zea mays]
Length=453

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK+ VIVISGPTGAGKS+LALE+A+RL GEIISADSVQVYRGLD+GSAKPS +E   VPH
Sbjct  58   KKDTVIVISGPTGAGKSRLALEVARRLGGEIISADSVQVYRGLDVGSAKPSAAEMSLVPH  117

Query  349  HLIDILHPSE  378
            HLIDIL  S+
Sbjct  118  HLIDILDTSD  127



>ref|XP_002437643.1| hypothetical protein SORBIDRAFT_10g031125 [Sorghum bicolor]
 gb|EER89010.1| hypothetical protein SORBIDRAFT_10g031125, partial [Sorghum bicolor]
Length=403

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK+ VIVISGPTGAGKS+LALE+A+RL GEI+SADSVQVYRGLD+GSAKPS  E   VPH
Sbjct  10   KKDTVIVISGPTGAGKSRLALEVARRLGGEIVSADSVQVYRGLDVGSAKPSAQEMSLVPH  69

Query  349  HLIDILHPSE  378
            HLIDIL  S+
Sbjct  70   HLIDILDTSD  79



>dbj|BAG68561.1| isopentenyl transferase [Physcomitrella patens]
Length=426

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            V G+K +V++I+GPTG GKS+LAL LAKRL GEIISADSVQVYR LD+GSAK  + ER+ 
Sbjct  11   VRGRKGRVVIIAGPTGVGKSRLALALAKRLRGEIISADSVQVYRTLDVGSAKTPVDEREG  70

Query  340  VPHHLIDILHPSE  378
            +PHHLIDI+ PS+
Sbjct  71   IPHHLIDIVDPSQ  83



>ref|XP_001767747.1| predicted protein [Physcomitrella patens]
 gb|EDQ67498.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            V G+K +V++I+GPTG GKS+LAL LAKRL GEIISADSVQVYR LD+GSAK  + ER+ 
Sbjct  142  VRGRKGRVVIIAGPTGVGKSRLALALAKRLRGEIISADSVQVYRTLDVGSAKTPVDEREG  201

Query  340  VPHHLIDILHPSEG  381
            +PHHLIDI+ PS+G
Sbjct  202  IPHHLIDIVDPSQG  215



>ref|XP_002985201.1| hypothetical protein SELMODRAFT_424359 [Selaginella moellendorffii]
 gb|EFJ13695.1| hypothetical protein SELMODRAFT_424359 [Selaginella moellendorffii]
Length=426

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +  +VIVISGPT  GKS+LAL LA+RLNGEI+SADSVQVYRGLD+GSAK  L ER+ VPH
Sbjct  10   RARRVIVISGPTAVGKSRLALALAQRLNGEIVSADSVQVYRGLDVGSAKTPLEEREGVPH  69

Query  349  HLIDILHPSE  378
            HL+DI+ P++
Sbjct  70   HLLDIVDPTD  79



>ref|XP_002970127.1| hypothetical protein SELMODRAFT_410898 [Selaginella moellendorffii]
 gb|EFJ29251.1| hypothetical protein SELMODRAFT_410898 [Selaginella moellendorffii]
Length=434

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +  +VIVISGPT  GKS+LAL LA+RLNGEI+SADSVQVYRGLD+GSAK  L ER+ VPH
Sbjct  10   RARRVIVISGPTAVGKSRLALALAQRLNGEIVSADSVQVYRGLDVGSAKTPLEEREGVPH  69

Query  349  HLIDILHPSE  378
            HL+DI+ P++
Sbjct  70   HLLDIVDPTD  79



>gb|ABP88738.1| tRNA-isopentenyltransferase [Physcomitrella patens]
Length=557

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            V G+K +V++I+GPTG GKS+LAL LAKRL GEIISADSVQVYR LD+GSAK  + ER+ 
Sbjct  142  VRGRKGRVVIIAGPTGVGKSRLALALAKRLRGEIISADSVQVYRTLDVGSAKTPVDEREG  201

Query  340  VPHHLIDILHPSE  378
            +PHHLIDI+ PS+
Sbjct  202  IPHHLIDIVDPSQ  214



>ref|XP_005708069.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
 gb|EME31549.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
Length=422

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K KVIVISGPTG GK+++++ELAK LNGEIISADSVQVYR LD+GS KPS+ ER  + HH
Sbjct  62   KPKVIVISGPTGVGKTRISIELAKLLNGEIISADSVQVYRKLDVGSNKPSIEERNGIVHH  121

Query  352  LIDILHPS  375
            LIDI+ P+
Sbjct  122  LIDIVEPT  129



>ref|XP_005708068.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
 gb|EME31548.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
Length=453

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K KVIVISGPTG GK+++++ELAK LNGEIISADSVQVYR LD+GS KPS+ ER  + HH
Sbjct  62   KPKVIVISGPTGVGKTRISIELAKLLNGEIISADSVQVYRKLDVGSNKPSIEERNGIVHH  121

Query  352  LIDILHPS  375
            LIDI+ P+
Sbjct  122  LIDIVEPT  129



>ref|XP_005702563.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
 gb|EME26043.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
Length=369

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K KVIVISGPTG GK+++++ELAK LNGEIISADSVQVYR LD+GS KPS+ ER  + HH
Sbjct  9    KPKVIVISGPTGVGKTRISIELAKLLNGEIISADSVQVYRKLDVGSNKPSIEERNGIVHH  68

Query  352  LIDILHPS  375
            LIDI+ P+
Sbjct  69   LIDIVEPT  76



>ref|XP_005702562.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
 gb|EME26042.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
Length=400

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K KVIVISGPTG GK+++++ELAK LNGEIISADSVQVYR LD+GS KPS+ ER  + HH
Sbjct  9    KPKVIVISGPTGVGKTRISIELAKLLNGEIISADSVQVYRKLDVGSNKPSIEERNGIVHH  68

Query  352  LIDILHPS  375
            LIDI+ P+
Sbjct  69   LIDIVEPT  76



>ref|WP_035254811.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [Desulfatiglans 
anilini]
Length=290

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            ++ KVIVI+GPT  GK+ LA+ELA+RL+ E+++ADS+QVYRG+DIG+AKPSLSER  VPH
Sbjct  4    ERSKVIVIAGPTAGGKTALAVELAQRLDAEVVNADSMQVYRGMDIGTAKPSLSERAGVPH  63

Query  349  HLIDILHPSE  378
            HL+D++ P +
Sbjct  64   HLLDVVDPDQ  73



>ref|WP_022416972.1| tRNA dimethylallyltransferase [Eubacterium sp. CAG:841]
 emb|CDE18762.1| tRNA dimethylallyltransferase [Eubacterium sp. CAG:841]
Length=310

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
             +K+I I+GPT +GKS LALEL KRLNGE++S DS+Q+YRGLDIG+AKPS +E+ EV HH
Sbjct  2    NDKIIAIAGPTASGKSALALELCKRLNGELVSFDSMQIYRGLDIGTAKPSKAEQAEVRHH  61

Query  352  LIDILHPSEGIA  387
            LIDI  PSE  +
Sbjct  62   LIDICDPSESFS  73



>ref|XP_005539056.1| tRNA isopentenyltransferase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83020.1| tRNA isopentenyltransferase [Cyanidioschyzon merolae strain 10D]
Length=500

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  163  AGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEV  342
            A ++  V+VI+GPT  GKS+LA ELA RLNGEIISADSVQVYRGLDIG+ KPS  ER  +
Sbjct  63   AQRRPMVVVIAGPTAVGKSQLAHELAARLNGEIISADSVQVYRGLDIGANKPSALERSLI  122

Query  343  PHHLIDILHPS  375
            P+HL+DIL PS
Sbjct  123  PYHLVDILEPS  133



>ref|WP_018673937.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
laterosporus]
Length=317

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KE ++VI+GPT  GK+ L+L LA++ NGEIIS DS+QVYRG+DIG+AK S  ER  VPH
Sbjct  3    QKENLVVIAGPTAVGKTALSLRLAQQFNGEIISGDSMQVYRGMDIGTAKASEEERATVPH  62

Query  349  HLIDILHPSEGIAI*IL  399
            HLIDI++P E  ++ I 
Sbjct  63   HLIDIMNPDEEYSVAIF  79



>ref|WP_022226282.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:302]
 emb|CDB91559.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:302]
Length=293

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            KVIVI+GPT  GK+KL++ELAKR NGEII+AD+VQVY+GLDIGSAK +  E++++PHHL 
Sbjct  3    KVIVITGPTAVGKTKLSIELAKRYNGEIINADAVQVYKGLDIGSAKVTEEEKEDIPHHLF  62

Query  358  DILHPSEGIAI  390
            DI    E   I
Sbjct  63   DIKEVDEEYTI  73



>ref|WP_042239754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neochlamydia 
sp. S13]
Length=330

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K++VI+I+GPTG GKS  AL+LA+++ GEI+SADS+QVY+G+DIG+AKP++ ER+++ HH
Sbjct  21   KKRVIIIAGPTGCGKSHFALQLARKIQGEIVSADSMQVYKGMDIGTAKPTIEERQQISHH  80

Query  352  LIDILHPSEGIAI  390
            LIDI H ++   +
Sbjct  81   LIDICHLTDSFNV  93



>ref|WP_044882520.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neochlamydia 
sp. EPS4]
Length=330

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K++VI+I+GPTG GKS  AL+LA+++ GEI+SADS+QVY+G+DIG+AKP++ ER+++ HH
Sbjct  21   KKRVIIIAGPTGCGKSHFALQLARKIQGEIVSADSMQVYKGMDIGTAKPTIEERQQISHH  80

Query  352  LIDILHPSEGIAI  390
            LIDI H ++   +
Sbjct  81   LIDICHLTDSFNV  93



>gb|KIC73229.1| tRNA dimethylallyltransferase [Neochlamydia sp. EPS4]
Length=364

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K++VI+I+GPTG GKS  AL+LA+++ GEI+SADS+QVY+G+DIG+AKP++ ER+++ HH
Sbjct  55   KKRVIIIAGPTGCGKSHFALQLARKIQGEIVSADSMQVYKGMDIGTAKPTIEERQQISHH  114

Query  352  LIDILHPSEGIAI  390
            LIDI H ++   +
Sbjct  115  LIDICHLTDSFNV  127



>ref|WP_039384140.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neochlamydia 
sp. TUME1]
Length=344

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K++VI+I+GPTG GKS  AL+LA+++ GEI+SADS+QVY+G+DIG+AKP++ ER+++ HH
Sbjct  35   KKRVIIIAGPTGCGKSHFALQLARKIQGEIVSADSMQVYKGMDIGTAKPTIEERQQISHH  94

Query  352  LIDILHPSEGIAI  390
            LIDI H ++   +
Sbjct  95   LIDICHLTDSFNV  107



>gb|KIC76632.1| tRNA dimethylallyltransferase [Neochlamydia sp. TUME1]
Length=343

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K++VI+I+GPTG GKS  AL+LA+++ GEI+SADS+QVY+G+DIG+AKP++ ER+++ HH
Sbjct  34   KKRVIIIAGPTGCGKSHFALQLARKIQGEIVSADSMQVYKGMDIGTAKPTIEERQQISHH  93

Query  352  LIDILHPSEGIAI  390
            LIDI H ++   +
Sbjct  94   LIDICHLTDSFNV  106



>ref|WP_007440312.1| tRNA dimethylallyltransferase, partial [Candidatus Arthromitus 
sp. SFB-1]
 gb|EIA22660.1| tRNA dimethylallyltransferase, partial [Candidatus Arthromitus 
sp. SFB-1]
Length=69

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++++SGPTG GK+ L+++LAK+LNGEIISADS+Q+Y+ +DIGSAK S SE   VPHH
Sbjct  2    KEKILILSGPTGVGKTSLSIKLAKKLNGEIISADSMQIYKYMDIGSAKISNSEMDGVPHH  61

Query  352  LIDILHP  372
            LIDI  P
Sbjct  62   LIDICEP  68



>ref|WP_041941869.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Waddlia chondrophila]
Length=333

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+KVIV+SGPT  GK++ A+ELAK LNGEIISADS+Q+YRG+DIG+AK S  +R++VPHH
Sbjct  24   KKKVIVLSGPTACGKTEFAIELAKSLNGEIISADSMQIYRGMDIGTAKASQEQRQQVPHH  83

Query  352  LIDI  363
            LID+
Sbjct  84   LIDM  87



>gb|ADI38731.1| tRNA delta-2-isopentenylpyrophosphate transferase [Waddlia chondrophila 
WSU 86-1044]
Length=345

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+KVIV+SGPT  GK++ A+ELAK LNGEIISADS+Q+YRG+DIG+AK S  +R++VPHH
Sbjct  36   KKKVIVLSGPTACGKTEFAIELAKSLNGEIISADSMQIYRGMDIGTAKASQEQRQQVPHH  95

Query  352  LIDI  363
            LID+
Sbjct  96   LIDM  99



>dbj|GAE48255.1| tRNA dimethylallyltransferase [Bacillus boroniphilus JCM 21738]
Length=86

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +++K+IV+ GPT  GK+KL++ELAK+ NGEIIS DS+Q+Y+G+DIG+AK +  E + +PH
Sbjct  3    QRQKLIVLIGPTAVGKTKLSIELAKKFNGEIISGDSMQIYKGMDIGTAKITREEMERIPH  62

Query  349  HLIDILHPSEGIA  387
            HLIDI  P E  +
Sbjct  63   HLIDIKQPDESFS  75



>ref|WP_005806270.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Candidatus Arthromitus]
 dbj|BAK56522.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus 
Arthromitus sp. SFB-mouse-Japan]
 gb|EGX28788.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus 
Arthromitus sp. SFB-mouse-NYU]
 dbj|BAK79852.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus 
Arthromitus sp. SFB-mouse-Yit]
 gb|EIA23653.1| tRNA dimethylallyltransferase [Candidatus Arthromitus sp. SFB-3]
 gb|EIA23872.1| tRNA dimethylallyltransferase [Candidatus Arthromitus sp. SFB-2]
 gb|EIA27481.1| tRNA dimethylallyltransferase [Candidatus Arthromitus sp. SFB-co]
 gb|EIA29128.1| tRNA dimethylallyltransferase [Candidatus Arthromitus sp. SFB-4]
 gb|EIA30806.1| tRNA dimethylallyltransferase [Candidatus Arthromitus sp. SFB-mouse-SU]
Length=306

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++++SGPTG GK+ L+++LAK+LNGEIISADS+Q+Y+ +DIGSAK S SE   VPHH
Sbjct  2    KEKILILSGPTGVGKTSLSIKLAKKLNGEIISADSMQIYKYMDIGSAKISNSEMDGVPHH  61

Query  352  LIDILHPSE  378
            LIDI  P E
Sbjct  62   LIDICEPDE  70



>ref|WP_031538266.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. MB2021]
Length=320

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEKV+V+ GPT  GK+ L++ELAK+ +GEIIS DS+Q+YRG+DI +AK S  E + VPHH
Sbjct  4    KEKVVVLIGPTAVGKTNLSIELAKKFDGEIISGDSMQIYRGMDIATAKISKDEMQGVPHH  63

Query  352  LIDILHPSEGIAI  390
            LIDI+ P EG ++
Sbjct  64   LIDIVEPDEGFSV  76



>ref|WP_024028344.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
vireti]
 gb|ETI68858.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
vireti LMG 21834]
Length=318

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K+K++VI GPT  GK+KL++E+AKR NGEIIS DS+Q+YRG+DIG+AK +  E + +PH
Sbjct  3    EKQKLLVIIGPTAVGKTKLSIEMAKRYNGEIISGDSMQIYRGMDIGTAKITKDEMEGIPH  62

Query  349  HLIDILHPSEGIAI  390
            HLIDI +PSE  ++
Sbjct  63   HLIDIKNPSENFSV  76



>ref|WP_034434342.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridiales 
bacterium S5-A14a]
 gb|KGF08974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridiales 
bacterium S5-A14a]
Length=314

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K+IV++GPT  GK++ A+E+AKRL+GEI++ DS+Q+Y+ +DIGSAKP+  ER+EVPHHL+
Sbjct  8    KLIVLAGPTAVGKTEFAIEIAKRLDGEIVNCDSMQIYKHMDIGSAKPTKEERREVPHHLV  67

Query  358  DILHPSEGIAI  390
            D ++P+E  ++
Sbjct  68   DFINPTEEFSV  78



>gb|AGC04673.1| tRNA-isopentenyltransferase [Physcomitrella patens]
Length=502

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            V  +K++VIVI+GPTG GKS+ A+ LAK+L GEIISADS+QVY G+++GSAK  L ER+ 
Sbjct  103  VETQKDRVIVIAGPTGVGKSRFAINLAKQLGGEIISADSIQVYNGMNVGSAKTPLHEREG  162

Query  340  VPHHLIDILHPSE  378
            VPHHL+DI+ P+E
Sbjct  163  VPHHLLDIVPPTE  175



>ref|WP_003337167.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
laterosporus]
 emb|CCF16951.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
laterosporus GI-9]
 gb|AIG27386.1| tRNA dimethylallyltransferase [Brevibacillus laterosporus LMG 
15441]
Length=317

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KE ++VI+GPT  GK+ L+L LA++ NGEIIS DS+QVYRG+DIG+AK +  ER  VPH
Sbjct  3    QKENLVVIAGPTAVGKTALSLRLAQQFNGEIISGDSMQVYRGMDIGTAKATEEERSIVPH  62

Query  349  HLIDILHPSEGIAI*IL  399
            HLIDI++P E  ++ I 
Sbjct  63   HLIDIMNPDEEYSVAIF  79



>ref|WP_045505564.1| hypothetical protein [bacterium UASB14]
 dbj|GAK50928.1| tRNA dimethylallyltransferase 2 [bacterium UASB14]
Length=309

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+ +I+I+GPTG GK+ +ALE+A+R+NGEI+ ADS+Q+YRG+DIG+AKP+  ER+ VPH+
Sbjct  2    KQPLIIIAGPTGVGKTGIALEVAERVNGEIVGADSMQIYRGMDIGTAKPTREERERVPHY  61

Query  352  LIDILHPSEGIAI  390
            LIDI  P+E  ++
Sbjct  62   LIDIRSPNEEFSV  74



>ref|WP_029099052.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
thermoruber]
Length=319

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++VI GPT  GK++L+LELA++ +GEIIS DS+QVYRG+DIG+AK +  ER  VPHH
Sbjct  6    KEKLVVIVGPTAVGKTELSLELAEQFDGEIISGDSMQVYRGMDIGTAKATPEERARVPHH  65

Query  352  LIDILHPSEGIAI  390
            LIDI+ P E  ++
Sbjct  66   LIDIIDPDEEYSV  78



>ref|WP_035343862.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
hemicellulosilyticus]
 dbj|GAE30842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
hemicellulosilyticus JCM 9152]
Length=313

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++VI GPT  GK+ L++ELAKR NGE+IS DS+QVY+G+DIG+AK SL E++ +PHH
Sbjct  2    KEKLLVIVGPTAVGKTALSIELAKRYNGEVISGDSMQVYKGMDIGTAKVSLDEQQGIPHH  61

Query  352  LIDILHPSEGIAI  390
            LIDI  P++  ++
Sbjct  62   LIDIKDPADSFSV  74



>ref|WP_015042677.1| MULTISPECIES: tRNA dimethylallyltransferase [Dehalobacter]
 gb|AFV01635.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dehalobacter 
sp. DCA]
 gb|AFV04671.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dehalobacter 
sp. CF]
 gb|EQB21969.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dehalobacter 
sp. UNSWDHB]
Length=313

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IVI GPT  GKS L +ELA RLNGEIIS DSVQVYR LDIGSAKPS +E+K VPHHLID
Sbjct  4    LIVIIGPTAVGKSALGVELALRLNGEIISGDSVQVYRKLDIGSAKPSKAEQKGVPHHLID  63

Query  361  ILHPSEGIAI  390
            +L P+E   +
Sbjct  64   LLDPAEPFTV  73



>ref|WP_007417850.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pedosphaera 
parvula]
 gb|EEF58145.1| tRNA delta(2)-isopentenylpyrophosphate transferase [bacterium 
Ellin514]
Length=309

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  184  IVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDI  363
            I+I+GPT  GKS+LAL LA+RLNGEIIS DS+QVYRGLDIG+AKPS  ER+ VPHHLID+
Sbjct  8    ILIAGPTAVGKSELALHLAERLNGEIISVDSMQVYRGLDIGTAKPSPEERQRVPHHLIDV  67

Query  364  L  366
            +
Sbjct  68   V  68



>ref|WP_035297419.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Bacillales]
Length=319

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++VI GPT  GK++L+LELA++ +GEIIS DS+QVYRG+DIG+AK +  ER  VPHH
Sbjct  6    KEKLVVIVGPTAVGKTELSLELAEQFDGEIISGDSMQVYRGMDIGTAKATPEERARVPHH  65

Query  352  LIDILHPSEGIAI  390
            LIDI+ P E  ++
Sbjct  66   LIDIIDPDEEYSV  78



>ref|WP_008514501.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dethiobacter 
alkaliphilus]
 gb|EEG78545.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dethiobacter 
alkaliphilus AHT 1]
Length=310

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            EK++VI GPT  GK+ +A+E+AK+L GEIISADSVQVYRGLDIG+AKPS  ER+ V HHL
Sbjct  2    EKLLVIVGPTAVGKTAVAIEVAKKLGGEIISADSVQVYRGLDIGAAKPSREEREAVAHHL  61

Query  355  IDILHPSEGIAI  390
            +DI+ P++   +
Sbjct  62   LDIVDPADNYTV  73



>ref|WP_006844981.1| transposase [Weissella koreensis]
 gb|EJF34419.1| tRNA isopentenyltransferase [Weissella koreensis KCTC 3621]
Length=307

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            +K+IVI+GPT  GK+ L+L+LAK+ +GEIIS DS+Q+YR LDIG+AK + +E+ +VPHHL
Sbjct  2    QKIIVIAGPTAVGKTDLSLQLAKKFDGEIISGDSMQIYRHLDIGTAKATKAEQDQVPHHL  61

Query  355  IDILHPSEGIAI  390
            ID+L P+E  ++
Sbjct  62   IDLLEPTENFSV  73



>ref|WP_013989634.1| transposase [Weissella koreensis]
 gb|AEJ23814.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Weissella 
koreensis KACC 15510]
Length=307

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            +K+IVI+GPT  GK+ L+L+LAK+ +GEIIS DS+Q+YR LDIG+AK + +E+ +VPHHL
Sbjct  2    QKIIVIAGPTAVGKTDLSLQLAKKFDGEIISGDSMQIYRYLDIGTAKATKAEQDQVPHHL  61

Query  355  IDILHPSEGIAI  390
            ID+L P+E  ++
Sbjct  62   IDLLEPTENFSV  73



>ref|WP_034741144.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
wakoensis]
 dbj|GAE24346.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
wakoensis JCM 9140]
Length=314

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KKE++IVI GPT  GK+ L++ LAK+  GE+IS DS+QVY+G+DIG+AK +++E++ VPH
Sbjct  2    KKEQLIVIVGPTAVGKTALSINLAKKYQGEVISGDSMQVYKGMDIGTAKVTVAEQEGVPH  61

Query  349  HLIDILHPSEGIAI  390
            HLIDILHP +  ++
Sbjct  62   HLIDILHPKDSFSV  75



>ref|WP_004514052.1| tRNA dimethylallyltransferase [Geobacter metallireducens]
 sp|Q39TZ3.1|MIAA_GEOMG RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA 
dimethylallyltransferase; Short=DMATase; AltName: 
Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; 
Short=IPP transferase; Short=IPPT; Short=IPTase [Geobacter metallireducens 
GS-15]
 gb|ABB32281.1| tRNA (N6-dimethylallyl-A37)-dimethylallyltransferase [Geobacter 
metallireducens GS-15]
 gb|EHP85161.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter 
metallireducens RCH3]
Length=309

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K +++++ GPT +GKS LALELA+R+ GEI++ADS+QVYRG+DIG+AKPS  ER+ VPH
Sbjct  5    EKTRLVIVQGPTASGKSALALELAERIGGEIVNADSMQVYRGMDIGTAKPSQEERRRVPH  64

Query  349  HLIDILHP  372
            HL DI+ P
Sbjct  65   HLYDIVDP  72



>ref|WP_031413818.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
laterosporus]
Length=317

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KE ++VI+GPT  GK+ L+L LA++ NGEIIS DS+QVYRG+DIG+AK +  ER  VPH
Sbjct  3    QKENLVVIAGPTAVGKTALSLRLAQQFNGEIISGDSMQVYRGMDIGTAKATEEERSIVPH  62

Query  349  HLIDILHPSEGIAI  390
            HLIDI++P E  ++
Sbjct  63   HLIDIMNPDEEYSV  76



>ref|WP_015898907.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Persephonella 
marina]
 gb|ACO04803.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Persephonella 
marina EX-H1]
Length=306

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            EK++VI+G T  GK+ L++ELAKRL+GEI+SADS+ VYR +DIG+AKPS  E +EVPHHL
Sbjct  2    EKILVITGVTATGKTDLSIELAKRLDGEIVSADSMMVYRYMDIGTAKPSKEEMEEVPHHL  61

Query  355  IDILHPSEGIAI  390
            ID++ PS   ++
Sbjct  62   IDVVDPSYDFSV  73



>ref|WP_045057306.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [Chroococcales 
cyanobacterium CENA595]
 gb|KJH69362.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [Chroococcales 
cyanobacterium CENA595]
Length=109

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            ++I I G T  GKS LAL LAKRL   IISADS QVYR  DIG+AKPSL ER+EVPH+LI
Sbjct  10   RLITICGATATGKSSLALALAKRLETMIISADSRQVYREFDIGTAKPSLQERQEVPHYLI  69

Query  358  DILHPSEGIAI  390
            DI  P+E + +
Sbjct  70   DICEPAETLTV  80



>ref|WP_040933766.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Prochloron 
didemni]
Length=304

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IVI GPT  GKS LALELA+RLN  I+SADS QVYR LDIG+AKP+L+E++ VPH+LID
Sbjct  2    LIVICGPTATGKSGLALELARRLNSVILSADSRQVYRELDIGTAKPTLAEQQSVPHYLID  61

Query  361  ILHPSEGIAI  390
            I HP+E + +
Sbjct  62   ICHPTETLTL  71



>ref|WP_040943176.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Prochloron 
didemni]
Length=304

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IVI GPT  GKS LALELA+RLN  I+SADS QVYR LDIG+AKP+L+E++ VPH+LID
Sbjct  2    LIVICGPTATGKSGLALELARRLNSVILSADSRQVYRELDIGTAKPTLAEQQSVPHYLID  61

Query  361  ILHPSEGIAI  390
            I HP+E + +
Sbjct  62   ICHPTETLTL  71



>ref|WP_022166100.1| tRNA dimethylallyltransferase [Eubacterium sp. CAG:192]
 emb|CDB13760.1| tRNA dimethylallyltransferase [Eubacterium sp. CAG:192]
Length=313

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K+++++GPT  GK+ L+++LAK++NGEIISADS+QVY+G+DIGSAK +  E   +PHHLI
Sbjct  3    KLVILTGPTAVGKTDLSIQLAKKINGEIISADSIQVYKGMDIGSAKITKEETDGIPHHLI  62

Query  358  DILHPSEGIAI*ILSK  405
            DIL P E   + I  K
Sbjct  63   DILEPKEEFNVHIFKK  78



>ref|WP_041018636.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Criblamydia 
sequanensis]
Length=332

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKK--EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYR  291
            R LF     A  + V+ +K  +KV+VI+GPT  GKS+ AL+LAK +NGEIISADS+QVY+
Sbjct  3    RILFGFKLEAQKQLVSLQKPRKKVLVIAGPTAVGKSRFALDLAKTINGEIISADSMQVYK  62

Query  292  GLDIGSAKPSLSERKEVPHHLIDI  363
            G+DIG+AK  L+ER+ +PHHLIDI
Sbjct  63   GMDIGTAKLPLNEREGIPHHLIDI  86



>ref|WP_040574403.1| tRNA dimethylallyltransferase [Methylohalobius crimeensis]
Length=311

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 60/75 (80%), Gaps = 6/75 (8%)
 Frame = +1

Query  154  KPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSER  333
            +PVA      +++ GPT +GKS+LA++LA+R+ GEI+S DS QVYRG+DIG+AKPSL  R
Sbjct  4    RPVA------LLLMGPTASGKSELAVDLARRMEGEIVSVDSSQVYRGMDIGTAKPSLDIR  57

Query  334  KEVPHHLIDILHPSE  378
             E+PHHLIDIL PSE
Sbjct  58   AEIPHHLIDILDPSE  72



>ref|WP_028399069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
panaciterrae]
Length=311

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            K+EKVIVI GPT  GK+KL++ELAK LNGEIIS DS+QVYRG+DIG+AK +  E + +PH
Sbjct  5    KQEKVIVIIGPTAVGKTKLSIELAKVLNGEIISGDSMQVYRGMDIGTAKVTSEEMEGIPH  64

Query  349  HLIDILHPSE  378
            ++IDI  PSE
Sbjct  65   YMIDIKEPSE  74



>ref|WP_013275984.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermosediminibacter 
oceani]
 gb|ADL07945.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermosediminibacter 
oceani DSM 16646]
Length=314

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+ ++ I GPT  GK+++A+E+A RLNGEIISADS+Q+YR +DIG+AKP+LSERK VPHH
Sbjct  3    KKLLLAIVGPTAVGKTEIAIEVALRLNGEIISADSMQIYRYMDIGTAKPTLSERKGVPHH  62

Query  352  LIDILHPSEGIAI  390
            +IDI+ P +  ++
Sbjct  63   MIDIVDPDKEFSV  75



>ref|WP_020492526.1| tRNA dimethylallyltransferase [Dehalobacter sp. FTH1]
Length=313

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IVI GPT  GKS L +ELA RLNGEIIS DSVQVYR LDIGSAKPS  E+K VPHHLID
Sbjct  4    LIVIIGPTAVGKSALGVELALRLNGEIISGDSVQVYRKLDIGSAKPSKVEQKGVPHHLID  63

Query  361  ILHPSEGIAI  390
            +L P+E   +
Sbjct  64   LLDPAEPFTV  73



>ref|WP_018661648.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermobrachium 
celere]
 emb|CDF57986.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermobrachium 
celere DSM 8682]
Length=315

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K  +I+I+GPT +GK+K+ +ELAK LNGE++SADS+Q+YR +DIG+AKPSL E + + HH
Sbjct  4    KPNIIIIAGPTASGKTKIGIELAKVLNGEVVSADSMQIYRYMDIGTAKPSLEEMEGIKHH  63

Query  352  LIDILHPSEGIAI*ILSK  405
            LIDI++P E  ++ +  K
Sbjct  64   LIDIVNPDEEFSVALFRK  81



>ref|WP_034658493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
massiliosenegalensis]
Length=322

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+KV+V+ GPT  GK+K+++ELAKR NGEIIS DS+Q+Y+G+DIG+AK S  E + VPHH
Sbjct  5    KKKVLVLIGPTAVGKTKMSIELAKRFNGEIISGDSMQIYKGMDIGTAKISTEEMEGVPHH  64

Query  352  LIDILHPSEGIAI  390
            LIDI  P+E  ++
Sbjct  65   LIDIKWPNESFSV  77



>ref|WP_010282246.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
timonensis]
Length=315

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KKEK++V+ GPT  GK+KL++ELAK+LN EIIS DS+Q+Y+G+DIG+AK +  E + +PH
Sbjct  5    KKEKLVVLIGPTAVGKTKLSIELAKKLNAEIISGDSMQIYKGMDIGTAKITRDEMEGIPH  64

Query  349  HLIDILHPSEGIAI  390
            HLIDI  P+E  ++
Sbjct  65   HLIDIKEPNESFSV  78



>emb|CDR35057.1| tRNA dimethylallyltransferase [Criblamydia sequanensis CRIB-18]
Length=348

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +1

Query  118  RRLFATSCSASTKPVAGKK--EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYR  291
            R LF     A  + V+ +K  +KV+VI+GPT  GKS+ AL+LAK +NGEIISADS+QVY+
Sbjct  19   RILFGFKLEAQKQLVSLQKPRKKVLVIAGPTAVGKSRFALDLAKTINGEIISADSMQVYK  78

Query  292  GLDIGSAKPSLSERKEVPHHLIDI  363
            G+DIG+AK  L+ER+ +PHHLIDI
Sbjct  79   GMDIGTAKLPLNEREGIPHHLIDI  102



>ref|WP_031556857.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium FD2005]
Length=311

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K K+++ISGPTG GK+KL++ELAK++ GEIISADS+QVY+ +DIGSAK +  E + V HH
Sbjct  2    KNKLVIISGPTGVGKTKLSIELAKKIGGEIISADSMQVYKYMDIGSAKVTKEEMQNVKHH  61

Query  352  LIDILHPSEGIAI  390
            LID+L P+E   +
Sbjct  62   LIDVLEPTESFDV  74



>ref|WP_021619401.1| tRNA dimethylallyltransferase [Aneurinibacillus aneurinilyticus]
 gb|ERI05592.1| tRNA dimethylallyltransferase [Aneurinibacillus aneurinilyticus 
ATCC 12856]
Length=315

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            ++G+KEKV+ I GPT  GK+ L+LEL +R  GEIIS DS+Q YRG+DIG+AK + SER  
Sbjct  1    MSGQKEKVLAIVGPTSVGKTALSLELGRRFAGEIISGDSMQFYRGMDIGTAKATESERLL  60

Query  340  VPHHLIDILHPSEGIAI  390
            VPHHLIDI  P E I +
Sbjct  61   VPHHLIDIRDPDEEITV  77



>ref|WP_042294598.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus 
Arthromitus sp. SFB-mouse-NL]
 gb|AID44708.1| tRNA dimethylallyltransferase [Candidatus Arthromitus sp. SFB-mouse-NL]
Length=306

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++++SGPTG GK+ L+++LAK+LNGEIISADS+Q+Y+ +DIGSAK S SE   VPHH
Sbjct  2    KEKILILSGPTGVGKTSLSIKLAKKLNGEIISADSMQIYKYMDIGSAKISNSEMDGVPHH  61

Query  352  LIDILHPSE  378
            LIDI  P +
Sbjct  62   LIDICEPDK  70



>ref|WP_029505954.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium AC2012]
Length=311

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K K+++ISGPTG GK+KL++ELAK++ GEIISADS+QVY+ +DIGSAK +  E + V HH
Sbjct  2    KNKLVIISGPTGVGKTKLSIELAKKIGGEIISADSMQVYKYMDIGSAKVTKEEMQNVKHH  61

Query  352  LIDILHPSEGIAI  390
            LID+L P+E   +
Sbjct  62   LIDVLEPTESFDV  74



>ref|WP_022849697.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geovibrio 
sp. L21-Ace-BES]
Length=299

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            ++ +I+GPT  GK++LALELA R++GEIISAD+ QVYR +DIG+AKPS+ ER+ + HHLI
Sbjct  2    RIPIITGPTATGKTELALELADRIDGEIISADAYQVYRYMDIGTAKPSMEERRGISHHLI  61

Query  358  DILHPSE  378
            DIL PSE
Sbjct  62   DILDPSE  68



>ref|WP_003350092.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
methanolicus]
 gb|EIJ81410.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
methanolicus PB1]
Length=320

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +1

Query  166  GKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVP  345
             KKEK+ V+ GPT  GK+KL++ELAKRLNGEIIS DS+Q+YRG+DIG+AK    E + +P
Sbjct  2    SKKEKLAVLIGPTAVGKTKLSIELAKRLNGEIISGDSMQIYRGMDIGTAKIKKEEMEGIP  61

Query  346  HHLIDILHPSEGIAI  390
            H+LIDI +P E  ++
Sbjct  62   HYLIDIKNPDESFSV  76



>ref|XP_008382159.1| PREDICTED: tRNA dimethylallyltransferase 9-like, partial [Malus 
domestica]
Length=111

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = +1

Query  76   LLRGPYGLTFHRGGRRLFATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNG  255
            +LR    LTF    RRL  T+CS S      +KEKVI +SGPTG+GK++LALELAKRLNG
Sbjct  15   VLRTAGLLTFTLRRRRL-TTACSVSAT-KXKEKEKVIXVSGPTGSGKTRLALELAKRLNG  72

Query  256  EIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDILH  369
            EIISADSVQV RGLDIGSAKPS +ER+        ILH
Sbjct  73   EIISADSVQVXRGLDIGSAKPSPAERQAGAFQF--ILH  108



>ref|WP_022584478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
laterosporus]
 gb|ERM19639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
laterosporus PE36]
Length=317

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KE ++VI+GPT  GK+ L+L L ++ NGEIIS DS+QVYRG+DIG+AK +  ER  VPH
Sbjct  3    QKENLVVIAGPTAVGKTALSLRLVQQFNGEIISGDSMQVYRGMDIGTAKATEEERSIVPH  62

Query  349  HLIDILHPSEGIAI*IL  399
            HLIDI++P E  ++ I 
Sbjct  63   HLIDIMNPDEEYSVAIF  79



>ref|WP_012529413.1| tRNA dimethylallyltransferase 1 [Geobacter bemidjiensis]
 sp|B5EGD5.1|MIAA1_GEOBB RecName: Full=tRNA dimethylallyltransferase 1; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase 1; Short=DMAPP:tRNA 
dimethylallyltransferase 1; Short=DMATase 1; 
AltName: Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase 
1; Short=IPP transferase 1; Short=IPPT 1; Short=IPTase 
1 [Geobacter bemidjiensis Bem]
 gb|ACH38000.1| tRNA (N6-dimethylallyl-A37)-dimethylallyltransferase [Geobacter 
bemidjiensis Bem]
Length=306

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK KVIV+ GPTG+GKS LA++LA+ + GEI++ADS+QVYR LDIG+AKPS ++   VPH
Sbjct  6    KKIKVIVLGGPTGSGKSDLAVKLAEEIGGEIVNADSMQVYRRLDIGTAKPSAADLARVPH  65

Query  349  HLIDILHPSE  378
            HLIDIL P+E
Sbjct  66   HLIDILDPNE  75



>ref|WP_026842367.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter 
bremensis]
Length=306

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  166  GKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVP  345
            GKK KVIV+ GPTG+GKS LA++LA+ + GEI++ADS+QVYR LDIG+AKPS ++   VP
Sbjct  5    GKKIKVIVLGGPTGSGKSDLAVKLAEEIGGEIVNADSMQVYRRLDIGTAKPSAADLARVP  64

Query  346  HHLIDILHPSE  378
            HHLI+IL P E
Sbjct  65   HHLINILDPDE  75



>ref|WP_041419427.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [Simkania 
negevensis]
Length=310

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 2/71 (3%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            +VIVI+GPT AGKS+LA E+AK ++GEIISADSVQVYRG+DIG+AK S  E  ++PHHLI
Sbjct  2    RVIVIAGPTAAGKSRLAFEMAKLIDGEIISADSVQVYRGMDIGTAKVSTQEMLQIPHHLI  61

Query  358  DI--LHPSEGI  384
            DI  LH S  +
Sbjct  62   DICDLHESFNV  72



>ref|WP_029565656.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
cibi]
 gb|KEZ54337.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
cibi]
Length=313

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KKEK++VI GPT  GK+KL++ELAKRLNGEIIS DS+Q+YRG+DIG+AK +  E   V H
Sbjct  2    KKEKLLVIIGPTAVGKTKLSIELAKRLNGEIISGDSMQIYRGMDIGTAKAAPDEMDGVRH  61

Query  349  HLIDILHPSEGIA  387
            HLIDI  P E  +
Sbjct  62   HLIDIKDPDESFS  74



>ref|WP_031502739.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermotoga 
hypogea]
Length=302

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IV++GPTG GK+ +A+ELA RLN EI+S DS Q+YR +DIG+AKP+L +R+ VPHHLID
Sbjct  1    MIVVTGPTGVGKTNIAIELALRLNAEIVSVDSRQIYRFMDIGTAKPTLEQRRLVPHHLID  60

Query  361  ILHPSEGIAI  390
            I+ P E  ++
Sbjct  61   IVSPDEYYSV  70



>ref|WP_031305817.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
panacihumi]
Length=319

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KEK++VI GPT  GK+ L+LELA++ +GE+IS DS+QVYRG+DIG+AK S  +   VPH
Sbjct  5    RKEKLVVIVGPTAVGKTDLSLELAEQFDGEVISGDSMQVYRGMDIGTAKASPQDLARVPH  64

Query  349  HLIDILHPSEGIAI  390
            HLIDI+ PSE  ++
Sbjct  65   HLIDIIEPSEEYSV  78



>ref|WP_027439081.1| hypothetical protein [Lachnospiraceae bacterium AC2031]
Length=335

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  GKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVP  345
             KK+K+IV++GPT  GK+ L++ LAKR+NGEIISADS+QVY+GLDIGSAK +  E + VP
Sbjct  4    NKKKKLIVLTGPTAVGKTDLSINLAKRINGEIISADSIQVYKGLDIGSAKITKEEMQGVP  63

Query  346  HHLIDILHPS  375
            HHLID   PS
Sbjct  64   HHLIDCYDPS  73



>ref|WP_027436413.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium AB2028]
Length=311

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK+++ISGPT  GKS  A++LAK + GE+ISADS+QVYRG+DIG+AK +  E   VPHH
Sbjct  2    KEKIVIISGPTAVGKSDCAVKLAKMIKGEVISADSMQVYRGMDIGTAKVTTEEMDGVPHH  61

Query  352  LIDILHPSEGIAI*ILSK  405
            LIDIL P +   + +  K
Sbjct  62   LIDILEPEQDFNVLLFKK  79



>gb|EST52454.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
panacihumi W25]
Length=317

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KEK++VI GPT  GK+ L+LELA++ +GE+IS DS+QVYRG+DIG+AK S  +   VPH
Sbjct  3    RKEKLVVIVGPTAVGKTDLSLELAEQFDGEVISGDSMQVYRGMDIGTAKASPQDLARVPH  62

Query  349  HLIDILHPSEGIAI  390
            HLIDI+ PSE  ++
Sbjct  63   HLIDIIEPSEEYSV  76



>ref|WP_019225370.1| tRNA dimethylallyltransferase [Dehalobacter sp. E1]
Length=313

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IVI GPT  GKS L +ELA RL+GEIIS DSVQVYR LDIGSAKPS +E+K VPHHLID
Sbjct  4    LIVIIGPTAVGKSALGIELALRLHGEIISGDSVQVYRKLDIGSAKPSKAEQKGVPHHLID  63

Query  361  ILHPSEGIAI  390
            +L P+E   +
Sbjct  64   LLDPAEPFTV  73



>ref|WP_025205660.1| tRNA dimethylallyltransferase [Dehalobacter restrictus]
 gb|AHF09933.1| tRNA dimethylallyltransferase [Dehalobacter restrictus DSM 9455]
Length=313

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IVI GPT  GKS L +ELA RL+GEIIS DSVQVYR LDIGSAKPS +E+K VPHHLID
Sbjct  4    LIVIIGPTAVGKSALGIELALRLHGEIISGDSVQVYRKLDIGSAKPSKAEQKGVPHHLID  63

Query  361  ILHPSEGIAI  390
            +L P+E   +
Sbjct  64   LLDPAEPFTV  73



>ref|WP_014812426.1| tRNA isopentenyltransferase MiaA [Desulfomonile tiedjei]
 gb|AFM27318.1| tRNA isopentenyltransferase MiaA [Desulfomonile tiedjei DSM 6799]
Length=308

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            +A +K K+I+++GPT AGK+ + + LA+R+ GEI+SADSVQVYR +DIGSAKPS  E+  
Sbjct  2    IAEQKPKIIIVAGPTAAGKTDIGIRLAERIQGEIVSADSVQVYRHMDIGSAKPSPDEQAI  61

Query  340  VPHHLIDILHPSEGIA  387
            VPHH+IDI  P E  +
Sbjct  62   VPHHMIDIKDPDESFS  77



>ref|WP_035411705.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. SJS]
 gb|KEZ55373.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. SJS]
Length=313

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K+KVIVI GPTG GK+KL+LE A +LNGEIIS DS+Q+Y+G+DIG+AK   +E + +PH
Sbjct  3    EKQKVIVIIGPTGVGKTKLSLEAAHKLNGEIISGDSMQIYKGMDIGTAKIRQNEMEGIPH  62

Query  349  HLIDILHPSEGIA  387
            HLIDI +P E  +
Sbjct  63   HLIDIKNPDESFS  75



>emb|CCB89591.1| tRNA dimethylallyltransferase [Simkania negevensis Z]
Length=336

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 2/71 (3%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            +VIVI+GPT AGKS+LA E+AK ++GEIISADSVQVYRG+DIG+AK S  E  ++PHHLI
Sbjct  28   RVIVIAGPTAAGKSRLAFEMAKLIDGEIISADSVQVYRGMDIGTAKVSTQEMLQIPHHLI  87

Query  358  DI--LHPSEGI  384
            DI  LH S  +
Sbjct  88   DICDLHESFNV  98



>ref|WP_034698953.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterococcus 
hirae]
 gb|KDR92718.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterococcus 
hirae]
Length=308

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            EKV+VI GPT  GK+ L++ELAK+ NGEIIS DS+QVY+ LDIG+AK   SE + +PHHL
Sbjct  2    EKVLVIVGPTAVGKTALSVELAKKFNGEIISGDSLQVYKKLDIGTAKIKTSEMESIPHHL  61

Query  355  IDILHPSEGIAI  390
            IDI+ P+E  ++
Sbjct  62   IDIIEPNETYSV  73



>ref|WP_027432968.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium MD2004]
Length=311

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K K+++ISGPTG GK+KL++E AK++ GEIISADS+QVY+ +DIGSAK +  E + V HH
Sbjct  2    KNKLVIISGPTGVGKTKLSIEFAKKIGGEIISADSMQVYKYMDIGSAKVTKEEMQNVKHH  61

Query  352  LIDILHPSEGIAI  390
            LID+L P+E   +
Sbjct  62   LIDVLEPTESFDV  74



>ref|WP_006953801.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina 
baltica]
 gb|EAQ33098.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina 
baltica OS145]
Length=318

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            VI I GPT AGK+ L++ELAK+L+GEIIS DS  +YRG+DIG+AKPSL+ER+ +PHHL+D
Sbjct  9    VICIYGPTAAGKTALSIELAKQLDGEIISVDSALIYRGMDIGTAKPSLAERQGIPHHLLD  68

Query  361  ILHPSE  378
            I  P+E
Sbjct  69   ICDPAE  74



>ref|WP_025601390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. JGI 0001002-E22]
Length=316

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E++ 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEKQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            +PH+LIDI  P E  ++
Sbjct  61   IPHYLIDIKEPDESFSV  77



>emb|CCO09346.1| tRNA dimethylallyltransferase [Desulfotomaculum hydrothermale 
Lam5 = DSM 18033]
Length=315

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            ++VI GPT AGK+ +A+ELAK + GE+ISADS+ VYRG+DIG+AKP+L+ER+ +PHHLID
Sbjct  7    LVVIVGPTAAGKTDVAIELAKLVRGEVISADSMLVYRGMDIGTAKPTLAERQGIPHHLID  66

Query  361  ILHPSEGIAI*ILSK  405
            I+ P +  ++ +  +
Sbjct  67   IVEPDQEFSVAMFQR  81



>ref|WP_042103588.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Parachlamydiaceae 
bacterium HS-T3]
Length=330

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  127  FATSCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIG  306
            FAT            K+KVI+++GPTG GKS LA++LA+ + GEIIS DS+QVY+G+DIG
Sbjct  5    FATEAQKQIPANFRPKKKVIILAGPTGCGKSDLAMQLAQEIGGEIISGDSIQVYKGMDIG  64

Query  307  SAKPSLSERKEVPHHLIDILHPSE  378
            +AKP+ ++R+ +PHHLIDI + +E
Sbjct  65   TAKPTKADRELIPHHLIDIRNVTE  88



>ref|WP_042491656.1| transposase [Weissella hellenica]
Length=307

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            +K++VI GPT  GK+ L+L+LAK+ NGEI+S DS+Q+YRGLDIG+AK + +E+ +VPHHL
Sbjct  2    QKLVVIVGPTAVGKTALSLKLAKQFNGEIVSGDSMQIYRGLDIGTAKATPAEQAQVPHHL  61

Query  355  IDILHPSEG  381
            IDI +P+E 
Sbjct  62   IDIANPTEN  70



>ref|WP_035408737.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
sp. RIT341]
 gb|EZP61698.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
sp. RIT341]
Length=308

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK+ VIVI GPT  GK+K  +ELAKRLNGE++S DSVQVY+G+DIGSAK +  E + VPH
Sbjct  2    KKQPVIVIVGPTAVGKTKTGIELAKRLNGEVLSGDSVQVYQGMDIGSAKVTTEEMEGVPH  61

Query  349  HLIDILHPSEGIAI  390
            HL+D++ P + +++
Sbjct  62   HLLDLVTPDDEMSV  75



>ref|WP_023346603.1| tRNA dimethylallyltransferase [Firmicutes bacterium ASF500]
 gb|ESL14961.1| tRNA dimethylallyltransferase [Firmicutes bacterium ASF500]
Length=313

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K++VI+GPT +GK+ LA+ELAKR NGE++SADS+Q+YR +DIG+AKP+  E++ VPHH++
Sbjct  4    KILVITGPTASGKTALAVELAKRHNGEVVSADSMQIYRRMDIGTAKPTEVEKQGVPHHML  63

Query  358  DILHPSEGIAI  390
            D+  P E  ++
Sbjct  64   DVAEPEEDFSV  74



>ref|WP_026574979.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. UNC438CL73TsuS30]
Length=318

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+K++VI GPT  GK+KL++ELAKR NGEIIS DS+Q+YRG+DIG+AK    E + +PHH
Sbjct  4    KQKLLVIIGPTAVGKTKLSIELAKRFNGEIISGDSMQIYRGMDIGTAKIKPEEMEGIPHH  63

Query  352  LIDILHPSEGIAI  390
            LIDI  P E  ++
Sbjct  64   LIDIREPDESFSV  76



>ref|WP_027938231.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaeroarcus 
burkinensis]
Length=314

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KE+++V+ GPT  GK+ LA+ELA R +GE++S DS+ VYRG+DIG+AKPS  ER+ +PHH
Sbjct  2    KERLLVVLGPTAVGKTDLAVELALRHDGEVVSGDSMLVYRGMDIGTAKPSQEERRGIPHH  61

Query  352  LIDILHPSE  378
            LIDIL P+E
Sbjct  62   LIDILEPNE  70



>ref|WP_022119788.1| tRNA dimethylallyltransferase [Firmicutes bacterium CAG:56]
 emb|CDA64580.1| tRNA dimethylallyltransferase [Firmicutes bacterium CAG:56]
Length=317

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KE +I+++GPT  GK+ L+L LA+R+NGEIISADS+QVYRG+DIGSAK    E+K +PHH
Sbjct  3    KEPLIILTGPTAVGKTALSLSLAERVNGEIISADSMQVYRGMDIGSAKIMPEEQKGIPHH  62

Query  352  LIDILHPSEGIAI  390
            LID+L P E   +
Sbjct  63   LIDVLDPDEEFHV  75



>ref|WP_029341237.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Exiguobacterium]
Length=308

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK+ VIVI GPT  GK+K  +ELAKRLNGE++S DSVQVY+G+DIGSAK +  E + VPH
Sbjct  2    KKQPVIVIVGPTAVGKTKTGIELAKRLNGEVLSGDSVQVYQGMDIGSAKVTTEEMEGVPH  61

Query  349  HLIDILHPSEGIAI  390
            HL+D++ P + +++
Sbjct  62   HLLDLVTPDDEMSV  75



>ref|WP_018704354.1| hypothetical protein [Anaeromusa acidaminophila]
Length=314

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KE+++V+ GPT  GK+ LA+ELA R +GE++S DS+ VYRG+DIG+AKPS  ER+ +PHH
Sbjct  2    KERLLVVLGPTAVGKTDLAVELALRHDGEVVSGDSMLVYRGMDIGTAKPSQEERRGIPHH  61

Query  352  LIDILHPSE  378
            LIDIL P+E
Sbjct  62   LIDILEPNE  70



>ref|WP_021978227.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:793]
 emb|CCY99863.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:793]
Length=309

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +1

Query  166  GKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVP  345
             +K+ VIVI GPT +GK+KL +ELA+ LNGEIISADS+Q+Y+ +DIG+AKP+L ER+   
Sbjct  3    NEKKDVIVICGPTASGKTKLGIELARNLNGEIISADSMQIYKDMDIGTAKPTLEERQMAV  62

Query  346  HHLIDILHPSEGIAI  390
            HHL+D + P +  ++
Sbjct  63   HHLVDFVSPDQRYSV  77



>ref|WP_044664332.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Syntrophaceticus 
schinkii]
Length=315

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            ++VI+GPT AGKSK+A+ELA +LNGEIISADSVQ+Y+  +IG+AK +L E+K VPHHL D
Sbjct  5    LVVIAGPTAAGKSKIAVELALKLNGEIISADSVQLYKYFNIGAAKLTLEEQKGVPHHLFD  64

Query  361  ILHPSEGIAI  390
            +L P E  ++
Sbjct  65   VLEPDEHFSV  74



>emb|CEO88093.1| tRNA dimethylallyltransferase [Syntrophaceticus schinkii]
Length=322

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            ++VI+GPT AGKSK+A+ELA +LNGEIISADSVQ+Y+  +IG+AK +L E+K VPHHL D
Sbjct  12   LVVIAGPTAAGKSKIAVELALKLNGEIISADSVQLYKYFNIGAAKLTLEEQKGVPHHLFD  71

Query  361  ILHPSEGIAI  390
            +L P E  ++
Sbjct  72   VLEPDEHFSV  81



>ref|WP_012727998.1| tRNA dimethylallyltransferase [Chlamydia trachomatis]
 emb|CAX11225.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Chlamydia 
trachomatis B/Jali20/OT]
Length=339

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K  VI+++GPTG+GK+ ++L+LA  ++GEIIS DS+QVYRG+DIG+AK SL++RKEVPHH
Sbjct  28   KRTVILLAGPTGSGKTAVSLKLAPLVDGEIISVDSMQVYRGMDIGTAKVSLADRKEVPHH  87

Query  352  LIDILHPSEGI  384
            LID+ H  E  
Sbjct  88   LIDVCHVQESF  98



>ref|WP_023467752.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
sp. MH3]
 gb|AHA29364.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
sp. MH3]
Length=308

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK+ VIVI GPT  GK+K  +ELAKRLNGE++S DSVQVY+G+DIGSAK +  E + VPH
Sbjct  2    KKQPVIVIVGPTAVGKTKTGIELAKRLNGEVLSGDSVQVYQGMDIGSAKVTTEEMEGVPH  61

Query  349  HLIDILHPSEGIAI  390
            HL+D++ P + +++
Sbjct  62   HLLDLVTPDDEMSV  75



>ref|WP_003776707.1| tRNA dimethylallyltransferase [Alloiococcus otitis]
 gb|EKU94307.1| tRNA dimethylallyltransferase [Alloiococcus otitis ATCC 51267]
Length=315

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK+IVI GPTG GK+KL+LELA+ L GEII+ DS+QVYRGLDIG+ K + SE+  +PHH
Sbjct  2    KEKIIVIVGPTGVGKTKLSLELAQDLAGEIINGDSMQVYRGLDIGTGKVTESEKAGIPHH  61

Query  352  LIDILHPSEGIAI  390
            L+DIL   E  ++
Sbjct  62   LLDILEVQEDYSV  74



>ref|WP_034265185.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. Aph1]
Length=316

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            VPH+LIDI  P E  ++
Sbjct  61   VPHYLIDIKEPDESFSV  77



>ref|WP_027347297.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Helcococcus 
sueciensis]
Length=302

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            VI+I+GPT  GK+ L++ LAK+LN EIISADS+Q+YRG+DIG+AK +L E + + HH+ID
Sbjct  4    VIIIAGPTAVGKTALSINLAKKLNTEIISADSMQIYRGMDIGTAKANLEEMQGIKHHMID  63

Query  361  ILHPSEGIAI  390
            IL+P+E  ++
Sbjct  64   ILNPNENFSV  73



>ref|WP_002463888.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Staphylococcus 
simiae]
 gb|EHJ07934.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Staphylococcus 
simiae CCM 7213]
Length=310

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  166  GKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVP  345
             KK  +I I GPT +GK++L++ELAKRLNGEIIS DS+QVY+ +DIG+AK +L E   VP
Sbjct  2    AKKPFIIAIVGPTASGKTELSIELAKRLNGEIISGDSMQVYKTMDIGTAKVTLEEMDGVP  61

Query  346  HHLIDILHPSEGIA  387
            HHLIDIL P +  +
Sbjct  62   HHLIDILEPDDTFS  75



>ref|WP_033579840.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
aryabhattai]
Length=316

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            VPH+LIDI  P E  ++
Sbjct  61   VPHYLIDIKEPDESFSV  77



>ref|WP_045519456.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
niacini]
Length=318

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+K++VI GPT  GK+KL++ELAK+ NGEIIS DS+Q+YRG+DIG+AK  + E + +PHH
Sbjct  4    KQKLLVIIGPTAVGKTKLSIELAKQYNGEIISGDSMQIYRGMDIGTAKIKIEEMEGIPHH  63

Query  352  LIDILHPSEGIA  387
            LIDI  P E  +
Sbjct  64   LIDIKEPDESFS  75



>ref|WP_013778391.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Tepidanaerobacter 
acetatoxydans]
 gb|AEE91468.1| tRNA dimethylallyltransferase [Tepidanaerobacter acetatoxydans 
Re1]
 emb|CCP26174.1| tRNA dimethylallyltransferase [Tepidanaerobacter acetatoxydans 
Re1]
Length=314

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+ ++VI GPT  GK+++A+E+A++++ EIISADS+Q+YR +DIG+ KPSL ERK +PHH
Sbjct  3    KKFLVVIVGPTAVGKTEIAIEVAQKIDAEIISADSMQIYRYMDIGTDKPSLEERKRIPHH  62

Query  352  LIDILHPSE  378
            +IDI+ P E
Sbjct  63   MIDIVDPDE  71



>gb|KIO58884.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
thermoamylovorans]
 gb|KIO67393.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
thermoamylovorans]
Length=320

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++ I GPT  GK+KL+++LAK+ +GEIIS DS+Q+YRGLDIG+AK S  E K +PHH
Sbjct  7    KEKLLCIIGPTAVGKTKLSIDLAKQFHGEIISGDSMQIYRGLDIGTAKISKEEMKGIPHH  66

Query  352  LIDILHPSEGIAI  390
            LIDI +P E  ++
Sbjct  67   LIDIKNPDESFSV  79



>ref|WP_026106681.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium]
Length=316

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            VPH+LIDI  P E  ++
Sbjct  61   VPHYLIDIKEPDESFSV  77



>ref|WP_028411375.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. 278922_107]
Length=316

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            VPH+LIDI  P E  ++
Sbjct  61   VPHYLIDIKEPDESFSV  77



>ref|WP_045817386.1| hypothetical protein [Teredinibacter sp. 1162T.S.0a.05]
Length=325

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            +VI + GPT +GKS L LELA+R   EI++ DS QVYRGLDIGSAKPSL ERKE+PHHL+
Sbjct  8    QVITLMGPTASGKSALGLELARRFPCEIVNVDSAQVYRGLDIGSAKPSLEERKEIPHHLL  67

Query  358  DILHPSE  378
            DI  P +
Sbjct  68   DIRDPGD  74



>ref|WP_025173040.1| hypothetical protein, partial [Streptococcus pneumoniae]
Length=124

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K K+IVI GPT  GK+ LA+E+AKR NGE++S DS QVYRGLDIG+AK S  E+  VPHH
Sbjct  2    KTKIIVIVGPTAVGKTALAIEVAKRFNGEVVSGDSQQVYRGLDIGTAKASPEEQAAVPHH  61

Query  352  LIDILHPSE  378
            LID+   +E
Sbjct  62   LIDVREITE  70



>gb|KIO74218.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
thermoamylovorans]
Length=320

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++ I GPT  GK+KL+++LAK+ +GEIIS DS+Q+YRGLDIG+AK S  E K +PHH
Sbjct  7    KEKLLCIIGPTAVGKTKLSIDLAKQFHGEIISGDSMQIYRGLDIGTAKISKEEMKGIPHH  66

Query  352  LIDILHPSEGIAI  390
            LIDI +P E  ++
Sbjct  67   LIDIKNPDESFSV  79



>ref|WP_041845208.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
thermoamylovorans]
Length=316

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++ I GPT  GK+KL+++LAK+ +GEIIS DS+Q+YRGLDIG+AK S  E K +PHH
Sbjct  3    KEKLLCIIGPTAVGKTKLSIDLAKQFHGEIISGDSMQIYRGLDIGTAKISKEEMKGIPHH  62

Query  352  LIDILHPSEGIAI  390
            LIDI +P E  ++
Sbjct  63   LIDIKNPDESFSV  75



>ref|WP_023495426.1| tRNA dimethylallyltransferase MiaA [Methyloglobulus morosus]
 gb|ESS71500.1| tRNA dimethylallyltransferase MiaA [Methyloglobulus morosus KoM1]
Length=315

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  184  IVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLIDI  363
            I + GPT +GKSKLA++LA+ LNGEIIS DSV VYRG+DIG+AKP+L ER  V HHLIDI
Sbjct  10   IFLMGPTASGKSKLAVQLAQALNGEIISVDSVLVYRGMDIGTAKPALEERAGVAHHLIDI  69

Query  364  LHPSEGIA  387
            L P+E  +
Sbjct  70   LDPAESFS  77



>ref|WP_037559111.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Staphylococcus 
sp. HGB0015]
Length=321

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            V GKK  ++VI GPT +GK++L +ELAK +NGE+IS DS+QVYRG++IG+AK + SE + 
Sbjct  4    VIGKKPFIVVIVGPTASGKTELGVELAKEINGEVISGDSMQVYRGMNIGTAKVTESEMQG  63

Query  340  VPHHLIDILHPSE  378
            +PHHLIDIL+P +
Sbjct  64   IPHHLIDILNPGQ  76



>ref|WP_014458499.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium]
 gb|AEN88006.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium WSH-002]
Length=316

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            VPH+LIDI  P E  ++
Sbjct  61   VPHYLIDIKEPDESFSV  77



>ref|WP_034769974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
thermoamylovorans]
 emb|CEE01518.1| tRNA dimethylallyltransferase [Bacillus thermoamylovorans]
Length=316

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++ I GPT  GK+KL+++LAK+ +GEIIS DS+Q+YRGLDIG+AK S  E K +PHH
Sbjct  3    KEKLLCIIGPTAVGKTKLSIDLAKQFHGEIISGDSMQIYRGLDIGTAKISKEEMKGIPHH  62

Query  352  LIDILHPSEGIAI  390
            LIDI +P E  ++
Sbjct  63   LIDIKNPDESFSV  75



>ref|WP_017365173.1| tRNA dimethylallyltransferase [Methylococcus capsulatus]
Length=312

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            V+V+ GPT +GKS+LA+ELA  L+GEI+S DS  VYRG+DIG+AKP+ +ER  VPHHLID
Sbjct  9    VVVLMGPTASGKSQLAIELANALDGEIVSVDSSLVYRGMDIGTAKPTPTERAAVPHHLID  68

Query  361  ILHPSE  378
            +L PSE
Sbjct  69   VLDPSE  74



>ref|WP_021953070.1| tRNA dimethylallyltransferase [Eubacterium sp. CAG:161]
 emb|CCY70884.1| tRNA dimethylallyltransferase [Eubacterium sp. CAG:161]
Length=318

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+K+I+++GPT  GK++LA++LA ++NGEIISADS+QVYR +DIGSAK   SE K + HH
Sbjct  2    KKKLIIVTGPTAVGKTELAIDLANKVNGEIISADSIQVYRYMDIGSAKVLPSETKGIKHH  61

Query  352  LIDILHPSEGIAI  390
            LID+L+P E   I
Sbjct  62   LIDVLNPDEEFNI  74



>ref|WP_034654991.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium]
 gb|KFN00134.1| tRNA dimethylallyltransferase [Bacillus megaterium]
 gb|KGJ73237.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium NBRC 15308 = ATCC 14581]
 gb|AJI23616.1| tRNA dimethylallyltransferase [Bacillus megaterium NBRC 15308 
= ATCC 14581]
Length=316

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            VPH+LIDI  P E  ++
Sbjct  61   VPHYLIDIKEPDESFSV  77



>gb|EOB27113.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [Streptococcus 
pneumoniae 357]
Length=132

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K K+IVI GPT  GK+ LA+E+AKR NGE++S DS QVYRGLDIG+AK S  E+  VPHH
Sbjct  10   KTKIIVIVGPTAVGKTALAIEVAKRFNGEVVSGDSQQVYRGLDIGTAKASPEEQAAVPHH  69

Query  352  LIDILHPSE  378
            LID+   +E
Sbjct  70   LIDVREITE  78



>ref|WP_026566589.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. UNC41MFS5]
Length=318

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+K++VI GPT  GK+KL++E+AKR NGEIIS DS+Q+YRG+DIG+AK    E + +PHH
Sbjct  4    KQKLLVIIGPTAVGKTKLSIEMAKRYNGEIISGDSMQIYRGMDIGTAKIKPEEMEGIPHH  63

Query  352  LIDILHPSEGIAI  390
            LIDI  P+E  ++
Sbjct  64   LIDIKEPTENFSV  76



>ref|WP_010960949.1| tRNA dimethylallyltransferase [Methylococcus capsulatus]
 sp|Q607R4.1|MIAA_METCA RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA 
dimethylallyltransferase; Short=DMATase; AltName: 
Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; 
Short=IPP transferase; Short=IPPT; Short=IPTase [Methylococcus 
capsulatus str. Bath]
 gb|AAU92073.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylococcus 
capsulatus str. Bath]
Length=312

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            V+V+ GPT +GKS+LA+ELA  L+GEI+S DS  VYRG+DIG+AKP+ +ER  VPHHLID
Sbjct  9    VVVLMGPTASGKSQLAIELANALDGEIVSVDSSLVYRGMDIGTAKPTPTERAAVPHHLID  68

Query  361  ILHPSE  378
            +L PSE
Sbjct  69   VLDPSE  74



>ref|WP_041966639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
selenatarsenatis]
 dbj|GAM14944.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
selenatarsenatis SF-1]
Length=317

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K+K+IV+ GPT  GK+KL++ELAK+ NGEIIS DS+Q+Y+G+DIG+AK +  E + VPH
Sbjct  3    QKQKLIVLIGPTAVGKTKLSIELAKKFNGEIISGDSMQIYKGMDIGTAKITQEEMEGVPH  62

Query  349  HLIDILHPSEGIA  387
            HLIDI  P E  +
Sbjct  63   HLIDIKEPDESFS  75



>ref|WP_035048460.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anoxybacillus 
sp. KU2-6(11)]
 gb|KFZ42816.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anoxybacillus 
sp. KU2-6(11)]
Length=311

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            EKV+V+ GPT  GK+K+++ELAKRLNGEII+ DS+QVY+GLDIG+AK    E + +PHHL
Sbjct  3    EKVVVLIGPTAVGKTKMSIELAKRLNGEIINGDSMQVYKGLDIGTAKIRQEEMEGIPHHL  62

Query  355  IDILHPSEGIAI  390
            +DI  P E  ++
Sbjct  63   LDIKEPHESFSV  74



>ref|WP_025746645.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caldicoprobacter 
oshimai]
Length=316

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K+ ++VI GPT  GK++L++ELAK LNGEI+SADS+Q+YR +DIG+AKP+  ER+ +PH
Sbjct  2    EKKPLVVIVGPTAVGKTRLSIELAKALNGEIVSADSMQIYRYMDIGTAKPTAEERQGIPH  61

Query  349  HLIDILHPSEGIAI  390
            H++DI+ P +  ++
Sbjct  62   HMMDIIDPGQEFSV  75



>ref|WP_043976720.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
aryabhattai]
Length=316

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            +PH+LIDI  P E  ++
Sbjct  61   IPHYLIDIKEPDESFSV  77



>ref|WP_015721776.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter 
sp. M18]
 gb|ADW14951.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter 
sp. M18]
Length=304

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK K++V+ GPTG+GKS LAL LA+ ++ EI++ADS+Q+YRGLDIG+AKPS  E   VPH
Sbjct  4    KKIKLLVVGGPTGSGKSDLALRLAEEIDAEIVNADSMQIYRGLDIGTAKPSPEELARVPH  63

Query  349  HLIDILHPSEGI  384
            HLIDI+ P +  
Sbjct  64   HLIDIVSPDQAF  75



>ref|WP_044894154.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
alveayuensis]
Length=315

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  EKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHL  354
            EK++VI GPT  GK+KL++ELAKRL+GEIIS DS+QVY+G+DIG+AK    E   +PHHL
Sbjct  3    EKLVVIIGPTAVGKTKLSIELAKRLDGEIISGDSMQVYKGMDIGTAKIKPEEMDGIPHHL  62

Query  355  IDILHPSEGIAI  390
            IDI  P+E  ++
Sbjct  63   IDIKEPTESFSV  74



>ref|WP_045614123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Streptococcus 
mitis]
 gb|KJQ76174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Streptococcus 
mitis]
Length=294

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K K+IVI GPT  GK+ LA+E+A+R NGE++S DS QVYRGLDIG+AK SL E+  VPHH
Sbjct  2    KSKIIVIVGPTAVGKTALAIEVAQRFNGEVVSGDSQQVYRGLDIGTAKASLEEQATVPHH  61

Query  352  LIDILHPSE  378
            LID+   +E
Sbjct  62   LIDVRDVTE  70



>ref|WP_025908612.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
flexus]
Length=316

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K+K+IVI GPT  GK+KL++E+AK LNGE+IS DS+Q+Y+ +DIG+AK +  E + 
Sbjct  1    MTGEKQKLIVIIGPTAVGKTKLSIEMAKLLNGEVISGDSMQIYKKMDIGTAKVTSDEMEG  60

Query  340  VPHHLIDILHPSEGIAI  390
            +PHHLIDI  P+E  ++
Sbjct  61   IPHHLIDIKEPTESFSV  77



>ref|WP_010898520.1| tRNA dimethylallyltransferase [Bacillus halodurans]
 sp|Q9KAC3.1|MIAA_BACHD RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA 
dimethylallyltransferase; Short=DMATase; AltName: 
Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; 
Short=IPP transferase; Short=IPPT; Short=IPTase [Bacillus halodurans 
C-125]
 dbj|BAB06085.1| tRNA isopentenylpyrophosphate transferase [Bacillus halodurans 
C-125]
Length=314

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++ I GPT  GK+K ++ LAKRLNGE+IS DS+QVYRG+DIG+AK +  E   VPHH
Sbjct  2    KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHH  61

Query  352  LIDILHPSEGIAI  390
            LIDI  PSE  ++
Sbjct  62   LIDIKDPSESFSV  74



>ref|WP_045290249.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
aryabhattai]
 gb|KJL06563.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
aryabhattai B8W22]
Length=316

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            +PH+LIDI  P E  ++
Sbjct  61   IPHYLIDIKEPDESFSV  77



>ref|WP_032099554.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anoxybacillus 
flavithermus]
Length=311

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            +EKV+V+ GPT  GK+K+++ELAKRLNGEII+ DS+QVY+GLDIG+AK    E + +PHH
Sbjct  2    EEKVVVLIGPTAVGKTKMSVELAKRLNGEIINGDSMQVYKGLDIGTAKIRQEEMEGIPHH  61

Query  352  LIDILHPSEGIAI  390
            L+DI  P E  ++
Sbjct  62   LLDIKEPHESFSV  74



>ref|WP_040934518.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Prochloron 
didemni]
Length=303

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IVI G T  GKS LALELA+RLN  I+SADS QVYR LDIG+AKP+L+E++ VPH+LID
Sbjct  2    LIVICGATATGKSGLALELARRLNSVILSADSRQVYRELDIGTAKPTLAEQQSVPHYLID  61

Query  361  ILHPSEGIAI  390
            I HP+E + +
Sbjct  62   ICHPTETLTL  71



>ref|WP_013058792.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Bacillus]
 gb|ADE71118.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium QM B1551]
Length=316

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            +PH+LIDI  P E  ++
Sbjct  61   IPHYLIDIKEPDESFSV  77



>ref|WP_003349182.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
methanolicus]
 gb|EIJ79670.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
methanolicus MGA3]
 gb|AIE59739.1| tRNA dimethylallyltransferase [Bacillus methanolicus MGA3]
Length=320

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK+ V+ GPT  GK+KL++ELAKRLNGEIIS DS+Q+YRG+DIG+AK    E + +PH+
Sbjct  4    KEKLAVLIGPTAVGKTKLSIELAKRLNGEIISGDSMQIYRGMDIGTAKIKKEEMEGIPHY  63

Query  352  LIDILHPSEGIAI  390
            LIDI  P E  ++
Sbjct  64   LIDIKDPDESFSV  76



>ref|WP_040189931.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Leuconostoc 
citreum]
 emb|CDX64321.1| tRNA dimethylallyltransferase [Leuconostoc citreum]
Length=294

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K++VI+GPT +GKS LA+ +A+R NGEI+SAD++Q+YRGLDIG+AK + +ER+ VPHHLI
Sbjct  3    KIVVIAGPTASGKSDLAISVAQRFNGEIVSADAMQIYRGLDIGTAKVTKAERELVPHHLI  62

Query  358  DILHPSEGIAI  390
            DI+  ++  ++
Sbjct  63   DIVDMTDKFSV  73



>ref|WP_038541321.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. X1(2014)]
 gb|AIM17767.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. X1(2014)]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+K++VI GPT  GK+KL++ELA R NGEIIS DS+Q+YRG+DIG+AK +  E + +PHH
Sbjct  4    KQKLLVIIGPTAVGKTKLSIELAHRFNGEIISGDSMQIYRGMDIGTAKITKDEMEGIPHH  63

Query  352  LIDILHPSEGIAI  390
            LIDI  P E  ++
Sbjct  64   LIDIKEPYENFSV  76



>ref|WP_025750259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
flexus]
Length=316

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL+LELAK+L+GEIIS DS+Q+Y+G+DIG+AK +  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSLELAKQLDGEIISGDSMQIYKGMDIGTAKVTEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            +PH+LIDI  P E  ++
Sbjct  61   IPHYLIDIKEPDESFSV  77



>ref|WP_013084737.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium]
 gb|ADF40923.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
megaterium DSM 319]
Length=316

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  160  VAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKE  339
            + G+K K+IVI GPT  GK+KL++ELAK+L+GEIIS DS+Q+Y+G+DIG+AK S  E + 
Sbjct  1    MTGEKPKLIVIIGPTAVGKTKLSIELAKQLDGEIISGDSMQIYKGMDIGTAKVSEEEMQG  60

Query  340  VPHHLIDILHPSEGIAI  390
            +PH+LIDI  P E  ++
Sbjct  61   IPHYLIDIKEPDESFSV  77



>ref|WP_015739879.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ammonifex 
degensii]
 gb|ACX53002.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ammonifex 
degensii KC4]
Length=315

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            ++VI+GPT  GK+ + +E+A RL GEIISADS+ VY+G+DIG+AKPSL ERK VPHHLID
Sbjct  7    LVVITGPTATGKTAVGIEVALRLGGEIISADSMMVYKGMDIGTAKPSLEERKGVPHHLID  66

Query  361  ILHPSEGIAI  390
            ++ P E  ++
Sbjct  67   VVEPHEHFSV  76



>ref|WP_007786918.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
sp. CF112]
 gb|EJL39430.1| tRNA isopentenyltransferase MiaA [Brevibacillus sp. CF112]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KEK++VI GPT  GK++L+L+LA++ NGEIIS DS+QVYRG+DIG+AK   +E   VPH
Sbjct  5    QKEKLVVIIGPTAVGKTQLSLDLAQQFNGEIISGDSMQVYRGMDIGTAKAEPAELALVPH  64

Query  349  HLIDILHPSEGIAI*ILSKN  408
            HLIDI +P E  ++ +  ++
Sbjct  65   HLIDIKNPDEEYSVALFQES  84



>ref|WP_029281153.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
indicus]
 gb|KEZ50178.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
indicus LMG 22858]
Length=313

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KKEK++VI GPT  GK+KL++ELAKRLN EIIS DS+Q+YRG+DIG+AK +  E   V H
Sbjct  2    KKEKLLVIIGPTAVGKTKLSIELAKRLNSEIISGDSMQIYRGMDIGTAKAAPDEMDGVHH  61

Query  349  HLIDILHPSEGIA  387
            HLIDI  P E  +
Sbjct  62   HLIDIKDPDESFS  74



>ref|WP_018946838.1| hypothetical protein [Thioalkalivibrio sp. AKL17]
Length=311

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            V++++GPT  GK+ LALELA+RL+ EI++ADS QVYRG+DIG+AKP   ER  VPHHL+D
Sbjct  8    VVLLAGPTATGKTGLALELAQRLDAEIVTADSAQVYRGMDIGTAKPDADERARVPHHLLD  67

Query  361  ILHPSE  378
            I  P E
Sbjct  68   IRDPEE  73



>ref|WP_004903209.1| tRNA dimethylallyltransferase [Leuconostoc citreum]
 emb|CCF25338.1| tRNA dimethylallyltransferase [Leuconostoc citreum LBAE C10]
Length=294

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K++VI+GPT +GKS LA+ +A+R NGEI+SAD++Q+YRGLDIG+AK + +ER+ VPHHLI
Sbjct  3    KIVVIAGPTASGKSDLAISVAQRFNGEIVSADAMQIYRGLDIGTAKVTKAERELVPHHLI  62

Query  358  DILHPSEGIAI  390
            DI+  ++  ++
Sbjct  63   DIVDMTDKFSV  73



>ref|WP_004909098.1| tRNA dimethylallyltransferase [Leuconostoc citreum]
 sp|B1MXL9.1|MIAA_LEUCK RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA 
dimethylallyltransferase; Short=DMATase; AltName: 
Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; 
Short=IPP transferase; Short=IPPT; Short=IPTase [Leuconostoc 
citreum KM20]
 gb|ACA82271.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Leuconostoc 
citreum KM20]
 emb|CCF29228.1| tRNA dimethylallyltransferase [Leuconostoc citreum LBAE E16]
Length=294

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K++VI+GPT +GKS LA+ +A+R NGEI+SAD++Q+YRGLDIG+AK + +ER+ VPHHLI
Sbjct  3    KIVVIAGPTASGKSDLAISVAQRFNGEIVSADAMQIYRGLDIGTAKVTKAERELVPHHLI  62

Query  358  DILHPSEGIAI  390
            DI+  ++  ++
Sbjct  63   DIVDMTDKFSV  73



>ref|WP_023614788.1| hypothetical protein [Bacillus sp. 17376]
 gb|ESU32943.1| hypothetical protein G3A_07830 [Bacillus sp. 17376]
Length=317

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +++K+IV+ GPT  GK+KL++ELAK+ NGEIIS DS+Q+Y+G+DIG+AK +  E + +PH
Sbjct  3    QRQKLIVLIGPTAVGKTKLSIELAKKFNGEIISGDSMQIYKGMDIGTAKITREEMERIPH  62

Query  349  HLIDILHPSEGIA  387
            HLIDI  P E  +
Sbjct  63   HLIDIKQPDESFS  75



>ref|WP_035240320.1| tRNA dimethylallyltransferase [Acidobacteriaceae bacterium URHE0068]
Length=303

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            V+++ GPTG+GK+ L+L+LA+R NGEI+S DS+ VYRG+D+GSAKPS  ER  VPHHLID
Sbjct  2    VVIVLGPTGSGKTALSLDLAERFNGEIVSCDSIAVYRGMDVGSAKPSSQERARVPHHLID  61

Query  361  ILHPS  375
            +  P 
Sbjct  62   VADPD  66



>ref|WP_008907915.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caloramator 
australicus]
 emb|CCJ32635.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caloramator 
australicus RC3]
Length=314

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            K+ +++I+GPT +GK+K+ +ELAK+++GEI+SADS+Q+Y+ +DIGSAKP+  E + VPHH
Sbjct  2    KKNIVIIAGPTASGKTKIGIELAKKIDGEIVSADSMQIYKYMDIGSAKPTREEMQGVPHH  61

Query  352  LIDILHPSEGIAI  390
            +ID++ P E  ++
Sbjct  62   MIDVVDPKEEFSV  74



>ref|WP_005835646.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Bacillales]
 gb|ELK39562.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
agri BAB-2500]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KEK++VI GPT  GK++L+L+LA++ NGEIIS DS+QVYRG+DIG+AK   +E   VPH
Sbjct  5    QKEKLVVIIGPTAVGKTQLSLDLAQQFNGEIISGDSMQVYRGMDIGTAKAEPAELALVPH  64

Query  349  HLIDILHPSEGIAI*ILSKN  408
            HLIDI +P E  ++ +  ++
Sbjct  65   HLIDIKNPDEEYSVALFQES  84



>ref|WP_025083957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fuchuensis]
Length=310

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEKV+VI GPTG GK+ L+L LA++LNGEIIS DS+QVYR LDIG+AK + +E+ + PHH
Sbjct  3    KEKVLVIVGPTGVGKTALSLTLAQQLNGEIISGDSMQVYRQLDIGTAKATPAEQAQAPHH  62

Query  352  LIDILHPSE  378
            LIDI+   E
Sbjct  63   LIDIVDVQE  71



>ref|WP_040176650.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Leuconostoc 
citreum]
 emb|CDX66042.1| tRNA dimethylallyltransferase [Leuconostoc citreum]
Length=294

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K++VI+GPT +GKS LA+ +A+R NGEI+SAD++Q+YRGLDIG+AK + +ER+ VPHHLI
Sbjct  3    KIVVIAGPTASGKSDLAISVAQRFNGEIVSADAMQIYRGLDIGTAKVTKAERELVPHHLI  62

Query  358  DILHPSEGIAI  390
            DI+  ++  ++
Sbjct  63   DIVDMTDKFSV  73



>ref|WP_004905757.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Leuconostoc 
citreum]
 emb|CCF27109.1| tRNA dimethylallyltransferase [Leuconostoc citreum LBAE C11]
Length=294

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  KVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLI  357
            K++VI+GPT +GKS LA+ +A+R NGEI+SAD++Q+YRGLDIG+AK + +ER+ VPHHLI
Sbjct  3    KIVVIAGPTASGKSDLAISVAQRFNGEIVSADAMQIYRGLDIGTAKVTKAERELVPHHLI  62

Query  358  DILHPSEGIAI  390
            DI+  ++  ++
Sbjct  63   DIVDMTDKFSV  73



>ref|WP_003385748.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
borstelensis]
 gb|EMT54070.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
borstelensis AK1]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KE+++VI GPT  GK+ L+LELA++  GEIIS DS+QVYRG+DIG+AK S +E  +VPH
Sbjct  5    EKERLVVIVGPTAVGKTALSLELAEQFRGEIISGDSMQVYRGMDIGTAKASPAELAKVPH  64

Query  349  HLIDILHPSEGIAI  390
            HLIDI+ P E  ++
Sbjct  65   HLIDIIDPDEEYSV  78



>dbj|GAE91531.1| tRNA dimethylallyltransferase [Gracilibacillus boraciitolerans 
JCM 21714]
Length=130

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KEK++VI GPT  GK+ LA+ELAK  NGE+IS DS+Q+Y+GLDIG+AK +  E   + HH
Sbjct  2    KEKLVVIVGPTAVGKTALAIELAKTFNGEVISGDSMQIYQGLDIGTAKVTKEEMSGITHH  61

Query  352  LIDILHPSEGIAI  390
            ++DI+ PS+  ++
Sbjct  62   MVDIIDPSQDFSV  74



>ref|WP_013842002.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfotomaculum 
ruminis]
 gb|AEG60240.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfotomaculum 
ruminis DSM 2154]
Length=311

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  181  VIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHHLID  360
            +IV+ GPT  GK+ L++E+AK++ GEIISADS+ VYRG+DIG+AKP+L+ER+ +PHHLID
Sbjct  7    LIVMVGPTATGKTDLSIEVAKKVRGEIISADSMLVYRGMDIGTAKPTLAERQGIPHHLID  66

Query  361  ILHPSEGIAI  390
            I++P +  ++
Sbjct  67   IVNPDQEYSV  76



>gb|EPE61515.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
sp. S17]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK  VIVI GPT  GK+K  +ELAK  +GEI+S DSVQVYRG+DIGSAK ++ E + VPH
Sbjct  5    KKTPVIVIVGPTAVGKTKTGIELAKAFDGEIVSGDSVQVYRGMDIGSAKVTVEEAEGVPH  64

Query  349  HLIDILHPSEGIAI  390
            HLIDI  P E +++
Sbjct  65   HLIDICDPDEAMSV  78



>ref|WP_024983805.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
borstelensis]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +KE+++VI GPT  GK+ L+LELA++  GEIIS DS+QVYRG+DIG+AK S  E  +VPH
Sbjct  5    EKERLVVIVGPTAVGKTALSLELAEQFRGEIISGDSMQVYRGMDIGTAKASPDELAKVPH  64

Query  349  HLIDILHPSEGIAI  390
            HLIDI+ P E  ++
Sbjct  65   HLIDIIDPDEEYSV  78



>ref|WP_008398174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium 
sp. M62/1]
 gb|EFE11743.1| tRNA dimethylallyltransferase [Clostridium sp. M62/1]
Length=338

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K  +I+I+GPT +GK+ L++ELAKR+ GEIISADS+QVYR +DIGSAK +  E   VPH
Sbjct  3    QKRPLIIITGPTASGKTALSIELAKRIGGEIISADSMQVYRHMDIGSAKVTEEEMDGVPH  62

Query  349  HLIDILHPSEGIAI  390
            HLID+L PSE   +
Sbjct  63   HLIDVLEPSEDFNV  76



>emb|CBK77990.1| tRNA isopentenyltransferase (miaA) [ [[Clostridium] cf. saccharolyticum 
K10]
Length=343

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K  +I+I+GPT +GK+ L++ELAKR+ GEIISADS+QVYR +DIGSAK +  E   VPH
Sbjct  3    QKRPLIIITGPTASGKTALSIELAKRIGGEIISADSMQVYRHMDIGSAKVTEEEMDGVPH  62

Query  349  HLIDILHPSEGIAI  390
            HLID+L PSE   +
Sbjct  63   HLIDVLEPSEDFNV  76



>ref|WP_035386423.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
sp. S17]
Length=316

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            KK  VIVI GPT  GK+K  +ELAK  +GEI+S DSVQVYRG+DIGSAK ++ E + VPH
Sbjct  2    KKTPVIVIVGPTAVGKTKTGIELAKAFDGEIVSGDSVQVYRGMDIGSAKVTVEEAEGVPH  61

Query  349  HLIDILHPSEGIAI  390
            HLIDI  P E +++
Sbjct  62   HLIDICDPDEAMSV  75



>ref|WP_021966577.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:149]
 emb|CCY85046.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:149]
Length=338

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K  +I+I+GPT +GK+ L++ELAKR+ GEIISADS+QVYR +DIGSAK +  E   VPH
Sbjct  3    QKRPLIIITGPTASGKTALSIELAKRIGGEIISADSMQVYRHMDIGSAKVTEEEMDGVPH  62

Query  349  HLIDILHPSEGIAI  390
            HLID+L PSE   +
Sbjct  63   HLIDVLEPSEDFNV  76



>ref|WP_021067303.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
pavilionensis]
 gb|ERG66675.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium 
pavilionensis RW-2]
Length=316

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  169  KKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPH  348
            +K  VIV+ GPT  GK+K  +ELAK  NGEI+S DSVQVYRG+DIGSAK ++ E + VPH
Sbjct  2    EKTPVIVLVGPTAVGKTKTGIELAKAFNGEIVSGDSVQVYRGMDIGSAKVTVEEAEGVPH  61

Query  349  HLIDILHPSEGIAI*ILSK  405
            HLIDI  P E +++    K
Sbjct  62   HLIDICDPDEAMSVATFQK  80



>gb|EKQ69151.1| tRNA isopentenyltransferase MiaA [Oscillatoriales cyanobacterium 
JSC-12]
Length=359

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 4/85 (5%)
 Frame = +1

Query  136  SCSASTKPVAGKKEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAK  315
            + S +  P+ G    +IVI GPT  GKS LA+ LAKRLN  I+SADS QVYR  +IG+AK
Sbjct  11   NISKNNTPILG----LIVICGPTAMGKSSLAIALAKRLNSVILSADSRQVYREFNIGTAK  66

Query  316  PSLSERKEVPHHLIDILHPSEGIAI  390
            P+L+E+KEVPH+LIDI  P+E + +
Sbjct  67   PTLAEQKEVPHYLIDICDPTETLTL  91



>ref|WP_026674201.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
bogoriensis]
Length=313

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  172  KEKVIVISGPTGAGKSKLALELAKRLNGEIISADSVQVYRGLDIGSAKPSLSERKEVPHH  351
            KE ++VI GPT  GK+K++++LAK  NGEIIS DS+QVY+G+DIG+AK +  E  +VPHH
Sbjct  2    KENLVVIVGPTAVGKTKMSVDLAKLFNGEIISGDSMQVYKGMDIGTAKITTEEMGDVPHH  61

Query  352  LIDILHPSEGIAI  390
            LIDI  P+E  ++
Sbjct  62   LIDIKQPTESFSV  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677