BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13122

Length=876
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622904.1|  PREDICTED: uncharacterized protein LOC104114...    187   4e-50   
ref|XP_009622901.1|  PREDICTED: uncharacterized protein LOC104114...    186   2e-49   Nicotiana tomentosiformis
ref|XP_009586951.1|  PREDICTED: uncharacterized protein LOC104084...    178   4e-49   
ref|XP_009586937.1|  PREDICTED: uncharacterized protein LOC104084...    179   7e-49   
ref|XP_009798287.1|  PREDICTED: uncharacterized protein LOC104244540    182   7e-48   Nicotiana sylvestris
ref|XP_006355214.1|  PREDICTED: uncharacterized protein LOC102585966    176   1e-45   Solanum tuberosum [potatoes]
ref|XP_004246076.1|  PREDICTED: uncharacterized protein LOC101247741    174   3e-45   Solanum lycopersicum
ref|XP_011082268.1|  PREDICTED: uncharacterized protein LOC105165093    164   2e-41   Sesamum indicum [beniseed]
ref|XP_007011534.1|  ABC1 family protein                                162   5e-41   
ref|XP_002874225.1|  ABC1 family protein                                162   7e-41   Arabidopsis lyrata subsp. lyrata
emb|CDP19648.1|  unnamed protein product                                154   1e-40   Coffea canephora [robusta coffee]
ref|XP_007225353.1|  hypothetical protein PRUPE_ppa000948mg             161   1e-40   Prunus persica
ref|XP_008219989.1|  PREDICTED: uncharacterized protein LOC103320...    159   3e-40   Prunus mume [ume]
ref|XP_008219987.1|  PREDICTED: uncharacterized protein LOC103320...    159   5e-40   Prunus mume [ume]
ref|XP_004498548.1|  PREDICTED: uncharacterized protein LOC101504060    159   8e-40   Cicer arietinum [garbanzo]
ref|XP_012076305.1|  PREDICTED: uncharacterized protein LOC105637451    158   2e-39   Jatropha curcas
ref|XP_010112151.1|  hypothetical protein L484_019890                   158   2e-39   
ref|XP_006394732.1|  hypothetical protein EUTSA_v10003586mg             158   2e-39   Eutrema salsugineum [saltwater cress]
emb|CDX88133.1|  BnaA06g27240D                                          156   7e-39   
ref|XP_009129999.1|  PREDICTED: uncharacterized protein LOC103854785    156   7e-39   Brassica rapa
gb|KDO67200.1|  hypothetical protein CISIN_1g002031mg                   154   9e-39   Citrus sinensis [apfelsine]
emb|CDY05459.1|  BnaA02g32320D                                          155   1e-38   
emb|CDX80470.1|  BnaC07g29740D                                          155   1e-38   
ref|XP_009375716.1|  PREDICTED: uncharacterized protein LOC103964508    155   2e-38   Pyrus x bretschneideri [bai li]
emb|CDY05396.1|  BnaC02g41040D                                          155   2e-38   
gb|KDO67199.1|  hypothetical protein CISIN_1g002031mg                   154   3e-38   Citrus sinensis [apfelsine]
gb|KDO67191.1|  hypothetical protein CISIN_1g002031mg                   154   4e-38   Citrus sinensis [apfelsine]
ref|XP_010421323.1|  PREDICTED: uncharacterized protein LOC104706794    154   4e-38   Camelina sativa [gold-of-pleasure]
ref|XP_004292868.1|  PREDICTED: uncharacterized protein LOC101309327    150   4e-38   Fragaria vesca subsp. vesca
ref|XP_007011535.1|  ABC1 family protein, putative                      153   4e-38   
gb|KDO67192.1|  hypothetical protein CISIN_1g002031mg                   154   5e-38   Citrus sinensis [apfelsine]
ref|XP_006483617.1|  PREDICTED: uncharacterized aarF domain-conta...    154   5e-38   Citrus sinensis [apfelsine]
ref|XP_006450111.1|  hypothetical protein CICLE_v10007354mg             154   6e-38   Citrus clementina [clementine]
ref|XP_006286769.1|  hypothetical protein CARUB_v10003319mg             153   7e-38   Capsella rubella
ref|XP_004291221.1|  PREDICTED: uncharacterized protein LOC101315016    152   2e-37   Fragaria vesca subsp. vesca
ref|XP_009151006.1|  PREDICTED: uncharacterized protein LOC103874346    150   6e-37   Brassica rapa
ref|XP_010541528.1|  PREDICTED: uncharacterized protein LOC104814...    150   7e-37   Tarenaya hassleriana [spider flower]
ref|XP_010541526.1|  PREDICTED: uncharacterized protein LOC104814...    150   9e-37   Tarenaya hassleriana [spider flower]
ref|XP_008360489.1|  PREDICTED: uncharacterized protein LOC103424180    150   1e-36   
ref|XP_008391427.1|  PREDICTED: uncharacterized protein LOC103453649    150   1e-36   
ref|XP_010541525.1|  PREDICTED: uncharacterized protein LOC104814...    150   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_010432830.1|  PREDICTED: uncharacterized protein LOC104717024    149   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010454806.1|  PREDICTED: uncharacterized protein LOC104736503    149   2e-36   Camelina sativa [gold-of-pleasure]
ref|NP_568458.1|  ABC1 family protein                                   146   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190388.1|  ABC1 family protein                                146   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161530.1|  hypothetical protein PHAVU_001G077100g             145   7e-35   Phaseolus vulgaris [French bean]
gb|KFK27753.1|  hypothetical protein AALP_AA8G424500                    144   1e-34   Arabis alpina [alpine rockcress]
gb|KJB55250.1|  hypothetical protein B456_009G069300                    142   4e-34   Gossypium raimondii
gb|KHG17463.1|  putative aarF domain-containing protein kinase 1        142   5e-34   Gossypium arboreum [tree cotton]
gb|KJB55249.1|  hypothetical protein B456_009G069300                    142   5e-34   Gossypium raimondii
ref|XP_009367941.1|  PREDICTED: uncharacterized protein LOC103957500    141   1e-33   Pyrus x bretschneideri [bai li]
gb|EYU22093.1|  hypothetical protein MIMGU_mgv1a000993mg                140   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_008466267.1|  PREDICTED: uncharacterized protein LOC103503727    140   3e-33   Cucumis melo [Oriental melon]
ref|XP_006850925.1|  PREDICTED: uncharacterized protein LOC18440724     139   5e-33   Amborella trichopoda
ref|XP_002527984.1|  Ubiquinone biosynthesis protein coq-8, putative    139   7e-33   Ricinus communis
ref|XP_009403303.1|  PREDICTED: uncharacterized aarF domain-conta...    136   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403302.1|  PREDICTED: uncharacterized aarF domain-conta...    135   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010648446.1|  PREDICTED: uncharacterized protein LOC100242...    134   2e-31   
ref|XP_002283043.1|  PREDICTED: uncharacterized protein LOC100242...    134   3e-31   Vitis vinifera
gb|KCW82601.1|  hypothetical protein EUGRSUZ_C03989                     132   1e-30   Eucalyptus grandis [rose gum]
ref|XP_008798142.1|  PREDICTED: uncharacterized protein LOC103713...    132   1e-30   Phoenix dactylifera
ref|XP_008798143.1|  PREDICTED: uncharacterized protein LOC103713...    132   1e-30   
ref|XP_010049790.1|  PREDICTED: uncharacterized protein LOC104438365    131   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010470869.1|  PREDICTED: uncharacterized protein LOC104750728    130   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010669478.1|  PREDICTED: uncharacterized protein LOC104886...    129   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010669479.1|  PREDICTED: uncharacterized protein LOC104886...    129   1e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK48358.1|  unknown                                                 121   1e-29   Lotus japonicus
ref|XP_003588594.1|  aarF domain-containing protein kinase, putative    127   5e-29   
ref|XP_009403305.1|  PREDICTED: uncharacterized protein LOC103986888    127   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011008661.1|  PREDICTED: uncharacterized protein LOC105113984    126   1e-28   Populus euphratica
ref|XP_010927205.1|  PREDICTED: uncharacterized protein LOC105049295    125   5e-28   Elaeis guineensis
ref|XP_006371820.1|  hypothetical protein POPTR_0018s03950g             124   9e-28   
ref|XP_006371821.1|  hypothetical protein POPTR_0018s03950g             124   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011045052.1|  PREDICTED: uncharacterized protein LOC105140...    122   2e-27   Populus euphratica
ref|XP_011003023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    122   3e-27   Populus euphratica
ref|XP_011045051.1|  PREDICTED: uncharacterized protein LOC105140...    122   3e-27   Populus euphratica
ref|XP_010263230.1|  PREDICTED: uncharacterized protein LOC104601555    122   3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_003550103.1|  PREDICTED: uncharacterized protein LOC100775...    121   7e-27   Glycine max [soybeans]
ref|XP_004136301.1|  PREDICTED: uncharacterized protein LOC101216220    120   1e-26   Cucumis sativus [cucumbers]
ref|XP_003588582.1|  aarF domain-containing protein kinase, putative    120   1e-26   
gb|KGN60194.1|  hypothetical protein Csa_3G888530                       120   1e-26   Cucumis sativus [cucumbers]
gb|EPS60965.1|  hypothetical protein M569_13837                         112   5e-26   Genlisea aurea
ref|XP_003544660.1|  PREDICTED: uncharacterized protein LOC100802...    119   6e-26   Glycine max [soybeans]
gb|EPS66438.1|  hypothetical protein M569_08337                         117   1e-25   Genlisea aurea
ref|XP_006371818.1|  hypothetical protein POPTR_0018s03930g             114   1e-24   
ref|XP_006382184.1|  ABC1 family protein                                112   6e-24   
ref|XP_004966108.1|  PREDICTED: uncharacterized protein LOC101759876    112   1e-23   Setaria italica
ref|XP_001767436.1|  predicted protein                                  109   9e-23   
ref|XP_009586952.1|  PREDICTED: uncharacterized protein LOC104084...    105   9e-23   
ref|NP_001168428.1|  uncharacterized protein LOC100382198               105   1e-21   
gb|AGT16406.1|  hypothetical protein SHCRBa_024_H17_F_120               104   5e-21   Saccharum hybrid cultivar R570
ref|XP_008648079.1|  PREDICTED: uncharacterized protein LOC100382...    103   5e-21   
dbj|BAJ86975.1|  predicted protein                                      101   4e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001766095.1|  predicted protein                                99.8    1e-19   
gb|EEC81263.1|  hypothetical protein OsI_24357                        99.4    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002450940.1|  hypothetical protein SORBIDRAFT_05g021423        90.9    3e-18   
ref|XP_002965001.1|  hypothetical protein SELMODRAFT_266894           92.8    2e-17   
ref|XP_006371822.1|  hypothetical protein POPTR_0018s03950g           91.7    5e-17   
ref|XP_010227427.1|  PREDICTED: uncharacterized protein LOC100845...  91.7    5e-17   Brachypodium distachyon [annual false brome]
ref|XP_010227425.1|  PREDICTED: uncharacterized protein LOC100845...  91.3    6e-17   
ref|XP_003563512.1|  PREDICTED: uncharacterized protein LOC100845...  91.3    7e-17   Brachypodium distachyon [annual false brome]
ref|XP_002977076.1|  hypothetical protein SELMODRAFT_106221           89.7    2e-16   
gb|EMT12091.1|  hypothetical protein F775_11903                       84.7    4e-15   
ref|XP_002977079.1|  hypothetical protein SELMODRAFT_443434           85.1    6e-15   
ref|XP_002965004.1|  hypothetical protein SELMODRAFT_439199           85.1    7e-15   
ref|XP_006656445.1|  PREDICTED: uncharacterized protein LOC102706948  84.0    2e-14   Oryza brachyantha
ref|XP_006371809.1|  hypothetical protein POPTR_0018s03850g           80.9    2e-14   
gb|EEE66303.1|  hypothetical protein OsJ_22534                        83.2    3e-14   Oryza sativa Japonica Group [Japonica rice]
gb|ACG36527.1|  hypothetical protein                                  61.2    2e-08   Zea mays [maize]
gb|AAK82520.1|  AT5g24810/F6A4_20                                     61.6    3e-07   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009622904.1| PREDICTED: uncharacterized protein LOC104114217 isoform X2 [Nicotiana 
tomentosiformis]
Length=770

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 185/249 (74%), Gaps = 22/249 (9%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP +FN+L  RRAIIPAANGHCSARALARYYAAL +GG++PP   SSMP LGSH HV
Sbjct  528  ATTLPAIFNSLYARRAIIPAANGHCSARALARYYAALAEGGRVPPPHYSSMPTLGSHPHV  587

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNAS--------GNEYVLVVNDD--  544
            PKFPS +T       + +K+  ++  S     G ++N+S        GN YV + +D+  
Sbjct  588  PKFPSQQT------VKKQKSRKKTAASDADGSGPTQNSSSSVDNDGKGNVYVRIPDDNSY  641

Query  543  ---DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghs  373
               DT +D+ N KLF N ++H+AF+GVGEYE LTYP+GQFGLGFKR +S +  LIGFGHS
Sbjct  642  SGGDTSSDNRNIKLFHNQRVHDAFMGVGEYENLTYPNGQFGLGFKRSYSTNGELIGFGHS  701

Query  372  gmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS--  199
            GMGGSTGFC++K++FAIA+TLNKLSFG VTAKII L+CSELNIPVP+EIS  +E+ SS  
Sbjct  702  GMGGSTGFCNLKHKFAIAVTLNKLSFGSVTAKIIHLICSELNIPVPQEISRLVETGSSDQ  761

Query  198  -NLAQPIIN  175
             ++ +P+IN
Sbjct  762  LDIGKPMIN  770



>ref|XP_009622901.1| PREDICTED: uncharacterized protein LOC104114217 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622902.1| PREDICTED: uncharacterized protein LOC104114217 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622903.1| PREDICTED: uncharacterized protein LOC104114217 isoform X1 [Nicotiana 
tomentosiformis]
Length=953

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 185/249 (74%), Gaps = 22/249 (9%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP +FN+L  RRAIIPAANGHCSARALARYYAAL +GG++PP   SSMP LGSH HV
Sbjct  711  ATTLPAIFNSLYARRAIIPAANGHCSARALARYYAALAEGGRVPPPHYSSMPTLGSHPHV  770

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNAS--------GNEYVLVVNDD--  544
            PKFPS +T       + +K+  ++  S     G ++N+S        GN YV + +D+  
Sbjct  771  PKFPSQQT------VKKQKSRKKTAASDADGSGPTQNSSSSVDNDGKGNVYVRIPDDNSY  824

Query  543  ---DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghs  373
               DT +D+ N KLF N ++H+AF+GVGEYE LTYP+GQFGLGFKR +S +  LIGFGHS
Sbjct  825  SGGDTSSDNRNIKLFHNQRVHDAFMGVGEYENLTYPNGQFGLGFKRSYSTNGELIGFGHS  884

Query  372  gmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS--  199
            GMGGSTGFC++K++FAIA+TLNKLSFG VTAKII L+CSELNIPVP+EIS  +E+ SS  
Sbjct  885  GMGGSTGFCNLKHKFAIAVTLNKLSFGSVTAKIIHLICSELNIPVPQEISRLVETGSSDQ  944

Query  198  -NLAQPIIN  175
             ++ +P+IN
Sbjct  945  LDIGKPMIN  953



>ref|XP_009586951.1| PREDICTED: uncharacterized protein LOC104084719 isoform X2 [Nicotiana 
tomentosiformis]
Length=383

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 195/292 (67%), Gaps = 45/292 (15%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP +FN+L  RRAIIPAANGHCSARALARYYAAL +GG++PP   SSMP LGSH H+
Sbjct  29   ATTLPAIFNSLYARRAIIPAANGHCSARALARYYAALAEGGRVPPPHYSSMPTLGSHPHI  88

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNAS------------GNEYVLVVN  550
            PKFPS +T       + +K+  ++  S     G ++N+S            GN YV + +
Sbjct  89   PKFPSQQT------VKKQKSRKKTAASDADGPGPTQNSSSSVDNGYGNDGKGNVYVRIPD  142

Query  549  DD-----DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsglig  385
            D+     DT +D+ N KLF N ++H+AF+GVGEYE LT P+G+FGLGFKR +S    LIG
Sbjct  143  DNSCSGGDTSSDNRNIKLFHNQRVHDAFMGVGEYENLTDPNGEFGLGFKRSYSTSGELIG  202

Query  384  fghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESE  205
            FGHSGMGGSTGFC++K++FAIA+TLNKLSFG VTAKII L+CSELNIPVP+EIS  +E+ 
Sbjct  203  FGHSGMGGSTGFCNLKHKFAIAVTLNKLSFGSVTAKIIHLICSELNIPVPQEISRLVETG  262

Query  204  SSNLAQPIIN*YKLPSHFCYCQI---VTLLLLSC-----SNIGKSQVLTTIL  73
            S              S F +C +   V L+++S      SNIG+ +   +I+
Sbjct  263  S--------------SLFVFCSLFEKVVLVIVSINNVIGSNIGEGRTRGSII  300



>ref|XP_009586937.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586938.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586939.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586940.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586941.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586943.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586944.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586945.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586946.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586947.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586948.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586949.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009586950.1| PREDICTED: uncharacterized protein LOC104084719 isoform X1 [Nicotiana 
tomentosiformis]
Length=410

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 195/292 (67%), Gaps = 45/292 (15%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP +FN+L  RRAIIPAANGHCSARALARYYAAL +GG++PP   SSMP LGSH H+
Sbjct  29   ATTLPAIFNSLYARRAIIPAANGHCSARALARYYAALAEGGRVPPPHYSSMPTLGSHPHI  88

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNAS------------GNEYVLVVN  550
            PKFPS +T       + +K+  ++  S     G ++N+S            GN YV + +
Sbjct  89   PKFPSQQT------VKKQKSRKKTAASDADGPGPTQNSSSSVDNGYGNDGKGNVYVRIPD  142

Query  549  DD-----DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsglig  385
            D+     DT +D+ N KLF N ++H+AF+GVGEYE LT P+G+FGLGFKR +S    LIG
Sbjct  143  DNSCSGGDTSSDNRNIKLFHNQRVHDAFMGVGEYENLTDPNGEFGLGFKRSYSTSGELIG  202

Query  384  fghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESE  205
            FGHSGMGGSTGFC++K++FAIA+TLNKLSFG VTAKII L+CSELNIPVP+EIS  +E+ 
Sbjct  203  FGHSGMGGSTGFCNLKHKFAIAVTLNKLSFGSVTAKIIHLICSELNIPVPQEISRLVETG  262

Query  204  SSNLAQPIIN*YKLPSHFCYCQI---VTLLLLSC-----SNIGKSQVLTTIL  73
            S              S F +C +   V L+++S      SNIG+ +   +I+
Sbjct  263  S--------------SLFVFCSLFEKVVLVIVSINNVIGSNIGEGRTRGSII  300



>ref|XP_009798287.1| PREDICTED: uncharacterized protein LOC104244540 [Nicotiana sylvestris]
 ref|XP_009798288.1| PREDICTED: uncharacterized protein LOC104244540 [Nicotiana sylvestris]
 ref|XP_009798289.1| PREDICTED: uncharacterized protein LOC104244540 [Nicotiana sylvestris]
Length=957

 Score =   182 bits (461),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 144/247 (58%), Positives = 181/247 (73%), Gaps = 14/247 (6%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP++FN+L  RRAIIPAANGHCSARALARYYAAL +GGK+PP   +SMP LGSH H+
Sbjct  711  ATTLPVIFNSLYARRAIIPAANGHCSARALARYYAALAEGGKVPPPHYASMPTLGSHPHI  770

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsS------RNASGNEYVLV-----VND  547
            PKFPS +T KK+   +   A    G     +  SS       +  GN Y+ +      N 
Sbjct  771  PKFPSQQTVKKQKSRKKTAASDADGPGPTQNSNSSIENGCGHDGKGNVYLRIPDNNSYNG  830

Query  546  DDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgm  367
             DT +D+ N KLF N ++H+AF+GVGEYE LTYP+GQFGLGFKR +S +  L+GFGHSGM
Sbjct  831  GDTSSDNRNIKLFHNQRVHDAFMGVGEYENLTYPNGQFGLGFKRSYSTNGELVGFGHSGM  890

Query  366  ggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSN---  196
            GGSTGFC++K++FAIA+TLNKLSFG VTAKII L+CSELNIPVP+EIS  +E+ SS+   
Sbjct  891  GGSTGFCNIKHKFAIAVTLNKLSFGSVTAKIIHLICSELNIPVPQEISRLVETGSSDQLE  950

Query  195  LAQPIIN  175
            + +P+IN
Sbjct  951  IGKPLIN  957



>ref|XP_006355214.1| PREDICTED: uncharacterized protein LOC102585966 [Solanum tuberosum]
Length=956

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 183/246 (74%), Gaps = 13/246 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP +FN+L  RRAIIPAANGHCSARALARYYAAL +GGK+PP   SSMP LGSH H+
Sbjct  711  ATTLPAIFNSLYARRAIIPAANGHCSARALARYYAALAEGGKVPPPHHSSMPTLGSHPHI  770

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASG-----NEYVLVVND-----D  544
            PKFPS +T KK+   +    D      + S + +++ +SG     N Y+ + +D     D
Sbjct  771  PKFPSQQTVKKQKSQKKTGLDDHGPGQTQSSNSTTQISSGHDDKGNVYIQIPSDNRCSID  830

Query  543  DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmg  364
            DT +D+ N KLF NPK+ +AF+GVGEYE LTYP+G FGLGFKR +S +  LIGFGHSG+G
Sbjct  831  DTSSDNLNIKLFHNPKVQDAFMGVGEYENLTYPNGMFGLGFKRSYSTNEELIGFGHSGIG  890

Query  363  gstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSN---L  193
            GSTG C+++++FA+A+TLNK+SFG VTAKII L+CSELNIPVPEEIS  +E+ S++   +
Sbjct  891  GSTGLCNIEHKFAMAVTLNKMSFGTVTAKIIHLICSELNIPVPEEISRLVETGSTSQLGI  950

Query  192  AQPIIN  175
             +P+IN
Sbjct  951  GKPLIN  956



>ref|XP_004246076.1| PREDICTED: uncharacterized protein LOC101247741 [Solanum lycopersicum]
 ref|XP_010325664.1| PREDICTED: uncharacterized protein LOC101247741 [Solanum lycopersicum]
 ref|XP_010325665.1| PREDICTED: uncharacterized protein LOC101247741 [Solanum lycopersicum]
Length=956

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 184/246 (75%), Gaps = 13/246 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP +FN+L  RRAIIPAANGHCSARALARYYAAL +GGK+PP   SSMP LGSH H+
Sbjct  711  ATTLPAIFNSLYARRAIIPAANGHCSARALARYYAALAEGGKVPPPHHSSMPTLGSHPHI  770

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASG-----NEYVLVVND-----D  544
            PKFPS +T KK+   +    D +    + S + S++ +SG     N Y+ + +D     D
Sbjct  771  PKFPSQQTVKKQKSQKKTGLDDQGPGQTQSSNLSTQISSGHHDKGNVYIQIPSDNRCSID  830

Query  543  DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmg  364
            D+ +D+   KLF NPK+H+AF+GVGEYE LTYP+G FGLGFKR +S +  LIGFGHSG+G
Sbjct  831  DSSSDNRTIKLFHNPKVHDAFMGVGEYENLTYPNGMFGLGFKRSYSTNEELIGFGHSGIG  890

Query  363  gstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSN---L  193
            GSTG C+++++FA+A+TLNK+SFG VTAKII L+CSELNIPVP+EIS  +E+ S++   +
Sbjct  891  GSTGLCNIEHKFAMAVTLNKMSFGTVTAKIIHLICSELNIPVPQEISRLVETGSTSQLGI  950

Query  192  AQPIIN  175
             +P+IN
Sbjct  951  GKPLIN  956



>ref|XP_011082268.1| PREDICTED: uncharacterized protein LOC105165093 [Sesamum indicum]
Length=984

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 160/249 (64%), Gaps = 21/249 (8%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A TLP +FN L  RRAIIPAAN HCSARALARYYAALVD G IPP  SSS    LGSH H
Sbjct  741  ASTLPALFNTLHARRAIIPAANAHCSARALARYYAALVDQGAIPPPHSSSTQPRLGSHPH  800

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDT-------  538
            +P+F S K        + + +       S      SR  SG  Y  +  DD         
Sbjct  801  IPEFSSQKPT-----KKRKGSKHAHNTDSSKSTNLSREDSGKTYTEIPTDDSNCNGTISV  855

Query  537  -----PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghs  373
                   D    KLF N KIH+AF+GVGEYE LT P GQFGLGFKR +S+D  L+GFGHS
Sbjct  856  AIDGFGNDRKTVKLFSNSKIHDAFMGVGEYENLTLPGGQFGLGFKRSYSEDGNLVGFGHS  915

Query  372  gmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEE---ISMKLESES  202
            GMGGSTG+CD+ +RFAIA+TLNK++FGGVTAK+IQLVCSELNIP+P +    + ++    
Sbjct  916  GMGGSTGYCDINHRFAIAVTLNKMNFGGVTAKVIQLVCSELNIPLPADFYRFTERINDNE  975

Query  201  SNLAQPIIN  175
            SN+  P+IN
Sbjct  976  SNIVGPLIN  984



>ref|XP_007011534.1| ABC1 family protein [Theobroma cacao]
 gb|EOY29153.1| ABC1 family protein [Theobroma cacao]
Length=963

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 172/258 (67%), Gaps = 30/258 (12%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A +LP++FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  SS   P LG H H
Sbjct  711  ATSLPVLFNMLNIRRAIIPAANGHCSARALARYYAALADGGVVPPPHSSRSNPPLGRHPH  770

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRN--------ASGNEYVLVVNDD-  544
            +P +PS K+ K++   + ++ +     S +  +G  +N         SG+ Y  V ++D 
Sbjct  771  IPSYPSKKSHKRQ---KGKRTNMVDAASKNKANGCRQNRYYSKDFKGSGDSYTRVDSEDS  827

Query  543  ---------------DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIH  409
                           DTP +  + K+F NP+IH+AF+GVGEY  L  PDG FGLGF+R+ 
Sbjct  828  NSTSSSSTSNCNANRDTPQNKTD-KIFSNPRIHDAFMGVGEYGNLALPDGIFGLGFRRLK  886

Query  408  SKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEE  229
            SKD  LIGFGHSGMGGSTGFCD+KNRFAIA+TLNK+SFGGVTAKII+LVCSELNIP+PEE
Sbjct  887  SKDESLIGFGHSGMGGSTGFCDIKNRFAIAVTLNKMSFGGVTAKIIELVCSELNIPLPEE  946

Query  228  ISMKLESESSNLAQPIIN  175
             S        N   P+IN
Sbjct  947  FSGS-SRRDLNTFSPLIN  963



>ref|XP_002874225.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50484.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata]
Length=1011

 Score =   162 bits (410),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 164/260 (63%), Gaps = 32/260 (12%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
             A  LP++FN L  RRAIIPAANGHCSARALARYYA L DGG +PP  SS   P LGSH H
Sbjct  757   ATNLPVLFNTLNVRRAIIPAANGHCSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  816

Query  696   VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYV---------------  562
             VPKF S K   K    R  K  + +      D    R   G ++                
Sbjct  817   VPKFTSLKDTTK---KRKSKEMAATEKRKSKDHQERRLYDGKQFTSAGSSGESNTESLAR  873

Query  561   LV----------VNDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRI  412
             LV          +N DD   D HN  LF NP IH+AF+G G+Y  L  PDG+FGLGFKR+
Sbjct  874   LVDTSSYAGKTEINSDDHQHDIHN--LFSNPSIHDAFMGAGDYSGLVVPDGKFGLGFKRV  931

Query  411   HSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPE  232
              S+D  L+GFGHSGMGGSTGFCD+KNRF+IA+TLNK+S GGVTAKI++LVCSELNIP+P+
Sbjct  932   ISQDGSLVGFGHSGMGGSTGFCDIKNRFSIAVTLNKMSMGGVTAKIVKLVCSELNIPLPK  991

Query  231   EISMKLES-ESSNLAQPIIN  175
             + S+  ++   S +  P+IN
Sbjct  992   DFSLSTDTGPDSQMGTPLIN  1011



>emb|CDP19648.1| unnamed protein product [Coffea canephora]
Length=284

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 160/254 (63%), Gaps = 23/254 (9%)
 Frame = -1

Query  867  TLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHVpk  688
            +LP +FN L  RRAIIPAANGHCSARALARYYAALVDGG +P   SSS PPLGSH H PK
Sbjct  31   SLPSLFNTLQARRAIIPAANGHCSARALARYYAALVDGGVVPAPHSSSGPPLGSHLHTPK  90

Query  687  -------fpspktpkkKLLARWRKAd---sesgdssdsddgsSRNASGNEYVLVVNDDDT  538
                     +     K LL   +K           S     S R A GN Y  V  D  +
Sbjct  91   FPTKNICKKNRAANIKNLLTASKKIGNFHQRQEHDSSGGGNSRRTARGNSYTRVPIDSSS  150

Query  537  PT---------DSHN-AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgli  388
                       D  N +KLF +P+IH+AF+GVGEYE L  PDGQFGLGFKR ++    ++
Sbjct  151  SKPCASEGDSFDGRNVSKLFCSPRIHDAFMGVGEYENLALPDGQFGLGFKRSYTMSGDIV  210

Query  387  gfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLES  208
            GFGHSGMGGSTG+C++++RFAIA+T+NK+S G VTAK+I LVC+ELNIP+P+E+   +E 
Sbjct  211  GFGHSGMGGSTGYCNIEHRFAIAVTINKMSMGTVTAKVIDLVCTELNIPLPKELRRFVEG  270

Query  207  ESS---NLAQPIIN  175
                  N   PIIN
Sbjct  271  SPDDVLNSGTPIIN  284



>ref|XP_007225353.1| hypothetical protein PRUPE_ppa000948mg [Prunus persica]
 gb|EMJ26552.1| hypothetical protein PRUPE_ppa000948mg [Prunus persica]
Length=953

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 165/245 (67%), Gaps = 13/245 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHRH  697
            A  LP +FN L  RRAIIP+ANGHCSARALARYYAALVDGG +PP  SSS  P  GSH H
Sbjct  710  ASVLPALFNMLNIRRAIIPSANGHCSARALARYYAALVDGGVVPPPHSSSSKPALGSHPH  769

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGN---EYVLVVNDDDT----  538
            +PK+P   +PKK+  +R +K  +     ++  + + ++   +         ND DT    
Sbjct  770  IPKYPVQSSPKKQKGSRTKKVAAAFRCRTNKYEQTPQDPDQDIVSHSRNTSNDSDTGLTE  829

Query  537  ----PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsg  370
                P + ++ K+F NP+IH+AFLGVGEY  L  PDG FGLGFKR  SKD  L GFGHSG
Sbjct  830  VIVSPKNDNDGKIFSNPRIHDAFLGVGEYANLVKPDGNFGLGFKRYRSKDGPLTGFGHSG  889

Query  369  mggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLA  190
            MGGSTGF D++NRFAIA+T+NK++FG  T +IIQ VCSELNIPVPE+ S K     S + 
Sbjct  890  MGGSTGFVDIENRFAIAVTVNKMTFGAATGRIIQFVCSELNIPVPEDYS-KFAESGSEVG  948

Query  189  QPIIN  175
            +P+IN
Sbjct  949  KPLIN  953



>ref|XP_008219989.1| PREDICTED: uncharacterized protein LOC103320134 isoform X2 [Prunus 
mume]
Length=841

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 166/245 (68%), Gaps = 13/245 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHRH  697
            A  LP +FN L  RRAIIPAANGHCSARALARYYAALVDGG IPP  SSS  P  GS+ H
Sbjct  598  ASVLPAVFNMLNIRRAIIPAANGHCSARALARYYAALVDGGVIPPPHSSSSKPALGSNPH  657

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGN---EYVLVVNDDDT----  538
            +PK+P   +PKK+  +R +K  +     ++  + + ++   +         ND DT    
Sbjct  658  IPKYPVKSSPKKQKGSRTKKVAAAFRCRTNKYEQTPQDPDQDIVSHSRNTSNDSDTGLTE  717

Query  537  ----PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsg  370
                P   ++ K+F NP+IH+AFLGVGEY  L  PDG FGLGFKR  SKD  LIGFGHSG
Sbjct  718  VIVSPKKDNDGKIFSNPRIHDAFLGVGEYANLVKPDGNFGLGFKRYRSKDGSLIGFGHSG  777

Query  369  mggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLA  190
            MGGSTGF D++NRFAIA+T+NK++FG  T +IIQ VCSELNIPVPE+ S K    +S + 
Sbjct  778  MGGSTGFVDIENRFAIAVTVNKMTFGAATGRIIQFVCSELNIPVPEDYS-KFAESASEVG  836

Query  189  QPIIN  175
            +P+IN
Sbjct  837  KPLIN  841



>ref|XP_008219987.1| PREDICTED: uncharacterized protein LOC103320134 isoform X1 [Prunus 
mume]
 ref|XP_008219988.1| PREDICTED: uncharacterized protein LOC103320134 isoform X1 [Prunus 
mume]
Length=954

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 166/245 (68%), Gaps = 13/245 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHRH  697
            A  LP +FN L  RRAIIPAANGHCSARALARYYAALVDGG IPP  SSS  P  GS+ H
Sbjct  711  ASVLPAVFNMLNIRRAIIPAANGHCSARALARYYAALVDGGVIPPPHSSSSKPALGSNPH  770

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGN---EYVLVVNDDDT----  538
            +PK+P   +PKK+  +R +K  +     ++  + + ++   +         ND DT    
Sbjct  771  IPKYPVKSSPKKQKGSRTKKVAAAFRCRTNKYEQTPQDPDQDIVSHSRNTSNDSDTGLTE  830

Query  537  ----PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsg  370
                P   ++ K+F NP+IH+AFLGVGEY  L  PDG FGLGFKR  SKD  LIGFGHSG
Sbjct  831  VIVSPKKDNDGKIFSNPRIHDAFLGVGEYANLVKPDGNFGLGFKRYRSKDGSLIGFGHSG  890

Query  369  mggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLA  190
            MGGSTGF D++NRFAIA+T+NK++FG  T +IIQ VCSELNIPVPE+ S K    +S + 
Sbjct  891  MGGSTGFVDIENRFAIAVTVNKMTFGAATGRIIQFVCSELNIPVPEDYS-KFAESASEVG  949

Query  189  QPIIN  175
            +P+IN
Sbjct  950  KPLIN  954



>ref|XP_004498548.1| PREDICTED: uncharacterized protein LOC101504060 [Cicer arietinum]
Length=957

 Score =   159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 158/247 (64%), Gaps = 14/247 (6%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKI-pplssssmppLGSHRH  697
            A  LP +FN L  RRAIIPAANGH SARALARYYAAL DGGKI PP SS+S P LGSH H
Sbjct  711  ATVLPPLFNTLNARRAIIPAANGHLSARALARYYAALADGGKIPPPHSSTSKPILGSHPH  770

Query  696  Vpkfps------------pktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVV  553
            +PK  S                   +   + K  S+       D  +SR++S  + +   
Sbjct  771  IPKLSSPKPPKKQKCIGRTVATLPTINKSYEKISSKEDFEVTDDINTSRDSSSGDDIGSS  830

Query  552  NDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghs  373
            N D  P      KL++NP+I + FLG GEYE LT P G FGLGFKR  SKD   I FGHS
Sbjct  831  NVDSNPQTHVPGKLYRNPRIVDEFLGAGEYENLTLPSGSFGLGFKRFSSKDGSSIAFGHS  890

Query  372  gmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEE-ISMKLESESSN  196
            GMGGSTGFCD+ NRF+IA+TLNK+SFGGVT KI+QLVCSELNIPVP++ +   +E    N
Sbjct  891  GMGGSTGFCDVTNRFSIAVTLNKMSFGGVTGKIVQLVCSELNIPVPDDFLRYAVEQSGGN  950

Query  195  LAQPIIN  175
              +PIIN
Sbjct  951  PGRPIIN  957



>ref|XP_012076305.1| PREDICTED: uncharacterized protein LOC105637451 [Jatropha curcas]
 gb|KDP33424.1| hypothetical protein JCGZ_06995 [Jatropha curcas]
Length=966

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 166/254 (65%), Gaps = 24/254 (9%)
 Frame = -1

Query  864  LPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRHV--  694
            LP +FN L  RRA+IP+ANGHCSARALARYYAALVD GKIPP  SS   P LGSH H+  
Sbjct  713  LPALFNMLNVRRAVIPSANGHCSARALARYYAALVDEGKIPPAHSSLSNPPLGSHLHIPK  772

Query  693  ------pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPT  532
                   K    K+ +    ++ + +D   G S +     SR  S + Y  + + + + T
Sbjct  773  FPSAKTSKNRKGKSKEADTSSKNKTSDHGHGHSRNYSSDHSRKNSSDGYTRLASSNGSAT  832

Query  531  DS------------HNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgli  388
            DS            + A++F NP+IH+AFLG+GEYE L  P G+FGLGF+R  SKD  L 
Sbjct  833  DSCATGDSSQKDNVNVARIFTNPRIHDAFLGMGEYENLAIPKGKFGLGFRRTISKDGSLT  892

Query  387  gfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLES  208
            GFGHSGMGGSTGFCD+KNRFAIA+TLNK+SFGGVT KII+LVCSELNIP+PE+ S   + 
Sbjct  893  GFGHSGMGGSTGFCDIKNRFAIAVTLNKMSFGGVTRKIIELVCSELNIPLPEDFSSSGDR  952

Query  207  ESS---NLAQPIIN  175
                  N+ +P+IN
Sbjct  953  GPDLQFNMGRPMIN  966



>ref|XP_010112151.1| hypothetical protein L484_019890 [Morus notabilis]
 gb|EXC32776.1| hypothetical protein L484_019890 [Morus notabilis]
Length=988

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 162/259 (63%), Gaps = 29/259 (11%)
 Frame = -1

Query  864  LPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRHVpk  688
            LP +FN L TRRAIIPAANGHCSARALARYYAAL DGG +PP  SS   P LGSH H+PK
Sbjct  730  LPPLFNMLNTRRAIIPAANGHCSARALARYYAALADGGVVPPPHSSYTKPPLGSHPHIPK  789

Query  687  fpspktpkkKLLARWRKAdsesg-----------dssdsddgsSRNASGNEYVLVV----  553
            FP     KKK       A +                   +    RN S + Y  +V    
Sbjct  790  FPGKTPTKKKAGKNKEPATASKAKNNGHGQNPNHSKDSENGNHYRNPSSDSYTRLVGETS  849

Query  552  --NDDDTPTDSH--------NAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
              N  DT T             K+F+NP+IH+AFLG GEY  L  PDG+FGLGFKR ++K
Sbjct  850  SSNRTDTGTTESVVVSNPRSGDKIFRNPRIHDAFLGSGEYGNLAKPDGEFGLGFKRYYAK  909

Query  402  DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            D   IGFGHSGMGGSTGFCD+KNRFAIA+T+NK+SFG VT+KIIQLVCSELNIPVPE+  
Sbjct  910  DKSFIGFGHSGMGGSTGFCDVKNRFAIAVTVNKMSFGAVTSKIIQLVCSELNIPVPEDYL  969

Query  222  MKLE---SESSNLAQPIIN  175
              +E       N+ +PIIN
Sbjct  970  RSVEIGPDGQLNVGRPIIN  988



>ref|XP_006394732.1| hypothetical protein EUTSA_v10003586mg [Eutrema salsugineum]
 gb|ESQ32018.1| hypothetical protein EUTSA_v10003586mg [Eutrema salsugineum]
Length=1003

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 161/248 (65%), Gaps = 15/248 (6%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
             A +LP++FN L  RRAIIPAANGHCSARALARYYA L DGG +PP  SS   P LGSH H
Sbjct  756   ATSLPVLFNTLNVRRAIIPAANGHCSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  815

Query  696   VpkfpspktpkkKLLARWRKAdsesg---dssdsddgsSRNASGNEYVLVVNDD------  544
             VPKF S     KK   +   A  +     +         R +S      +VND       
Sbjct  816   VPKFTSLNDTTKKRKGKEMAATEKLKDHHEKRFMRAVRGRESSTESLARLVNDTSSSAGK  875

Query  543   -DTPTDSHNAKL---FKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh  376
              +  ++ H   +   F NP+IH+AF+G G+Y  L  PDG+FGLGFKR++S+D  L+GFGH
Sbjct  876   TEISSNDHQDDIRCIFSNPRIHDAFMGAGDYGGLVLPDGKFGLGFKRVNSQDGSLVGFGH  935

Query  375   sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKL-ESESS  199
             SGMGGSTGFCD+KNRF+IAITLNK+S GGVTA II+LVCSELNIP+P+E S+       S
Sbjct  936   SGMGGSTGFCDIKNRFSIAITLNKMSLGGVTASIIRLVCSELNIPLPKEFSIASGMGPDS  995

Query  198   NLAQPIIN  175
              +  P+IN
Sbjct  996   EMGSPLIN  1003



>emb|CDX88133.1| BnaA06g27240D [Brassica napus]
Length=980

 Score =   156 bits (395),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 162/238 (68%), Gaps = 15/238 (6%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A +LP++FN L  RRA IPAANGHCSARALARYYAAL DGG +PP  SS S PPLGSH H
Sbjct  753  ASSLPVLFNTLNVRRATIPAANGHCSARALARYYAALADGGLVPPPHSSLSQPPLGSHTH  812

Query  696  VpkfpspktpkkKLLARWRKAdsesgds----sdsddgsSRNASGNEYVLVVNDDDTPTD  529
            VPKF S     KK   + ++  +          +      R +S      +VND  T  D
Sbjct  813  VPKFSSVNDTLKKRKGKGKEIAATEKLKPQDHKEKKLYDDRESSTESLARLVND--TSND  870

Query  528  SHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGF  349
              N  +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR+ S+D  L+GFGHSG+GGSTGF
Sbjct  871  IRN--MFSNPRIHDAFMGTGDYCDLVLPDGKFGLGFKRVTSQDGSLVGFGHSGLGGSTGF  928

Query  348  CDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLAQPIIN  175
            CD+KNRF+IAITLNK+S GGVTA II+LVCSELNIP+P++ S+      S+   P+IN
Sbjct  929  CDIKNRFSIAITLNKMSMGGVTANIIRLVCSELNIPLPKDFSL------SSGMDPVIN  980



>ref|XP_009129999.1| PREDICTED: uncharacterized protein LOC103854785 [Brassica rapa]
Length=999

 Score =   156 bits (395),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 164/243 (67%), Gaps = 13/243 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A +LP++FN L  RRAIIPAANGHCSARALARYYA+L DGG +PP  SS   P LGSH H
Sbjct  760  ATSLPVLFNTLNVRRAIIPAANGHCSARALARYYASLADGGLVPPPHSSLSQPPLGSHAH  819

Query  696  VpkfpspktpkkK-----LLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPT  532
            VPKF S    KKK     ++A  +K   +        D     ++ +   LV +  +   
Sbjct  820  VPKFSSVNDTKKKRKGKEMMASTQKLKPKGHKEKRLYDEEQFMSTESLASLVSDTSNDHQ  879

Query  531  DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstG  352
            D     +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR+ S+D  L+GFGHSGMGGSTG
Sbjct  880  DDDVRNIFSNPRIHDAFMGAGDYSGLVLPDGKFGLGFKRVTSQDGSLVGFGHSGMGGSTG  939

Query  351  FCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS----MKLESESSNLAQP  184
            FCD++NRF+IAIT+NK+S GGVTA II+LVCSELNIP+P++ S    M LE E   +  P
Sbjct  940  FCDIENRFSIAITVNKMSLGGVTASIIRLVCSELNIPLPKDFSIANGMGLELE---MGTP  996

Query  183  IIN  175
            +IN
Sbjct  997  LIN  999



>gb|KDO67200.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=729

 Score =   154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 158/263 (60%), Gaps = 30/263 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A   P +FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  S    P LGSH H
Sbjct  467  AAITPAVFNMLNIRRAIIPAANGHCSARALARYYAALADGGVVPPPHSRLSKPPLGSHPH  526

Query  696  V------pkfpspktpkkKLLARWRKAdsesgdssdsddgsS-----RNASGNEYVLVVN  550
            +            K  KK+LLA  +   + S                R ASG+ Y  ++N
Sbjct  527  IPKFPSHETSKKQKGTKKELLAALKNKTNNSEHGHKYTKDLEGGSHIRTASGDTYARLIN  586

Query  549  ---------------DDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKR  415
                           + D P  S+  K+F NP+IH+AFLGVG+Y  L  P+G+FGLGFKR
Sbjct  587  IETSSSNTSTTDSISNTDEPQSSNVRKIFNNPRIHDAFLGVGDYGDLALPNGRFGLGFKR  646

Query  414  IHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             +++D   IGFGHSGMGGSTGFCD+ NRFAIA+TLNK+SFG  T +II  VCSELN+PVP
Sbjct  647  YNTRDGSYIGFGHSGMGGSTGFCDVNNRFAIAVTLNKMSFGATTGRIIHFVCSELNLPVP  706

Query  234  EEISMKLESE---SSNLAQPIIN  175
            E+     E E     +L QP+IN
Sbjct  707  EDYLRFAEVEHDTPQDLGQPLIN  729



>emb|CDY05459.1| BnaA02g32320D [Brassica napus]
Length=1000

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 165/246 (67%), Gaps = 18/246 (7%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A +LP++FN L  RRAIIPAANGHCSARALARYYA+L DGG +PP  SS   P LGSH H
Sbjct  760  ATSLPVLFNTLNVRRAIIPAANGHCSARALARYYASLADGGLVPPPHSSLSQPPLGSHAH  819

Query  696  VpkfpspktpkkK-----LLARWRKAdsesgdssdsddgsSRNASGNEYVLVVND---DD  541
            VPKF S    KKK     ++A  +K   +  +         +  S      +V+D   D 
Sbjct  820  VPKFSSVNDTKKKRKGKEMMASTQKLKPKGHNKEKRLYDEEQFMSTESLASLVSDTSNDH  879

Query  540  TPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmgg  361
               D  N  +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR+ S+D  L+GFGHSGMGG
Sbjct  880  QDDDVRN--IFSNPRIHDAFMGAGDYSGLVLPDGKFGLGFKRVTSQDGSLVGFGHSGMGG  937

Query  360  stGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS----MKLESESSNL  193
            STGFCD++NRF+IAIT+NK+S GGVTA II+LVCSELNIP+P++ S    M LE E   +
Sbjct  938  STGFCDIENRFSIAITVNKMSLGGVTASIIRLVCSELNIPLPKDFSIANGMGLELE---M  994

Query  192  AQPIIN  175
              P+IN
Sbjct  995  GTPLIN  1000



>emb|CDX80470.1| BnaC07g29740D [Brassica napus]
Length=1009

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 159/238 (67%), Gaps = 15/238 (6%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
             A +LP++FN L  RRA IPAANGHCSARALARYYAAL DGG +PP  SS   P LGSH H
Sbjct  782   ASSLPVLFNTLNVRRATIPAANGHCSARALARYYAALADGGIVPPPHSSLSQPPLGSHTH  841

Query  696   VpkfpspktpkkKLLARWRKAdsesgds----sdsddgsSRNASGNEYVLVVNDDDTPTD  529
             VPKF S     KK   + ++  +          +      R +S      +VND  T  D
Sbjct  842   VPKFSSVNDTMKKRKGKGKEMAATEKLKPKDHKEKKLYDDRESSTESLARLVND--TSND  899

Query  528   SHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGF  349
              HN  +F NP IH+AF+G G+Y  L  PDG+FGLGFKR+ S+D  L+GFGHSG+GGSTGF
Sbjct  900   IHN--MFSNPSIHDAFMGTGDYSGLVLPDGKFGLGFKRVTSEDGSLVGFGHSGLGGSTGF  957

Query  348   CDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLAQPIIN  175
             CD+ NRF+IAITLN++S GGVTA I++LVCSELNIP+P++ S+      S+   P+IN
Sbjct  958   CDITNRFSIAITLNRMSMGGVTANIVRLVCSELNIPMPKDFSL------SSGMDPVIN  1009



>ref|XP_009375716.1| PREDICTED: uncharacterized protein LOC103964508 [Pyrus x bretschneideri]
Length=963

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 162/266 (61%), Gaps = 44/266 (17%)
 Frame = -1

Query  876  SAXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHR  700
            +A  LP +FN L  RRA+IPAANGH SARALARYYA LVDGG +PP  SSS  P  GSH 
Sbjct  710  AATALPALFNMLNIRRAMIPAANGHFSARALARYYATLVDGGVVPPPHSSSSKPALGSHP  769

Query  699  HVpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDD-DTPTDSH  523
            H+PKF    + KK+   R +K              + RN   N+Y     D  D    SH
Sbjct  770  HIPKFADQPSLKKQKGNRSKK-----------IAAAFRNMRTNKYEKTPQDSKDQDIGSH  818

Query  522  N------------------------------AKLFKNPKIHEAFLGVGEYEKLTYPDGQF  433
            N                               K+F NP+IH+AF+G+GEY  L  PDG F
Sbjct  819  NRNTSGNSNTCNGSDNVLDEIIVNPNPQKDVVKIFNNPRIHDAFMGIGEYSNLAKPDGNF  878

Query  432  GLGFKRIHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSE  253
            GLGFKR +SKD  LIGFGHSGMGGSTGFCD+KNRF+IA+TLNK+SFG  TAKIIQLVCSE
Sbjct  879  GLGFKRYYSKDRSLIGFGHSGMGGSTGFCDIKNRFSIAVTLNKMSFGLETAKIIQLVCSE  938

Query  252  LNIPVPEEISMKLESESSNLAQPIIN  175
            LNIPVPE+     ++ SS+  +P+IN
Sbjct  939  LNIPVPEDYLRYAQTGSSD-GKPLIN  963



>emb|CDY05396.1| BnaC02g41040D [Brassica napus]
Length=998

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 163/243 (67%), Gaps = 13/243 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A +LP++FN L  RRAIIPAANGHCSARALARYYA+L DGG +PP  SS   P LGSH H
Sbjct  759  ATSLPVLFNTLNVRRAIIPAANGHCSARALARYYASLADGGLVPPPHSSLSQPPLGSHAH  818

Query  696  VpkfpspktpkkK-----LLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPT  532
            VPKF S    KKK     ++A  +K   +        D     ++ +   LV +  +   
Sbjct  819  VPKFSSVNDTKKKRKGKEMMASTQKLKPKGHKEKRLYDEEQFMSTESLASLVSDTSNDHQ  878

Query  531  DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstG  352
            D     LF NP+I +AF+G G+Y  L  PDG+FGLGFKR+ S+D  L+GFGHSGMGGSTG
Sbjct  879  DDDIPNLFSNPRIRDAFMGAGDYSSLVLPDGKFGLGFKRVTSQDGSLVGFGHSGMGGSTG  938

Query  351  FCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS----MKLESESSNLAQP  184
            FCD++NRF+IAIT+NK+S GGVTA II+LVCSELNIP+P++ S    M LE E   +  P
Sbjct  939  FCDIENRFSIAITVNKMSLGGVTASIIKLVCSELNIPLPKDFSIANGMGLELE---MGTP  995

Query  183  IIN  175
            +IN
Sbjct  996  LIN  998



>gb|KDO67199.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=864

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 158/263 (60%), Gaps = 30/263 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A   P +FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  S    P LGSH H
Sbjct  602  AAITPAVFNMLNIRRAIIPAANGHCSARALARYYAALADGGVVPPPHSRLSKPPLGSHPH  661

Query  696  V------pkfpspktpkkKLLARWRKAdsesgdssdsddgsS-----RNASGNEYVLVVN  550
            +            K  KK+LLA  +   + S                R ASG+ Y  ++N
Sbjct  662  IPKFPSHETSKKQKGTKKELLAALKNKTNNSEHGHKYTKDLEGGSHIRTASGDTYARLIN  721

Query  549  ---------------DDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKR  415
                           + D P  S+  K+F NP+IH+AFLGVG+Y  L  P+G+FGLGFKR
Sbjct  722  IETSSSNTSTTDSISNTDEPQSSNVRKIFNNPRIHDAFLGVGDYGDLALPNGRFGLGFKR  781

Query  414  IHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             +++D   IGFGHSGMGGSTGFCD+ NRFAIA+TLNK+SFG  T +II  VCSELN+PVP
Sbjct  782  YNTRDGSYIGFGHSGMGGSTGFCDVNNRFAIAVTLNKMSFGATTGRIIHFVCSELNLPVP  841

Query  234  EEISMKLESE---SSNLAQPIIN  175
            E+     E E     +L QP+IN
Sbjct  842  EDYLRFAEVEHDTPQDLGQPLIN  864



>gb|KDO67191.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=941

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 158/263 (60%), Gaps = 30/263 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A   P +FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  S    P LGSH H
Sbjct  679  AAITPAVFNMLNIRRAIIPAANGHCSARALARYYAALADGGVVPPPHSRLSKPPLGSHPH  738

Query  696  V------pkfpspktpkkKLLARWRKAdsesgdssdsddgsS-----RNASGNEYVLVVN  550
            +            K  KK+LLA  +   + S                R ASG+ Y  ++N
Sbjct  739  IPKFPSHETSKKQKGTKKELLAALKNKTNNSEHGHKYTKDLEGGSHIRTASGDTYARLIN  798

Query  549  ---------------DDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKR  415
                           + D P  S+  K+F NP+IH+AFLGVG+Y  L  P+G+FGLGFKR
Sbjct  799  IETSSSNTSTTDSISNTDEPQSSNVRKIFNNPRIHDAFLGVGDYGDLALPNGRFGLGFKR  858

Query  414  IHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             +++D   IGFGHSGMGGSTGFCD+ NRFAIA+TLNK+SFG  T +II  VCSELN+PVP
Sbjct  859  YNTRDGSYIGFGHSGMGGSTGFCDVNNRFAIAVTLNKMSFGATTGRIIHFVCSELNLPVP  918

Query  234  EEISMKLESE---SSNLAQPIIN  175
            E+     E E     +L QP+IN
Sbjct  919  EDYLRFAEVEHDTPQDLGQPLIN  941



>ref|XP_010421323.1| PREDICTED: uncharacterized protein LOC104706794 [Camelina sativa]
Length=1011

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 161/257 (63%), Gaps = 26/257 (10%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
             A +LP++FN L  RRAIIPAANGH SARALARYYA L DGG +PP  SS   P LGSH H
Sbjct  757   ATSLPVLFNTLNVRRAIIPAANGHLSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  816

Query  696   Vpkfps-----------pktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVN  550
             VPKF S                +KL  +  +      +       SSR ++      +V+
Sbjct  817   VPKFTSLKDTTKKRKGKEMAATEKLKPKDHQERRLYDEKQFMSASSSRESNTESLARLVD  876

Query  549   D-----------DDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
                         DD   D HN  +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR+ S+
Sbjct  877   TSSSAGETEISRDDHQDDIHN--MFSNPRIHDAFMGAGDYSNLVVPDGKFGLGFKRVISQ  934

Query  402   DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
             D  L GFGHSGMGGSTGFCD+KNRF+IA+TLNK+S GGVTA I+QLVCSELNIP+P++ S
Sbjct  935   DGSLAGFGHSGMGGSTGFCDIKNRFSIAVTLNKMSMGGVTANIMQLVCSELNIPLPKDFS  994

Query  222   MKLE-SESSNLAQPIIN  175
             +       S +A P+IN
Sbjct  995   LSSAIGPDSEMATPLIN  1011



>ref|XP_004292868.1| PREDICTED: uncharacterized protein LOC101309327 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 148/231 (64%), Gaps = 46/231 (20%)
 Frame = -1

Query  876  SAXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl--ssssmppLGSH  703
            +A  +P +FN L  RRAIIPAAN HCSARALARYYA+LVDGG IPP   +SSS PPLGSH
Sbjct  250  AATMVPALFNMLNIRRAIIPAANAHCSARALARYYASLVDGGAIPPPHPTSSSTPPLGSH  309

Query  702  RHVpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSH  523
             H                                         N +   V  +++P+   
Sbjct  310  PH-----------------------------------------NPHSPAV--ENSPSSPK  326

Query  522  NAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIH-SKDsgligfghsgmggstGFC  346
              KLF NPKIH+AFLGVGEY  L   DG FGLGFKR H SKD+ LIGFGHSGMGGSTGFC
Sbjct  327  KDKLFSNPKIHDAFLGVGEYASLVMQDGIFGLGFKRCHHSKDNSLIGFGHSGMGGSTGFC  386

Query  345  DMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNL  193
            D++N+FAIA+TLNK+S+G  TA+IIQLVCSELNIPVPEE S   +S++  L
Sbjct  387  DIQNKFAIAVTLNKMSYGAETARIIQLVCSELNIPVPEEYSGFEDSDAKVL  437



>ref|XP_007011535.1| ABC1 family protein, putative [Theobroma cacao]
 gb|EOY29154.1| ABC1 family protein, putative [Theobroma cacao]
Length=779

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 157/241 (65%), Gaps = 26/241 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A + P +FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  SS   P LGSH H
Sbjct  557  ATSSPALFNMLNLRRAIIPAANGHCSARALARYYAALADGGVVPPPHSSLSNPPLGSHPH  616

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDD-----DTPT  532
            +P            L+R+   + +  DS DS        S        +DD     D P 
Sbjct  617  IPN----------FLSRY--CNKDFKDSGDSCTRFDNEGSNGNSSNSTSDDCNASRDGPQ  664

Query  531  DSHNAKLFKNPKIHEAFLGVGEYEKLTYP--DGQFGLGFKRIHSKDsgligfghsgmggs  358
            +  N+K+F N +IH+AFLGVGEY  L  P  DG FGLGF+R+ SKD     FGHSGMGGS
Sbjct  665  N-ENSKIFSNARIHDAFLGVGEYGNLALPSPDGIFGLGFRRLKSKDGSFTAFGHSGMGGS  723

Query  357  tGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLAQPII  178
             GFCD+KNRFAIA+TLNK+SFGGVTAKII+LVCSELN+P+PEE      S SS+  +P+I
Sbjct  724  AGFCDIKNRFAIAVTLNKMSFGGVTAKIIELVCSELNLPLPEEF-----SGSSDAYRPLI  778

Query  177  N  175
            N
Sbjct  779  N  779



>gb|KDO67192.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=968

 Score =   154 bits (388),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 158/263 (60%), Gaps = 30/263 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A   P +FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  S    P LGSH H
Sbjct  706  AAITPAVFNMLNIRRAIIPAANGHCSARALARYYAALADGGVVPPPHSRLSKPPLGSHPH  765

Query  696  V------pkfpspktpkkKLLARWRKAdsesgdssdsddgsS-----RNASGNEYVLVVN  550
            +            K  KK+LLA  +   + S                R ASG+ Y  ++N
Sbjct  766  IPKFPSHETSKKQKGTKKELLAALKNKTNNSEHGHKYTKDLEGGSHIRTASGDTYARLIN  825

Query  549  ---------------DDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKR  415
                           + D P  S+  K+F NP+IH+AFLGVG+Y  L  P+G+FGLGFKR
Sbjct  826  IETSSSNTSTTDSISNTDEPQSSNVRKIFNNPRIHDAFLGVGDYGDLALPNGRFGLGFKR  885

Query  414  IHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             +++D   IGFGHSGMGGSTGFCD+ NRFAIA+TLNK+SFG  T +II  VCSELN+PVP
Sbjct  886  YNTRDGSYIGFGHSGMGGSTGFCDVNNRFAIAVTLNKMSFGATTGRIIHFVCSELNLPVP  945

Query  234  EEISMKLESE---SSNLAQPIIN  175
            E+     E E     +L QP+IN
Sbjct  946  EDYLRFAEVEHDTPQDLGQPLIN  968



>ref|XP_006483617.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X1 [Citrus sinensis]
 ref|XP_006483618.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X2 [Citrus sinensis]
 ref|XP_006483619.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X3 [Citrus sinensis]
 ref|XP_006483620.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X4 [Citrus sinensis]
 ref|XP_006483621.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X5 [Citrus sinensis]
 ref|XP_006483622.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X6 [Citrus sinensis]
 gb|KDO67193.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67194.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67195.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67196.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67197.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67198.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=977

 Score =   154 bits (388),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 158/263 (60%), Gaps = 30/263 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A   P +FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  S    P LGSH H
Sbjct  715  AAITPAVFNMLNIRRAIIPAANGHCSARALARYYAALADGGVVPPPHSRLSKPPLGSHPH  774

Query  696  V------pkfpspktpkkKLLARWRKAdsesgdssdsddgsS-----RNASGNEYVLVVN  550
            +            K  KK+LLA  +   + S                R ASG+ Y  ++N
Sbjct  775  IPKFPSHETSKKQKGTKKELLAALKNKTNNSEHGHKYTKDLEGGSHIRTASGDTYARLIN  834

Query  549  ---------------DDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKR  415
                           + D P  S+  K+F NP+IH+AFLGVG+Y  L  P+G+FGLGFKR
Sbjct  835  IETSSSNTSTTDSISNTDEPQSSNVRKIFNNPRIHDAFLGVGDYGDLALPNGRFGLGFKR  894

Query  414  IHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             +++D   IGFGHSGMGGSTGFCD+ NRFAIA+TLNK+SFG  T +II  VCSELN+PVP
Sbjct  895  YNTRDGSYIGFGHSGMGGSTGFCDVNNRFAIAVTLNKMSFGATTGRIIHFVCSELNLPVP  954

Query  234  EEISMKLESE---SSNLAQPIIN  175
            E+     E E     +L QP+IN
Sbjct  955  EDYLRFAEVEHDTPQDLGQPLIN  977



>ref|XP_006450111.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 ref|XP_006450112.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 ref|XP_006450113.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 ref|XP_006450114.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63351.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63352.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63353.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63354.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
Length=977

 Score =   154 bits (388),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 158/263 (60%), Gaps = 30/263 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A   P +FN L  RRAIIPAANGHCSARALARYYAAL DGG +PP  S    P LGSH H
Sbjct  715  AAITPAVFNMLNIRRAIIPAANGHCSARALARYYAALADGGVVPPPHSRLSKPPLGSHPH  774

Query  696  V------pkfpspktpkkKLLARWRKAdsesgdssdsddgsS-----RNASGNEYVLVVN  550
            +            K  KK+LLA  +   + S                R ASG+ Y  ++N
Sbjct  775  IPKFPSHETSKKQKGTKKELLAALKNKTNNSEHGHKYTKDLEGGSHIRTASGDTYARLIN  834

Query  549  ---------------DDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKR  415
                           + D P  S+  K+F NP+IH+AFLGVG+Y  L  P+G+FGLGFKR
Sbjct  835  IETSSSNTSTTDSISNTDEPQSSNVRKIFNNPRIHDAFLGVGDYGDLALPNGRFGLGFKR  894

Query  414  IHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             +++D   IGFGHSGMGGSTGFCD+ NRFAIA+TLNK+SFG  T +II  VCSELN+PVP
Sbjct  895  YNTRDGCYIGFGHSGMGGSTGFCDVNNRFAIAVTLNKMSFGATTGRIIHFVCSELNLPVP  954

Query  234  EEISMKLESE---SSNLAQPIIN  175
            E+     E E     +L QP+IN
Sbjct  955  EDYLRFAEVEHDTPQDLGQPLIN  977



>ref|XP_006286769.1| hypothetical protein CARUB_v10003319mg [Capsella rubella]
 gb|EOA19667.1| hypothetical protein CARUB_v10003319mg [Capsella rubella]
Length=1011

 Score =   153 bits (387),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 161/257 (63%), Gaps = 26/257 (10%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
             A  LP++FN L  RRAIIPAANGHCSARALARYYA L DGG +PP  SS   P LGSH H
Sbjct  757   ATNLPVLFNTLNVRRAIIPAANGHCSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  816

Query  696   Vpkfps-----------pktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVN  550
             VPKF S                +KL  +  +      +       SSR ++      +V+
Sbjct  817   VPKFTSLKDSTKKRKGKEMAATEKLKPKDHQKKRLYDEKHVMSASSSRESNTESLARLVD  876

Query  549   D-----------DDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
                         DD   D HN  +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR+ S+
Sbjct  877   SSSSAGKTEISSDDHQDDIHN--MFNNPRIHDAFMGAGDYSDLVVPDGKFGLGFKRVISQ  934

Query  402   DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
             D  L+GFGHSGMGGSTGFCD+KNRF+IA+TLNK+S GGVTA I++LVCSELNIP+P++ S
Sbjct  935   DGSLVGFGHSGMGGSTGFCDIKNRFSIAVTLNKMSMGGVTANIMKLVCSELNIPLPKDFS  994

Query  222   MK-LESESSNLAQPIIN  175
             +       S +  P+IN
Sbjct  995   LSNAIGPDSEMGTPLIN  1011



>ref|XP_004291221.1| PREDICTED: uncharacterized protein LOC101315016 [Fragaria vesca 
subsp. vesca]
Length=956

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 154/245 (63%), Gaps = 17/245 (7%)
 Frame = -1

Query  864  LPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHRHV--  694
            +P +FN L  RR IIPAANGHCSARALARYYAALVDGG +PP  SS   P  GSH H+  
Sbjct  714  VPPLFNMLNIRRGIIPAANGHCSARALARYYAALVDGGVVPPPHSSPSKPALGSHPHIPK  773

Query  693  --------pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDT  538
                     +    K     L  R +K +       D    SS N S N    V +    
Sbjct  774  FPAESSSKKQGNRSKKLAAALKLRTKKYEQAPTSDPDIVIPSSTNRSSN-ITNVTDPGSI  832

Query  537  PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggs  358
            P   +  K+F NP+IH+AFLG GEY  L  PDG FGLGFKR HS++  LIGFGHSGMGGS
Sbjct  833  PQKGNAGKIFSNPRIHDAFLGAGEYANLAKPDGGFGLGFKRYHSEEGCLIGFGHSGMGGS  892

Query  357  tGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEI----SMKLESESSNLA  190
            TGFCD+KNRFAI++TLNKLSFG  T +II LVCSELNIPVP++        LE +S ++ 
Sbjct  893  TGFCDIKNRFAISVTLNKLSFGAETGRIIHLVCSELNIPVPQDYVRLAETALEGQSDSV-  951

Query  189  QPIIN  175
            +P+IN
Sbjct  952  RPLIN  956



>ref|XP_009151006.1| PREDICTED: uncharacterized protein LOC103874346 [Brassica rapa]
Length=994

 Score =   150 bits (380),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 161/250 (64%), Gaps = 25/250 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A +LP++FN L  RRA IPAANGHCSARALARYYAAL DGG +PP  SS   P LGSH H
Sbjct  753  ASSLPVLFNTLNVRRATIPAANGHCSARALARYYAALADGGLVPPPHSSLSQPPLGSHTH  812

Query  696  VpkfpspktpkkKLLARWRKAdsesgds----sdsddgsSRNASGNEYVLVVND------  547
            VPKF S     KK   + ++  +          +      R +S      +VND      
Sbjct  813  VPKFSSVNDTLKKRKGKGKEIAATEKLKPQDHKEKKLYDDRESSTESLARLVNDTSSSAG  872

Query  546  ------DDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsglig  385
                  +D   D  N  +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR+ S+D  L+G
Sbjct  873  KTEISSNDHQDDIRN--MFSNPRIHDAFMGTGDYCDLVLPDGKFGLGFKRVTSQDGSLVG  930

Query  384  fghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESE  205
            FGHSG+GGSTGFCD+KNRF+IAITLNK+S GGVTA II+LVCSEL+IP+P++ S+     
Sbjct  931  FGHSGLGGSTGFCDIKNRFSIAITLNKMSMGGVTANIIRLVCSELDIPLPKDFSL-----  985

Query  204  SSNLAQPIIN  175
             S+   P+IN
Sbjct  986  -SSGMDPVIN  994



>ref|XP_010541528.1| PREDICTED: uncharacterized protein LOC104814963 isoform X3 [Tarenaya 
hassleriana]
Length=964

 Score =   150 bits (379),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 153/254 (60%), Gaps = 21/254 (8%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A TLP++FN L  RRAIIPAAN HCSARALARYYA L D G +PP  SS     LGSH H
Sbjct  711  ATTLPVIFNTLDVRRAIIPAANLHCSARALARYYATLADSGLVPPSHSSLSKPQLGSHSH  770

Query  696  V--------pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDD-  544
            +              K  +  +  + +       D      G  R  S +    +V+   
Sbjct  771  IPKLFLSLNDTSKKKKEKEMAVAEKHKPKARRHYDDRSITHGRGRELSTDSLTRLVDGSS  830

Query  543  -------DTPTDSHN---AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsg  394
                   D  TD +     K+F+NP+IH+AFLGVGEY  L  P+G+FGLGFKR  SK   
Sbjct  831  AGNTSSPDGKTDDNRENVGKIFRNPRIHDAFLGVGEYSGLVLPEGKFGLGFKRNRSKSES  890

Query  393  ligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS-MK  217
            L GFGHSGMGGSTGFCD +NRF+IA+TLNK+S GGVTA II+LVCSELNIPVPE+ S + 
Sbjct  891  LTGFGHSGMGGSTGFCDAENRFSIAVTLNKMSLGGVTADIIKLVCSELNIPVPEDFSTLS  950

Query  216  LESESSNLAQPIIN  175
                +  ++ P+IN
Sbjct  951  AMGSAQEISTPVIN  964



>ref|XP_010541526.1| PREDICTED: uncharacterized protein LOC104814963 isoform X2 [Tarenaya 
hassleriana]
Length=1006

 Score =   150 bits (379),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 153/254 (60%), Gaps = 21/254 (8%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
             A TLP++FN L  RRAIIPAAN HCSARALARYYA L D G +PP  SS     LGSH H
Sbjct  753   ATTLPVIFNTLDVRRAIIPAANLHCSARALARYYATLADSGLVPPSHSSLSKPQLGSHSH  812

Query  696   V--------pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDD-  544
             +              K  +  +  + +       D      G  R  S +    +V+   
Sbjct  813   IPKLFLSLNDTSKKKKEKEMAVAEKHKPKARRHYDDRSITHGRGRELSTDSLTRLVDGSS  872

Query  543   -------DTPTDSHN---AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsg  394
                    D  TD +     K+F+NP+IH+AFLGVGEY  L  P+G+FGLGFKR  SK   
Sbjct  873   AGNTSSPDGKTDDNRENVGKIFRNPRIHDAFLGVGEYSGLVLPEGKFGLGFKRNRSKSES  932

Query  393   ligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS-MK  217
             L GFGHSGMGGSTGFCD +NRF+IA+TLNK+S GGVTA II+LVCSELNIPVPE+ S + 
Sbjct  933   LTGFGHSGMGGSTGFCDAENRFSIAVTLNKMSLGGVTADIIKLVCSELNIPVPEDFSTLS  992

Query  216   LESESSNLAQPIIN  175
                 +  ++ P+IN
Sbjct  993   AMGSAQEISTPVIN  1006



>ref|XP_008360489.1| PREDICTED: uncharacterized protein LOC103424180 [Malus domestica]
Length=943

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 160/256 (63%), Gaps = 26/256 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHRH  697
            A  LP +FN L  RRA+IPAANGH SARALARYYA LVDGG +PP  SSS  P  GSH H
Sbjct  691  ATALPALFNMLNIRRAMIPAANGHFSARALARYYATLVDGGVVPPPHSSSSKPALGSHPH  750

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsS-------------RNASGNEYVLV  556
            +PKF    + KK+   R +K  +   +   +    +             RN SG+     
Sbjct  751  IPKFADQPSLKKQKGNRSKKIAAAFRNXRTNKYEKTPQDSKDQDIGSHRRNTSGDSNT--  808

Query  555  VNDDDTPTDS---------HNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
             N  DT  D             K+F NP+IH+AF+G GEY  L  PDG FGLGFKR +SK
Sbjct  809  CNGSDTVLDEIIVNPNPQKDVVKIFNNPRIHDAFMGXGEYSNLAKPDGSFGLGFKRYYSK  868

Query  402  DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            D  LIGFGHSGMGGSTGFCD+KNRF+IA+TLNK+S G  TAKIIQLVCSELNIPVPE+  
Sbjct  869  DRSLIGFGHSGMGGSTGFCDIKNRFSIAVTLNKMSXGLETAKIIQLVCSELNIPVPEDYL  928

Query  222  MKLESESSNLAQPIIN  175
               E+  S+  +P+IN
Sbjct  929  RYAETGPSD-GKPLIN  943



>ref|XP_008391427.1| PREDICTED: uncharacterized protein LOC103453649 [Malus domestica]
Length=963

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 160/256 (63%), Gaps = 26/256 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHRH  697
            A  LP +FN L  RRA+IPAANGH SARALARYYA LVDGG +PP  SSS  P  GSH H
Sbjct  711  ATALPALFNMLNIRRAMIPAANGHFSARALARYYATLVDGGVVPPPHSSSSKPALGSHPH  770

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsS-------------RNASGNEYVLV  556
            +PKF    + KK+   R +K  +   +   +    +             RN SG+     
Sbjct  771  IPKFADQPSLKKQKGNRSKKIAAAFRNXRTNKYEKTPQDSKDQDIGSHXRNTSGDSNT--  828

Query  555  VNDDDTPTDS---------HNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
             N  DT  D             K+F NP+IH+AF+G GEY  L  PDG FGLGFKR +SK
Sbjct  829  CNGSDTVLDEIIVNPNPQKDVVKIFNNPRIHDAFMGXGEYSNLAKPDGSFGLGFKRYYSK  888

Query  402  DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            D  LIGFGHSGMGGSTGFCD+KNRF+IA+TLNK+S G  TAKIIQLVCSELNIPVPE+  
Sbjct  889  DRSLIGFGHSGMGGSTGFCDIKNRFSIAVTLNKMSXGLETAKIIQLVCSELNIPVPEDYL  948

Query  222  MKLESESSNLAQPIIN  175
               E+  S+  +P+IN
Sbjct  949  RYAETGPSD-GKPLIN  963



>ref|XP_010541525.1| PREDICTED: uncharacterized protein LOC104814963 isoform X1 [Tarenaya 
hassleriana]
Length=1015

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 153/254 (60%), Gaps = 21/254 (8%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
             A TLP++FN L  RRAIIPAAN HCSARALARYYA L D G +PP  SS     LGSH H
Sbjct  762   ATTLPVIFNTLDVRRAIIPAANLHCSARALARYYATLADSGLVPPSHSSLSKPQLGSHSH  821

Query  696   V--------pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDD-  544
             +              K  +  +  + +       D      G  R  S +    +V+   
Sbjct  822   IPKLFLSLNDTSKKKKEKEMAVAEKHKPKARRHYDDRSITHGRGRELSTDSLTRLVDGSS  881

Query  543   -------DTPTDSHN---AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsg  394
                    D  TD +     K+F+NP+IH+AFLGVGEY  L  P+G+FGLGFKR  SK   
Sbjct  882   AGNTSSPDGKTDDNRENVGKIFRNPRIHDAFLGVGEYSGLVLPEGKFGLGFKRNRSKSES  941

Query  393   ligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS-MK  217
             L GFGHSGMGGSTGFCD +NRF+IA+TLNK+S GGVTA II+LVCSELNIPVPE+ S + 
Sbjct  942   LTGFGHSGMGGSTGFCDAENRFSIAVTLNKMSLGGVTADIIKLVCSELNIPVPEDFSTLS  1001

Query  216   LESESSNLAQPIIN  175
                 +  ++ P+IN
Sbjct  1002  AMGSAQEISTPVIN  1015



>ref|XP_010432830.1| PREDICTED: uncharacterized protein LOC104717024 [Camelina sativa]
Length=965

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 156/257 (61%), Gaps = 26/257 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A +LP++FN L  RRAIIPAANGH SARALARYYA L DGG +PP  SS   P LGSH H
Sbjct  711  ATSLPVLFNTLNVRRAIIPAANGHSSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  770

Query  696  V-----------pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVN  550
            V            +        +KL  +  +      +       SSR ++      +V+
Sbjct  771  VPKFTWLKDTRKKRKGKEMAATEKLKPKDHQERRLYDEKQFMSASSSRESNTESLARLVD  830

Query  549  D-----------DDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
                        DD   D HN  +F NP+IH+AF+G G+Y     PDG+FGLGFKR+ S+
Sbjct  831  TSSSAGETEISRDDHQDDIHN--MFSNPRIHDAFMGSGDYSNFVVPDGKFGLGFKRVISQ  888

Query  402  DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            D  L+GFGHS MGGSTGFCD+KNRF+IA+TLNK+S GGVTA I+QLVCSEL IP+P++ S
Sbjct  889  DGSLVGFGHSDMGGSTGFCDIKNRFSIAVTLNKMSMGGVTANIMQLVCSELYIPLPKDFS  948

Query  222  MKLE-SESSNLAQPIIN  175
            +       S +A P+IN
Sbjct  949  LSSAIGPDSEMATPLIN  965



>ref|XP_010454806.1| PREDICTED: uncharacterized protein LOC104736503 [Camelina sativa]
Length=897

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 160/257 (62%), Gaps = 26/257 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A +LP++FN L  RRAIIPAANGH SARALARYYA L DGG +PP  SS   P LGSH H
Sbjct  643  ATSLPVLFNTLNVRRAIIPAANGHLSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  702

Query  696  Vpkfpspk-----------tpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVN  550
            VPKF S K              +KL  +  +      +       SSR ++      +V+
Sbjct  703  VPKFTSLKDTTKKRKGKEIAATEKLKPKDHQEKRLYDEKQFISASSSRESNTESLARLVD  762

Query  549  D-----------DDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
                        DD   D HN  +F NP I +AF+G G+Y  L  PDG+FGLGFKR+ S+
Sbjct  763  TSSSAGETEISRDDHQDDIHN--MFSNPMILDAFMGAGDYSNLVVPDGKFGLGFKRVISQ  820

Query  402  DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            D  L GFGHSGMGGSTGFCD+KNRF+IA+TLNK+S GGVTA I+QLVCSELNIP+P++ S
Sbjct  821  DGSLAGFGHSGMGGSTGFCDIKNRFSIAVTLNKMSMGGVTANIMQLVCSELNIPLPKDFS  880

Query  222  MKLE-SESSNLAQPIIN  175
            +       S +A P+IN
Sbjct  881  LSSAIGPDSEMATPLIN  897



>ref|NP_568458.1| ABC1 family protein [Arabidopsis thaliana]
 gb|AAL24393.1| Unknown protein [Arabidopsis thaliana]
 gb|AAQ22645.1| At5g24810/F6A4.20 [Arabidopsis thaliana]
 gb|AED93364.1| ABC1 family protein [Arabidopsis thaliana]
Length=1009

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 164/254 (65%), Gaps = 22/254 (9%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKI-pplssssmppLGSHRH  697
             A  LP++FN L  RRAIIPAANGHCSARALARYYA L DGG + PP SS S PPLGSH H
Sbjct  757   ATNLPVLFNTLNVRRAIIPAANGHCSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  816

Query  696   VpkfpspktpkkKLL-----------ARWRKAdsesgdssdsddgsSRNASGNEYVLVVN  550
             VPKF S K   KK             ++  +      +       SSR ++      +V+
Sbjct  817   VPKFTSLKDTTKKKKGKEMAATEKGKSKDHQERKLYDEKQFMSASSSRESNTESLARLVD  876

Query  549   DDDTP------TDSHN---AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDs  397
              + +       +D H      +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR  S+D 
Sbjct  877   TNSSAGKTEINSDDHQHDIHNMFSNPRIHDAFMGAGDYSGLVVPDGKFGLGFKRAISQDG  936

Query  396   gligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMK  217
              L+GFGHSG+GGSTGFCD+ NRF+IA+TLNK+S GGVTA I++LVCSELNIP+P++ +  
Sbjct  937   SLVGFGHSGLGGSTGFCDINNRFSIAVTLNKMSMGGVTANIVKLVCSELNIPLPKDFATD  996

Query  216   LESESSNLAQPIIN  175
             + ++ S +  P+IN
Sbjct  997   IGAD-SQMGTPLIN  1009



>ref|NP_001190388.1| ABC1 family protein [Arabidopsis thaliana]
 gb|AED93365.1| ABC1 family protein [Arabidopsis thaliana]
Length=1040

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 164/254 (65%), Gaps = 22/254 (9%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKI-pplssssmppLGSHRH  697
             A  LP++FN L  RRAIIPAANGHCSARALARYYA L DGG + PP SS S PPLGSH H
Sbjct  788   ATNLPVLFNTLNVRRAIIPAANGHCSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  847

Query  696   VpkfpspktpkkKLL-----------ARWRKAdsesgdssdsddgsSRNASGNEYVLVVN  550
             VPKF S K   KK             ++  +      +       SSR ++      +V+
Sbjct  848   VPKFTSLKDTTKKKKGKEMAATEKGKSKDHQERKLYDEKQFMSASSSRESNTESLARLVD  907

Query  549   DDDTP------TDSHN---AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDs  397
              + +       +D H      +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR  S+D 
Sbjct  908   TNSSAGKTEINSDDHQHDIHNMFSNPRIHDAFMGAGDYSGLVVPDGKFGLGFKRAISQDG  967

Query  396   gligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMK  217
              L+GFGHSG+GGSTGFCD+ NRF+IA+TLNK+S GGVTA I++LVCSELNIP+P++ +  
Sbjct  968   SLVGFGHSGLGGSTGFCDINNRFSIAVTLNKMSMGGVTANIVKLVCSELNIPLPKDFATD  1027

Query  216   LESESSNLAQPIIN  175
             + ++ S +  P+IN
Sbjct  1028  IGAD-SQMGTPLIN  1040



>ref|XP_007161530.1| hypothetical protein PHAVU_001G077100g [Phaseolus vulgaris]
 gb|ESW33524.1| hypothetical protein PHAVU_001G077100g [Phaseolus vulgaris]
Length=964

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 154/265 (58%), Gaps = 43/265 (16%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A TLPI+FN L  RRAIIPAANGH SARALARYYAAL DGGKIPP  SS+    LGSH H
Sbjct  711  ATTLPIVFNTLNVRRAIIPAANGHVSARALARYYAALADGGKIPPPHSSASKPLLGSHPH  770

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHN-  520
            +PK  S +        R RK       +  +       ++   Y  V + DD   D  + 
Sbjct  771  IPKLTSSQKT-----PRKRKCIGRKKATMPAV------STNKSYEKVSSYDDLEADVGSN  819

Query  519  -------------------------AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKR  415
                                      K+++NP+I + FLG G+YE L   +G FGLGFKR
Sbjct  820  TNRESSSSDDTSTSRIDNNLRTPVAGKVYRNPRIIDEFLGAGDYENLALKNGSFGLGFKR  879

Query  414  IHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
              SKD   I  GHSGMGGSTGFCD+ N+F+IA+TLNK+SFGGVT KI+QLVCSELNIPVP
Sbjct  880  FTSKDGSSIALGHSGMGGSTGFCDVTNKFSIAVTLNKMSFGGVTGKIVQLVCSELNIPVP  939

Query  234  EE-----ISMKLESESSNLAQPIIN  175
            ++     +  + E     + +P+IN
Sbjct  940  DDFLRFAVEQRGEDAQLQMGRPMIN  964



>gb|KFK27753.1| hypothetical protein AALP_AA8G424500 [Arabis alpina]
Length=955

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 153/242 (63%), Gaps = 26/242 (11%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  LP++FN L  RRAIIPAANGHCSARALARYYA L DGG +PP  SS S PPLGSH H
Sbjct  700  ATNLPVLFNTLNVRRAIIPAANGHCSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  759

Query  696  VpkfpspktpkkKLLARWRKAdse------------sgdssdsddgsSRNASGNEYVLVV  553
            VPKF +     KK   +   A  +              +   +  G  R++S      +V
Sbjct  760  VPKFSASNDTAKKRKGKEMAATEKHKPKDHQEKKKLYDEEQLTSAGRGRDSSTESLARLV  819

Query  552  NDDDTPT-----------DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHS  406
            ND  T             + HN  +F NP+IH+AF+G G Y  L  PDG+FGLGFKR+  
Sbjct  820  NDTGTSAGKSEISGNDQDEIHN--MFSNPRIHDAFMGTGNYSGLVLPDGKFGLGFKRVTL  877

Query  405  KDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEI  226
            +D  L+GFGHSG+GGS GFCD++NRF+IAITLNK+S G VTA II+LVCSELNIP P++ 
Sbjct  878  QDGSLVGFGHSGIGGSIGFCDIENRFSIAITLNKMSLGSVTANIIRLVCSELNIPYPKDF  937

Query  225  SM  220
            ++
Sbjct  938  AV  939



>gb|KJB55250.1| hypothetical protein B456_009G069300 [Gossypium raimondii]
Length=832

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 159/253 (63%), Gaps = 37/253 (15%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A  LP  FN L  RRAI+PAANGHCSARALARYYAAL D G +PP  SS+  P LGSH H
Sbjct  597  AEYLPAFFNMLNVRRAIVPAANGHCSARALARYYAALADCGVVPPPHSSASNPPLGSHPH  656

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSR-NASGNEYVLVV-----------  553
            +PKFPS            +K D +     D    + R +   N Y+ +            
Sbjct  657  IPKFPS------------KKTDEKQKGKVDGGLKNERSDGRQNVYIRIEEDDDNDEEKCS  704

Query  552  -NDDDTPT----DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgli  388
             +  DT      ++   K+F NP++HEAF+GVGEYE +   DG FGLGF+R+ SKD    
Sbjct  705  KSSRDTSKGAGPENKKGKIFSNPRVHEAFMGVGEYENMCLRDGVFGLGFRRLKSKDGDGS  764

Query  387  gfg--hsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKL  214
              G  HSGMGGSTGFCD+KNRFA+A+TLNKLSFGGVTAKI++L+CSELN+P+PE +    
Sbjct  765  YSGFGHSGMGGSTGFCDVKNRFAMAVTLNKLSFGGVTAKIVELICSELNLPLPEGL----  820

Query  213  ESESSNLAQPIIN  175
             S S ++ +P+IN
Sbjct  821  -SGSGDINRPLIN  832



>gb|KHG17463.1| putative aarF domain-containing protein kinase 1 [Gossypium arboreum]
Length=1052

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 157/252 (62%), Gaps = 36/252 (14%)
 Frame = -1

Query  873   AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
             A  LP  FN L  RRAI+PAANGHCSARALARYYAAL D G + P  SS+  P LGSH H
Sbjct  818   AEYLPAFFNMLNVRRAIVPAANGHCSARALARYYAALADCGVVLPPHSSASNPPLGSHPH  877

Query  696   VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSR-NASGNEYVLVV-----------  553
             +PKFPS            +K D +     D    + R +   N Y+ +            
Sbjct  878   IPKFPS------------KKTDEKQKGKVDGGVKNERSDGRQNIYIRIEEDDDDEEKCSK  925

Query  552   NDDDTPT----DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsglig  385
             +  DT      ++   K+F NP++HEAF+GVGEYE +   DG FGLGF+R+ SKD     
Sbjct  926   SSRDTSKGGGPENKKGKIFSNPRVHEAFMGVGEYENMCLRDGVFGLGFRRLKSKDGDGSY  985

Query  384   fgh--sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLE  211
              G   SGMGGSTGFCD+KNRFA+A+TLNKLSFGGVTAKI++L+CSELN+P+PE +     
Sbjct  986   SGFGHSGMGGSTGFCDVKNRFAMAVTLNKLSFGGVTAKIVELICSELNLPLPEGL-----  1040

Query  210   SESSNLAQPIIN  175
             S S ++ +P+IN
Sbjct  1041  SGSGDINRPLIN  1052



>gb|KJB55249.1| hypothetical protein B456_009G069300 [Gossypium raimondii]
Length=985

 Score =   142 bits (358),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 158/253 (62%), Gaps = 37/253 (15%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A  LP  FN L  RRAI+PAANGHCSARALARYYAAL D G +PP  SS+  P LGSH H
Sbjct  750  AEYLPAFFNMLNVRRAIVPAANGHCSARALARYYAALADCGVVPPPHSSASNPPLGSHPH  809

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSR-NASGNEYVLVV-----------  553
            +PKFPS            +K D +     D    + R +   N Y+ +            
Sbjct  810  IPKFPS------------KKTDEKQKGKVDGGLKNERSDGRQNVYIRIEEDDDNDEEKCS  857

Query  552  -NDDDTPT----DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgli  388
             +  DT      ++   K+F NP++HEAF+GVGEYE +   DG FGLGF+R+ SKD    
Sbjct  858  KSSRDTSKGAGPENKKGKIFSNPRVHEAFMGVGEYENMCLRDGVFGLGFRRLKSKDGDGS  917

Query  387  gfgh--sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKL  214
              G   SGMGGSTGFCD+KNRFA+A+TLNKLSFGGVTAKI++L+CSELN+P+PE +    
Sbjct  918  YSGFGHSGMGGSTGFCDVKNRFAMAVTLNKLSFGGVTAKIVELICSELNLPLPEGL----  973

Query  213  ESESSNLAQPIIN  175
             S S ++ +P+IN
Sbjct  974  -SGSGDINRPLIN  985



>ref|XP_009367941.1| PREDICTED: uncharacterized protein LOC103957500 [Pyrus x bretschneideri]
 ref|XP_009367942.1| PREDICTED: uncharacterized protein LOC103957500 [Pyrus x bretschneideri]
 ref|XP_009367943.1| PREDICTED: uncharacterized protein LOC103957500 [Pyrus x bretschneideri]
Length=959

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 160/256 (63%), Gaps = 26/256 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A  LP++FN L  RRA+IPAANGH SARALARYYAAL DGG +P   SSS    LGSH H
Sbjct  707  ATALPVLFNMLNVRRAMIPAANGHFSARALARYYAALADGGVVPLPHSSSSKPALGSHPH  766

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsS-------------RNASGNEYVLV  556
            +PKFP+  +PK++   R +K  +   +   +    +             RN S +     
Sbjct  767  IPKFPAQPSPKQQKGNRSKKIAAAFRNMRTNTYEKTTQNSKDHDIGSHSRNTSSDSNT--  824

Query  555  VNDDDTPTDS---------HNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSK  403
             N  DT  D           +AK+F NP+IH+AF+GVGEY  L  PDG+FGLGF+R +S+
Sbjct  825  CNASDTVLDEVVVNPNPQKDSAKIFSNPRIHDAFMGVGEYANLVKPDGKFGLGFRRYYSQ  884

Query  402  DsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            D  LIGFGHSGMGGST FCD+KNR +IA+TLNK+ FG  T KI+  +CSELNIPVP +  
Sbjct  885  DGSLIGFGHSGMGGSTAFCDIKNRLSIAVTLNKMVFGAETGKIVHFICSELNIPVPADYL  944

Query  222  MKLESESSNLAQPIIN  175
               E+  S+  +P+IN
Sbjct  945  RFAETAPSD-GKPLIN  959



>gb|EYU22093.1| hypothetical protein MIMGU_mgv1a000993mg [Erythranthe guttata]
Length=918

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 153/240 (64%), Gaps = 38/240 (16%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKI---pplssssmppLGSH  703
            A TLP +FN L  RRAIIPAAN HCSARALARYYAALVD G +      SS + P LGSH
Sbjct  710  ASTLPALFNTLFARRAIIPAANAHCSARALARYYAALVDRGTVPPPHAHSSPTHPRLGSH  769

Query  702  RHVpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSH  523
             H PKFPS K  KK                        +  S     +V+  D T     
Sbjct  770  PHTPKFPSLKPSKK------------------------QKKSDRLSEIVIAKDYT-----  800

Query  522  NAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCD  343
              ++F N +IH+AF+GVGEYE L    GQFGLGFKR +S+   LIGFGHSGMGGSTG+CD
Sbjct  801  --RIFGNARIHDAFMGVGEYEDLVLSGGQFGLGFKRSYSEGGELIGFGHSGMGGSTGYCD  858

Query  342  MKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESES----SNLAQPIIN  175
            +KNRFAIA+TLNK++FGGVTAK+++LVCSEL+IP+P +     E  S    SNLA P+IN
Sbjct  859  VKNRFAIAVTLNKMNFGGVTAKVMKLVCSELDIPLPADFYRFTERISDDIDSNLAAPLIN  918



>ref|XP_008466267.1| PREDICTED: uncharacterized protein LOC103503727 [Cucumis melo]
Length=967

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 165/267 (62%), Gaps = 43/267 (16%)
 Frame = -1

Query  867  TLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppL-GSHRHVp  691
            TL  +FN L TRRAIIPAANGHCSARALARYYAAL DGG IPP  SSS  P  GSH H+P
Sbjct  708  TLTPLFNMLNTRRAIIPAANGHCSARALARYYAALADGGVIPPPHSSSSQPALGSHPHIP  767

Query  690  kfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNE----------------YVL  559
            KF S        + + +KA       ++ ++   +N+S  E                Y  
Sbjct  768  KFTSE-------IPKKQKAARSKDVHTNVNNNHEKNSSSTETAENNNSIFRTTSNTGYTR  820

Query  558  VVNDDDTPTDSHN-----------------AKLFKNPKIHEAFLGVGEYEKLTYPDGQFG  430
            ++ND  + +++++                   ++KNP+IH+AFLG+ EYE  T P+G+FG
Sbjct  821  LLNDSSSCSNTNDPSTRVDIRHPNDGNKFVGNIYKNPRIHDAFLGIREYENYTIPNGKFG  880

Query  429  LGFKRIHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSEL  250
            LGF R+ S++   IGFGHSGMGGSTGFC++ +RFAI++ +NKLS GGVTA IIQLVCSEL
Sbjct  881  LGFSRLRSEEGSFIGFGHSGMGGSTGFCNIDHRFAISVMVNKLSLGGVTASIIQLVCSEL  940

Query  249  NIPVPEEISMK--LESESSNLAQPIIN  175
            NIP+P E S     + + S +  P+IN
Sbjct  941  NIPLPVEFSSPGISDGQHSIVETPLIN  967



>ref|XP_006850925.1| PREDICTED: uncharacterized protein LOC18440724 [Amborella trichopoda]
 gb|ERN12506.1| hypothetical protein AMTR_s00025p00182260 [Amborella trichopoda]
Length=924

 Score =   139 bits (350),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 152/236 (64%), Gaps = 8/236 (3%)
 Frame = -1

Query  876  SAXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRH  697
            +   LP++FN L  RRAIIPAANGH SARALAR+YA LV GG IPP  S   PPLGSH H
Sbjct  697  TVSALPVLFNTLNIRRAIIPAANGHFSARALARFYATLVSGGSIPPPHSPREPPLGSHPH  756

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
            +PKFPS +T  K   +   K  +++ +     +    + S N      N + T +D  N 
Sbjct  757  IPKFPSQETKIKTKRSSKNKNTAKTNNDKKHSNEDLPSGSINHNNKFYNGNGTSSDG-NT  815

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            K+FK+P I +AF+GVG+YE L  P+G+FGLGF+R  S       FGHSGMGGSTGFCD+K
Sbjct  816  KIFKSPSIRDAFMGVGDYEGLVLPNGKFGLGFRRFGS-----GCFGHSGMGGSTGFCDVK  870

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLAQPIIN*Y  169
            + FA+A+TLNK+S GGVT K++QLVCSEL +P+P  +      E+    QP I  Y
Sbjct  871  HGFAMAVTLNKMSLGGVTRKVVQLVCSELGVPLP--VDFAETGETGPDMQPTIRTY  924



>ref|XP_002527984.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
 gb|EEF34396.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
Length=965

 Score =   139 bits (350),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 164/253 (65%), Gaps = 22/253 (9%)
 Frame = -1

Query  867  TLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRHVp  691
            T+P +FN L  RRA IPAANGHCSARALARYYAAL DGG  PP  SS     LGSH H+P
Sbjct  713  TVPALFNMLIVRRATIPAANGHCSARALARYYAALADGGLTPPPHSSFTKPALGSHPHIP  772

Query  690  kfpspktpkkKLLARWRKAdsesgdssdsddgsSRNA----SGNE-YVLVVNDD------  544
            KF S KTPKK+   R     +    SSD     +++     +GN+ Y  +  D       
Sbjct  773  KFSSEKTPKKQKGKRKEVTTTSKKRSSDYSRNHNKDLEEGNNGNDGYTRLATDGSSSASA  832

Query  543  -------DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsglig  385
                   D     +  ++F +P+IH+AFLGVGEYE L  P+G+FGLGF+R  S D  LIG
Sbjct  833  ADSFASGDGNKRDNVTRIFIDPRIHDAFLGVGEYENLAVPNGKFGLGFRRNSSNDGSLIG  892

Query  384  fghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESE  205
            FGHSGMGGSTGFCD+KNRFAIA+T+NKLS G VT KI +LVCSE+N+P+PEE+S+  E  
Sbjct  893  FGHSGMGGSTGFCDIKNRFAIAVTVNKLSVGFVTRKIAELVCSEVNVPLPEELSISGERG  952

Query  204  SS---NLAQPIIN  175
                 N+ +P+IN
Sbjct  953  PDLELNIGKPLIN  965



>ref|XP_009403303.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=764

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 153/225 (68%), Gaps = 10/225 (4%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  +P++FN L  RRA+IPAANGHCSARALARYYAAL +GG  PP  S  S PPLGSH H
Sbjct  527  ASGVPVLFNTLNIRRAVIPAANGHCSARALARYYAALANGGSTPPPHSLVSKPPLGSHVH  586

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNE-------YVLVVNDDDT  538
            VP FPS K PKKKL  R ++ D+    +  +D    R  S +        Y +V N+ D 
Sbjct  587  VPTFPSFKQPKKKL--RIKEIDNPDTPTKKTDGLRRRGCSNSNSPKNNKAYNIVDNNIDN  644

Query  537  PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggs  358
                   ++F +PKIH+AF+GVG+Y  +   DG+FGLGF+R ++       FGHSG+GGS
Sbjct  645  DAQKSVQRIFSSPKIHDAFMGVGDYSDMVIADGKFGLGFRRFNTAAGNPTSFGHSGVGGS  704

Query  357  tGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            TGFC++++ F+IA+T+NK+S GGVT  IIQLVCSELNIPVPEE S
Sbjct  705  TGFCNIEHNFSIAVTVNKMSLGGVTRSIIQLVCSELNIPVPEEFS  749



>ref|XP_009403302.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 153/225 (68%), Gaps = 10/225 (4%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  +P++FN L  RRA+IPAANGHCSARALARYYAAL +GG  PP  S  S PPLGSH H
Sbjct  710  ASGVPVLFNTLNIRRAVIPAANGHCSARALARYYAALANGGSTPPPHSLVSKPPLGSHVH  769

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNE-------YVLVVNDDDT  538
            VP FPS K PKKKL  R ++ D+    +  +D    R  S +        Y +V N+ D 
Sbjct  770  VPTFPSFKQPKKKL--RIKEIDNPDTPTKKTDGLRRRGCSNSNSPKNNKAYNIVDNNIDN  827

Query  537  PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggs  358
                   ++F +PKIH+AF+GVG+Y  +   DG+FGLGF+R ++       FGHSG+GGS
Sbjct  828  DAQKSVQRIFSSPKIHDAFMGVGDYSDMVIADGKFGLGFRRFNTAAGNPTSFGHSGVGGS  887

Query  357  tGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            TGFC++++ F+IA+T+NK+S GGVT  IIQLVCSELNIPVPEE S
Sbjct  888  TGFCNIEHNFSIAVTVNKMSLGGVTRSIIQLVCSELNIPVPEEFS  932



>ref|XP_010648446.1| PREDICTED: uncharacterized protein LOC100242392 isoform X2 [Vitis 
vinifera]
Length=854

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = -1

Query  552  NDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghs  373
            N DD+P    + K+F NP+IH+AFLGVGEYE   +P G+FGLGFK   SKD  L+GFGHS
Sbjct  727  NGDDSPKS--DTKIFSNPRIHDAFLGVGEYENYGFPSGKFGLGFKSCSSKDGTLLGFGHS  784

Query  372  gmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM----KLESE  205
            GMGGSTG+CD+ N+FAIA+TLNK+S GGVT KIIQ +CSELN+PVPE+ S     +   E
Sbjct  785  GMGGSTGYCDINNKFAIAVTLNKMSLGGVTGKIIQFICSELNLPVPEDYSRFSGSEKPEE  844

Query  204  SSNLAQPIIN  175
             SN+ +P+IN
Sbjct  845  QSNVWRPLIN  854



>ref|XP_002283043.1| PREDICTED: uncharacterized protein LOC100242392 isoform X1 [Vitis 
vinifera]
 ref|XP_010648444.1| PREDICTED: uncharacterized protein LOC100242392 isoform X1 [Vitis 
vinifera]
Length=978

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = -1

Query  552  NDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghs  373
            N DD+P    + K+F NP+IH+AFLGVGEYE   +P G+FGLGFK   SKD  L+GFGHS
Sbjct  851  NGDDSPKS--DTKIFSNPRIHDAFLGVGEYENYGFPSGKFGLGFKSCSSKDGTLLGFGHS  908

Query  372  gmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM----KLESE  205
            GMGGSTG+CD+ N+FAIA+TLNK+S GGVT KIIQ +CSELN+PVPE+ S     +   E
Sbjct  909  GMGGSTGYCDINNKFAIAVTLNKMSLGGVTGKIIQFICSELNLPVPEDYSRFSGSEKPEE  968

Query  204  SSNLAQPIIN  175
             SN+ +P+IN
Sbjct  969  QSNVWRPLIN  978



>gb|KCW82601.1| hypothetical protein EUGRSUZ_C03989 [Eucalyptus grandis]
Length=783

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 150/254 (59%), Gaps = 25/254 (10%)
 Frame = -1

Query  864  LPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssss-mppLGSHRHVpk  688
            LP MFN L  RRAIIPAANGHCSARALARYYAALVDGG +PP  S+S  P LGSH H+PK
Sbjct  531  LPAMFNMLNIRRAIIPAANGHCSARALARYYAALVDGGLVPPPHSASFQPNLGSHVHIPK  590

Query  687  fpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPT--------  532
            FPS K  K++   R +   S   +          +  G +         TP         
Sbjct  591  FPSLKVSKRQRGRRNKGLLSLLRNPYLQIPNRPNDLQGGDCGRSTTGQSTPVPDCGSSSC  650

Query  531  ---------------DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDs  397
                           +S + K+F    IH+AFLG G+Y  L  PDG FGLGFKR  +KD 
Sbjct  651  SINTSGSGGNGDKRQNSDHHKIFSGKGIHDAFLGAGDYANLALPDGMFGLGFKRSKTKDG  710

Query  396  gligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMK  217
               GFGH+GMGGSTGFCDM NRFA+A+T+NK+S G  T  II+LVCSEL++P+PE+ +  
Sbjct  711  SCFGFGHTGMGGSTGFCDMNNRFAMAVTVNKMSLGAATRSIIELVCSELDLPLPEDFATP  770

Query  216  LESESSNLAQPIIN  175
             +    N  +P+IN
Sbjct  771  TDG-GLNTERPLIN  783



>ref|XP_008798142.1| PREDICTED: uncharacterized protein LOC103713116 isoform X1 [Phoenix 
dactylifera]
Length=957

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 117/235 (50%), Positives = 156/235 (66%), Gaps = 15/235 (6%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A  LP++FN L  RRAIIPAANGHCSARALARYYAAL  GG +PP  S      LGSH H
Sbjct  711  ASGLPLLFNTLNVRRAIIPAANGHCSARALARYYAALAAGGSVPPPHSHHTKPLLGSHIH  770

Query  696  VpkfpspktpkkKLLARWRK----------AdsesgdssdsddgsSRNASGNE---YVLV  556
            +P+F   K P+KK  ++ ++          A + +G S+   DG+ R+AS  +   Y L+
Sbjct  771  IPRFAPFKKPRKKRGSKDKEIADPEPQNGSAIAANGVSNPLHDGNDRSASTTDDQGYSLI  830

Query  555  VNDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh  376
             N DD    ++ +K+F NPKIH+AF+G+G+Y  L   DG+FGLGF+R     +    FGH
Sbjct  831  ANVDDE-AGNNVSKIFSNPKIHDAFMGLGDYSHLVVADGKFGLGFRRYKPGSTNFTSFGH  889

Query  375  sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLE  211
            +G+GGS GFC++++ F+IA+T+NK+S GGV   IIQLVCSEL IP+PEE SM  E
Sbjct  890  AGIGGSVGFCNIEHDFSIAVTVNKMSLGGVPRSIIQLVCSELKIPIPEEFSMTGE  944



>ref|XP_008798143.1| PREDICTED: uncharacterized protein LOC103713116 isoform X2 [Phoenix 
dactylifera]
Length=956

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 117/235 (50%), Positives = 156/235 (66%), Gaps = 15/235 (6%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A  LP++FN L  RRAIIPAANGHCSARALARYYAAL  GG +PP  S      LGSH H
Sbjct  710  ASGLPLLFNTLNVRRAIIPAANGHCSARALARYYAALAAGGSVPPPHSHHTKPLLGSHIH  769

Query  696  VpkfpspktpkkKLLARWRK----------AdsesgdssdsddgsSRNASGNE---YVLV  556
            +P+F   K P+KK  ++ ++          A + +G S+   DG+ R+AS  +   Y L+
Sbjct  770  IPRFAPFKKPRKKRGSKDKEIADPEPQNGSAIAANGVSNPLHDGNDRSASTTDDQGYSLI  829

Query  555  VNDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh  376
             N DD    ++ +K+F NPKIH+AF+G+G+Y  L   DG+FGLGF+R     +    FGH
Sbjct  830  ANVDDE-AGNNVSKIFSNPKIHDAFMGLGDYSHLVVADGKFGLGFRRYKPGSTNFTSFGH  888

Query  375  sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLE  211
            +G+GGS GFC++++ F+IA+T+NK+S GGV   IIQLVCSEL IP+PEE SM  E
Sbjct  889  AGIGGSVGFCNIEHDFSIAVTVNKMSLGGVPRSIIQLVCSELKIPIPEEFSMTGE  943



>ref|XP_010049790.1| PREDICTED: uncharacterized protein LOC104438365 [Eucalyptus grandis]
 ref|XP_010049791.1| PREDICTED: uncharacterized protein LOC104438365 [Eucalyptus grandis]
 gb|KCW82600.1| hypothetical protein EUGRSUZ_C03989 [Eucalyptus grandis]
Length=966

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 150/254 (59%), Gaps = 25/254 (10%)
 Frame = -1

Query  864  LPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssss-mppLGSHRHVpk  688
            LP MFN L  RRAIIPAANGHCSARALARYYAALVDGG +PP  S+S  P LGSH H+PK
Sbjct  714  LPAMFNMLNIRRAIIPAANGHCSARALARYYAALVDGGLVPPPHSASFQPNLGSHVHIPK  773

Query  687  fpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPT--------  532
            FPS K  K++   R +   S   +          +  G +         TP         
Sbjct  774  FPSLKVSKRQRGRRNKGLLSLLRNPYLQIPNRPNDLQGGDCGRSTTGQSTPVPDCGSSSC  833

Query  531  ---------------DSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDs  397
                           +S + K+F    IH+AFLG G+Y  L  PDG FGLGFKR  +KD 
Sbjct  834  SINTSGSGGNGDKRQNSDHHKIFSGKGIHDAFLGAGDYANLALPDGMFGLGFKRSKTKDG  893

Query  396  gligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMK  217
               GFGH+GMGGSTGFCDM NRFA+A+T+NK+S G  T  II+LVCSEL++P+PE+ +  
Sbjct  894  SCFGFGHTGMGGSTGFCDMNNRFAMAVTVNKMSLGAATRSIIELVCSELDLPLPEDFATP  953

Query  216  LESESSNLAQPIIN  175
             +    N  +P+IN
Sbjct  954  TDG-GLNTERPLIN  966



>ref|XP_010470869.1| PREDICTED: uncharacterized protein LOC104750728 [Camelina sativa]
Length=1011

 Score =   130 bits (327),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = -1

Query  555  VNDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh  376
            ++ DD   D HN  +F NP+IH+AF+G G+Y  L  PDG+FGLGFKR+ S+D  L GFGH
Sbjct  886  ISKDDHQDDIHN--MFSNPRIHDAFMGSGDYSNLVVPDGKFGLGFKRVISQDGSLAGFGH  943

Query  375  sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM  220
            SGMGGSTGFCD+KNRF+IA+TLNK+S GGVTA I+QLVCSELNIP+P++ S+
Sbjct  944  SGMGGSTGFCDIKNRFSIAVTLNKMSMGGVTANIMQLVCSELNIPLPKDFSL  995



>ref|XP_010669478.1| PREDICTED: uncharacterized protein LOC104886700 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=988

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -1

Query  549  DDDTPTDSHN---AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfg  379
            D D   D H     KLF NP IH+AF+G+GEYE L  P+G FGLGFKRI S D  +IGFG
Sbjct  861  DSDVNGDDHEKTPEKLFTNPGIHDAFIGLGEYEHLALPNGDFGLGFKRITSADGSIIGFG  920

Query  378  hsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS  199
            HSGMGGSTGFCD+KN+F+IAITLNK+SFG VT +IIQLVCSELN+P+P+E+     +   
Sbjct  921  HSGMGGSTGFCDIKNKFSIAITLNKMSFGAVTGEIIQLVCSELNLPLPKELKGLEGNLEL  980

Query  198  NLAQPIIN  175
            N  +P+IN
Sbjct  981  NSGRPLIN  988



>ref|XP_010669479.1| PREDICTED: uncharacterized protein LOC104886700 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=968

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -1

Query  549  DDDTPTDSHN---AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfg  379
            D D   D H     KLF NP IH+AF+G+GEYE L  P+G FGLGFKRI S D  +IGFG
Sbjct  841  DSDVNGDDHEKTPEKLFTNPGIHDAFIGLGEYEHLALPNGDFGLGFKRITSADGSIIGFG  900

Query  378  hsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS  199
            HSGMGGSTGFCD+KN+F+IAITLNK+SFG VT +IIQLVCSELN+P+P+E+     +   
Sbjct  901  HSGMGGSTGFCDIKNKFSIAITLNKMSFGAVTGEIIQLVCSELNLPLPKELKGLEGNLEL  960

Query  198  NLAQPIIN  175
            N  +P+IN
Sbjct  961  NSGRPLIN  968



>gb|AFK48358.1| unknown [Lotus japonicus]
Length=168

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 89/120 (74%), Gaps = 5/120 (4%)
 Frame = -1

Query  519  AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDM  340
             K+++NP+I + FLG GE E L  P+G FGLGFKR+ S +   I FGHSGMGGSTGFCD+
Sbjct  49   GKVYRNPRIIDEFLGAGECENLALPNGGFGLGFKRLSSNNGSSIAFGHSGMGGSTGFCDV  108

Query  339  KNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEI-----SMKLESESSNLAQPIIN  175
             NRFAIA+TLNK+SFGGV+AKI+QLVCSEL IPVP++          + E  +L +P+IN
Sbjct  109  TNRFAIAVTLNKMSFGGVSAKIVQLVCSELQIPVPDDFLRFMAQQSGQDEQLSLGRPLIN  168



>ref|XP_003588594.1| aarF domain-containing protein kinase, putative [Medicago truncatula]
Length=953

 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 154/245 (63%), Gaps = 23/245 (9%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A ++P +FN L  RRAIIPAANGH SARALARYYAAL DGGKIP   SS+    LGSH H
Sbjct  720  ATSVPPIFNTLNVRRAIIPAANGHVSARALARYYAALADGGKIPSPHSSTSKPLLGSHTH  779

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYV----LVVNDDDT---  538
            +PK           L+  +                + N S  +++    L V   +T   
Sbjct  780  IPK-----------LSSQKAPKKRKCIGRTVTTLPAVNKSYEKFLVKKTLRVQKAETLAQ  828

Query  537  --PTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmg  364
                    A +++NP+I + FLG GEYE L+ P G FGLGFKR  SKD   I FGHSGMG
Sbjct  829  VVAVVVILAVVYQNPRIVDEFLGAGEYENLSLPGGGFGLGFKRFSSKDGSTIAFGHSGMG  888

Query  363  gstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESES--SNLA  190
            GSTGFCD+ NRF+IA+TLNK+SFGGVT KI+QLVCSELNIPVP++      ++S  +NLA
Sbjct  889  GSTGFCDVTNRFSIAVTLNKMSFGGVTGKIVQLVCSELNIPVPDDFLRYAANQSGDANLA  948

Query  189  QPIIN  175
            +P+IN
Sbjct  949  RPMIN  953



>ref|XP_009403305.1| PREDICTED: uncharacterized protein LOC103986888 [Musa acuminata 
subsp. malaccensis]
Length=912

 Score =   127 bits (319),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 147/223 (66%), Gaps = 25/223 (11%)
 Frame = -1

Query  876  SAXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGK-IpplssssmppLGSHR  700
            +  +LP++FN L TRRAIIPAAN HCSARALAR+YAAL +GG  +PP S  S PPLGSH 
Sbjct  707  TMSSLPVLFNNLNTRRAIIPAANAHCSARALARFYAALANGGSTLPPHSLLSKPPLGSHV  766

Query  699  HVpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHN  520
            H P FP  K PKK    +W +               ++N+S  +  +   DD  P ++  
Sbjct  767  HTPTFPPLKRPKKNWRVKWTQ---------------NKNSSLTDISI---DDGGPKNTRT  808

Query  519  AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDM  340
              +F++P IH+AF+GVG+Y  +  P+G+FGLGF+R ++    L GFGH+G+GGS+  CD 
Sbjct  809  --IFRSPTIHDAFMGVGDYSGMAIPNGRFGLGFRRFNTTTGDLRGFGHAGVGGSSAVCDT  866

Query  339  KNRFAIAITLNKLSFGGVTAKIIQLVCSELNI----PVPEEIS  223
            ++ F+IA+T+NK+  GGVT  I+QLVCSELNI    P+PEE S
Sbjct  867  EHNFSIAVTVNKMGLGGVTGSILQLVCSELNIELNLPLPEEFS  909



>ref|XP_011008661.1| PREDICTED: uncharacterized protein LOC105113984 [Populus euphratica]
Length=982

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 145/251 (58%), Gaps = 35/251 (14%)
 Frame = -1

Query  867  TLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRHV-  694
            TL  + N L  RRAIIPAANGHCSARALARYYA+LVD G +PP  SS   P LGSH H+ 
Sbjct  714  TLLALSNTLNIRRAIIPAANGHCSARALARYYASLVDRGLVPPSHSSLSTPPLGSHPHIP  773

Query  693  ------pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNE-----YVLVVND  547
                            K + +  +K ++     +     S  N SG E     Y  +  D
Sbjct  774  KFSSEITSKMQNGKTSKAVGSASKKKENGYEQKTKQSKDSKDNGSGGESNRDGYTRIAVD  833

Query  546  ----------------DDTPTDSHNAK------LFKNPKIHEAFLGVGEYEKLTYPDGQF  433
                            D+    S++++      +F +P+IH+ F+G GEY  L  P+G+F
Sbjct  834  STSGSSSISISNTSSPDNGSVSSNDSRKNNVISVFNDPRIHDEFMGTGEYSDLVLPNGKF  893

Query  432  GLGFKRIHSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSE  253
            GLGF+R  + D    GFGHSG+GGSTGFCD++NR AIA+TLNK+SFG  T KIIQ VCSE
Sbjct  894  GLGFERFSASDGSFNGFGHSGLGGSTGFCDIENRLAIAVTLNKISFGTATRKIIQFVCSE  953

Query  252  LNIPVPEEISM  220
            LN+P+P+E S+
Sbjct  954  LNVPLPDEFSI  964



>ref|XP_010927205.1| PREDICTED: uncharacterized protein LOC105049295 [Elaeis guineensis]
 ref|XP_010927206.1| PREDICTED: uncharacterized protein LOC105049295 [Elaeis guineensis]
Length=956

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 148/232 (64%), Gaps = 15/232 (6%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A  LP++FN L  RRAIIPAANGHCSARALARYYAAL  GG IPP  S      LGSH H
Sbjct  710  ASGLPVLFNTLNMRRAIIPAANGHCSARALARYYAALATGGFIPPPHSHHSKPLLGSHIH  769

Query  696  VpkfpspktpkkKLLARWRK-------------AdsesgdssdsddgsSRNASGNEYVLV  556
            +PKFPS K P+KK  ++ ++             A+  S      +  S+  ++   Y L+
Sbjct  770  IPKFPSLKKPRKKKGSKDKEIADPEPQNGTVIAANGISKSLQYGNGHSASTSNDKGYSLI  829

Query  555  VNDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh  376
             +  D   D++  ++F NPKIH AF+GVG+Y  L   DG+FGLGF+R  S  S    FGH
Sbjct  830  ASVGDE-ADNNVRRIFSNPKIHNAFMGVGDYSHLVIADGKFGLGFRRYKSDSSKFTSFGH  888

Query  375  sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM  220
            SG+GGS GFC++++ F+IA+T+NK+S G V   IIQ VCSEL +PVPEE SM
Sbjct  889  SGIGGSVGFCNIEHDFSIAVTVNKMSLGSVPRSIIQFVCSELEVPVPEEFSM  940



>ref|XP_006371820.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
 gb|ERP49617.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
Length=962

 Score =   124 bits (311),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 3/117 (3%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            K+F NP+IH+ F+GVGEY  L  P+G+FGLGF+R  S D    GFGHSGMGGSTGFCD+K
Sbjct  846  KIFNNPRIHDEFMGVGEYRNLVLPNGKFGLGFRRFSSSDGSFYGFGHSGMGGSTGFCDIK  905

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLES---ESSNLAQPIIN  175
            NRFAIA+TLNK+S G  T +I+Q VCSELN+P+P+E ++  E+   E  ++A+P+IN
Sbjct  906  NRFAIAVTLNKMSLGTATRRIVQFVCSELNVPLPDEFAVLSETAPDEELSIARPLIN  962



>ref|XP_006371821.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
 gb|ERP49618.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
Length=978

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 3/117 (3%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            K+F NP+IH+ F+GVGEY  L  P+G+FGLGF+R  S D    GFGHSGMGGSTGFCD+K
Sbjct  862  KIFNNPRIHDEFMGVGEYRNLVLPNGKFGLGFRRFSSSDGSFYGFGHSGMGGSTGFCDIK  921

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLES---ESSNLAQPIIN  175
            NRFAIA+TLNK+S G  T +I+Q VCSELN+P+P+E ++  E+   E  ++A+P+IN
Sbjct  922  NRFAIAVTLNKMSLGTATRRIVQFVCSELNVPLPDEFAVLSETAPDEELSIARPLIN  978



>ref|XP_011045052.1| PREDICTED: uncharacterized protein LOC105140069 isoform X2 [Populus 
euphratica]
Length=914

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 3/117 (3%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            ++F NP+IH+ F+GVGEY  L  P+G+FGLGF+R  S D    GFGHSGMGGSTGFCD+K
Sbjct  798  RIFNNPRIHDEFMGVGEYRNLVLPNGKFGLGFRRFSSSDGSFYGFGHSGMGGSTGFCDIK  857

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLES---ESSNLAQPIIN  175
            +RFAIA+TLNK+S G  T +IIQ VCSELN+P+P+E S+  E+   E  ++A+P+IN
Sbjct  858  SRFAIAVTLNKMSLGTATRRIIQFVCSELNVPLPDEFSVLSETAPDEELSIARPLIN  914



>ref|XP_011003023.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105109860 
[Populus euphratica]
Length=861

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 3/117 (3%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            ++F NP+IH+ F+GVGEY  L  P+G+FGLGF+R  S D    GFGHSGMGGSTGFCD+K
Sbjct  745  RIFNNPRIHDEFMGVGEYRNLVLPNGKFGLGFRRFSSSDGSFYGFGHSGMGGSTGFCDIK  804

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLES---ESSNLAQPIIN  175
            +RFAIA+TLNK+S G  T +IIQ VCSELN+P+P+E S+  E+   E  ++A+P+IN
Sbjct  805  SRFAIAVTLNKMSLGTATRRIIQFVCSELNVPLPDEFSVLSETAPDEELSIARPLIN  861



>ref|XP_011045051.1| PREDICTED: uncharacterized protein LOC105140069 isoform X1 [Populus 
euphratica]
Length=973

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 3/117 (3%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            ++F NP+IH+ F+GVGEY  L  P+G+FGLGF+R  S D    GFGHSGMGGSTGFCD+K
Sbjct  857  RIFNNPRIHDEFMGVGEYRNLVLPNGKFGLGFRRFSSSDGSFYGFGHSGMGGSTGFCDIK  916

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLES---ESSNLAQPIIN  175
            +RFAIA+TLNK+S G  T +IIQ VCSELN+P+P+E S+  E+   E  ++A+P+IN
Sbjct  917  SRFAIAVTLNKMSLGTATRRIIQFVCSELNVPLPDEFSVLSETAPDEELSIARPLIN  973



>ref|XP_010263230.1| PREDICTED: uncharacterized protein LOC104601555 [Nelumbo nucifera]
Length=973

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = -1

Query  519  AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDM  340
             ++F NP+IH+AF+GVG+Y     PDG+FGLGF+R   KD  L  FGHSG+GGSTGFCD+
Sbjct  856  TRIFNNPRIHDAFMGVGDYGNFALPDGKFGLGFRRFTLKDGSLTSFGHSGIGGSTGFCDV  915

Query  339  KNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS---NLAQPIIN  175
            +N+FAIA+TLNK+S G VT KII+LVCSELNIP+PEE S   E       NL +P+I+
Sbjct  916  ENKFAIAVTLNKMSLGTVTGKIIELVCSELNIPLPEEFSRFGERRPDMQLNLGKPLIS  973



>ref|XP_003550103.1| PREDICTED: uncharacterized protein LOC100775929 isoformX1 [Glycine 
max]
 ref|XP_006601037.1| PREDICTED: uncharacterized protein LOC100775929 isoform X2 [Glycine 
max]
 gb|KHN19730.1| Hypothetical protein glysoja_047190 [Glycine soja]
Length=966

 Score =   121 bits (304),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 5/119 (4%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            K++KNP+I + FLG GEYE L  P   FGLGFKR  SKD   I FGHSGMGGSTGFCD+ 
Sbjct  848  KVYKNPRIIDEFLGTGEYENLALPGESFGLGFKRFSSKDGSSIAFGHSGMGGSTGFCDVT  907

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEE-----ISMKLESESSNLAQPIIN  175
            N F++A+TLNK+SFGGVT KI+QLVCSELNIPVP++     +      E  ++ +PIIN
Sbjct  908  NNFSVAVTLNKMSFGGVTGKIVQLVCSELNIPVPDDFLRFAVEQSGPDEQLSMGRPIIN  966



>ref|XP_004136301.1| PREDICTED: uncharacterized protein LOC101216220 [Cucumis sativus]
Length=965

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = -1

Query  549  DDDTPTDSHN--AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh  376
            D   P D +    K++K+P+IH+AFLG+ EYE  T P+G+FGLGF R+ S+D   IGFGH
Sbjct  837  DTRHPNDGNKFVGKIYKDPRIHDAFLGIREYENYTIPNGKFGLGFSRLRSEDGSFIGFGH  896

Query  375  sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMK--LESES  202
            SGMGGSTGFC++ +RFAI++TLNKLS GGVTA IIQLVCSELNIP+P E S     + + 
Sbjct  897  SGMGGSTGFCNIDHRFAISVTLNKLSLGGVTASIIQLVCSELNIPLPVEFSSPGISDGQH  956

Query  201  SNLAQPIIN  175
            S +  P+IN
Sbjct  957  SIVETPLIN  965



>ref|XP_003588582.1| aarF domain-containing protein kinase, putative [Medicago truncatula]
Length=872

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 115/236 (49%), Positives = 147/236 (62%), Gaps = 23/236 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A ++P +FN L  RRAIIPAANGH SARALARYYAAL DGGKIP   SS+    LGSH H
Sbjct  657  ATSVPPIFNTLNVRRAIIPAANGHVSARALARYYAALADGGKIPSPHSSTSKPLLGSHTH  716

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
            +PK  S K P+K  +  W+ + + +         +S ++S +      N D  P      
Sbjct  717  IPKLSSQKDPQKAEM-YWKDSHNFTYSEGTEGRNTSTSSSSSGDTGSSNLDSNPRPHVPG  775

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            K+++NP+I + FLG                   R  SKD   I FGHSGMGGSTGFCD+ 
Sbjct  776  KVYQNPRIVDEFLG-------------------RFSSKDGSTIAFGHSGMGGSTGFCDVT  816

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESES--SNLAQPIIN  175
            NRF+IA+TLNK+SFGGVT KI+QLVCSELNIPVP++      ++S  +NLA+P+IN
Sbjct  817  NRFSIAVTLNKMSFGGVTGKIVQLVCSELNIPVPDDFLRYAANQSGDANLARPMIN  872



>gb|KGN60194.1| hypothetical protein Csa_3G888530 [Cucumis sativus]
Length=966

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = -1

Query  549  DDDTPTDSHN--AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh  376
            D   P D +    K++K+P+IH+AFLG+ EYE  T P+G+FGLGF R+ S+D   IGFGH
Sbjct  838  DTRHPNDGNKFVGKIYKDPRIHDAFLGIREYENYTIPNGKFGLGFSRLRSEDGSFIGFGH  897

Query  375  sgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMK--LESES  202
            SGMGGSTGFC++ +RFAI++TLNKLS GGVTA IIQLVCSELNIP+P E S     + + 
Sbjct  898  SGMGGSTGFCNIDHRFAISVTLNKLSLGGVTASIIQLVCSELNIPLPVEFSSPGISDGQH  957

Query  201  SNLAQPIIN  175
            S +  P+IN
Sbjct  958  SIVETPLIN  966



>gb|EPS60965.1| hypothetical protein M569_13837 [Genlisea aurea]
Length=212

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 123/212 (58%), Gaps = 47/212 (22%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  LP  FN+L  RRAI PAANGH SARALARYYAALVD G IPP  SS + PPLGSH+H
Sbjct  35   ADRLPRTFNSLLIRRAISPAANGHSSARALARYYAALVDRGAIPPPHSSYTQPPLGSHKH  94

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
                                                    G+ +       D        
Sbjct  95   ----------------------------------------GDAHTQTTGSSD------GG  108

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            KLF N  IH+AF G GEYE L  P G FGLGFKR  SK+  +IGFGHSG+GGSTG C ++
Sbjct  109  KLFTNGMIHDAFTGTGEYENLAVPGGIFGLGFKRAVSKNGDVIGFGHSGIGGSTGMCSIE  168

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIP  241
            +RFAIA+TLNK++FG V AK+I LVCSELNIP
Sbjct  169  HRFAIAVTLNKMNFGTVAAKVIHLVCSELNIP  200



>ref|XP_003544660.1| PREDICTED: uncharacterized protein LOC100802638 isoform X1 [Glycine 
max]
 ref|XP_006596168.1| PREDICTED: uncharacterized protein LOC100802638 isoform X2 [Glycine 
max]
 gb|KHN45585.1| Hypothetical protein glysoja_047536 [Glycine soja]
Length=965

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = -1

Query  528  SHNA-KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstG  352
            SH A K++KNP+I + FLG GEY  L  P   FGLGFKR  SKD   I FGHSGMGGSTG
Sbjct  842  SHVAGKVYKNPRIIDEFLGTGEYTNLALPGEGFGLGFKRFTSKDGSSIAFGHSGMGGSTG  901

Query  351  FCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEE-----ISMKLESESSNLAQ  187
            FCD+ N F+IA+TLNK+SFGGVT KI+QLVCSELNIPVP++     +      E  ++ +
Sbjct  902  FCDVTNNFSIAVTLNKMSFGGVTGKIVQLVCSELNIPVPDDFLRFAVEQSGPDEQLSMGR  961

Query  186  PIIN  175
            PIIN
Sbjct  962  PIIN  965



>gb|EPS66438.1| hypothetical protein M569_08337 [Genlisea aurea]
Length=944

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 150/236 (64%), Gaps = 17/236 (7%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A T+P  FN L +RRAI+P+ANGHCSARALARYYAALVD G +PP  SSS  P LGSH H
Sbjct  723  AATVPRTFNTLFSRRAILPSANGHCSARALARYYAALVDRGVVPPRHSSSSQPPLGSHPH  782

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
            VP FP  K P  +   +W KA +             R  + ++           +     
Sbjct  783  VPSFPKEKLPPAR---KWNKAVAYYA----------RVPAADDLATAGGGTAGSSPPSGG  829

Query  516  KLFKN-PKIHEAFLGVGEYEKLTYPDGQFGLGFKR-IHSKDsgligfghsgmggstGFCD  343
            K+F +  K+H+AF G GEY  L    GQFGLGFKR   S D  L+GFGHSG+GGSTGFCD
Sbjct  830  KIFLDGDKVHDAFNGTGEYAHLVADGGQFGLGFKRNTSSVDGSLMGFGHSGLGGSTGFCD  889

Query  342  MKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNLAQPIIN  175
            ++ RFA+A+TLNK++ GGVT K+++LVCSEL+IP+P + + +  +  S  A P+IN
Sbjct  890  VRGRFAVAVTLNKMNTGGVTGKVMELVCSELDIPLPSDYA-RFAAAGSGAAGPLIN  944



>ref|XP_006371818.1| hypothetical protein POPTR_0018s03930g [Populus trichocarpa]
 gb|ERP49615.1| hypothetical protein POPTR_0018s03930g [Populus trichocarpa]
Length=957

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            ++F NP+IH+ F+G GEY  L  P+G+FGLGF+R  S D    GFGHSG+GGSTGFCD K
Sbjct  857  RIFNNPRIHDEFMGAGEYRNLVLPNGKFGLGFRRFRSSDGSFYGFGHSGIGGSTGFCDNK  916

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM  220
            NRFAIA+TLNK+S G  T +IIQ VCSELN+P+P+E S+
Sbjct  917  NRFAIAVTLNKMSLGTATRRIIQFVCSELNVPLPDEFSV  955



>ref|XP_006382184.1| ABC1 family protein [Populus trichocarpa]
 gb|ERP59981.1| ABC1 family protein [Populus trichocarpa]
Length=972

 Score =   112 bits (281),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -1

Query  513  LFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMKN  334
            +F +P+IH+ F+G GEY  L  P+G+FGLGFKR  S D    GFGHSG+GGSTGFCD++N
Sbjct  857  IFNDPRIHDQFMGTGEYSDLVLPNGKFGLGFKRFSSSDGSFSGFGHSGLGGSTGFCDIEN  916

Query  333  RFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM  220
            RFAIA+TLNK+SFG  T KIIQ VCSELN+P+P+E S+
Sbjct  917  RFAIAVTLNKISFGTATRKIIQFVCSELNVPLPDEFSI  954



>ref|XP_004966108.1| PREDICTED: uncharacterized protein LOC101759876 [Setaria italica]
Length=942

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 146/235 (62%), Gaps = 10/235 (4%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRH  697
            A  +P++FN L  RRAIIPAANGHCSARALARYYAAL  GG IPP  S+   P LGSH H
Sbjct  709  ASGVPVLFNTLNVRRAIIPAANGHCSARALARYYAALATGGSIPPPHSADSKPPLGSHVH  768

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
             PKFP+       L  +        G + +  D S+ + +G   +   + +D        
Sbjct  769  TPKFPTAP-----LKKKKGAGKKGVGSTGNLQDVSNTDKNGYSQLRTSDANDEAAAGSGG  823

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsglig-fghsgmggstGFCDM  340
            ++F + KI +AF+GVGEY+ + +P+G+FGLGF+R ++   G +  FGHSGMGGSTGFCD+
Sbjct  824  RIFSSDKILDAFMGVGEYQSMVHPNGKFGLGFRRYNNPSGGTLRCFGHSGMGGSTGFCDV  883

Query  339  KNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS---NLAQP  184
            +N FA+A+ +NK+S G VT  I++ +  EL +PVP+E S   E       NLA P
Sbjct  884  ENNFAMAVMVNKMSLGSVTRGIVRFILEELGLPVPDEFSTSGEKGPDMVLNLAPP  938



>ref|XP_001767436.1| predicted protein [Physcomitrella patens]
 gb|EDQ67760.1| predicted protein [Physcomitrella patens]
Length=962

 Score =   109 bits (272),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 122/216 (56%), Gaps = 26/216 (12%)
 Frame = -1

Query  864  LPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHVpkf  685
            LP++FN L  RRAI+PAANGH SARALARYYA L  GG +PP S SS PPL  H H    
Sbjct  745  LPVLFNTLFVRRAIVPAANGHFSARALARYYATLCTGGIVPPASLSSEPPLSRHPH----  800

Query  684  pspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPT---DSHNAK  514
                         + K     G+  +      RN        VV D + P     S +A+
Sbjct  801  -----------KPFEKKSVAKGNKKNGTKKPDRNTRH-----VVTDIEAPQVVEPSPSAR  844

Query  513  LFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh---sgmggstGFCD  343
            +F N  IH+AFL  GEY KL Y D +FGLGF+RI S D           SG+GGSTGFC 
Sbjct  845  IFLNTSIHDAFLAAGEYSKLAYTDEKFGLGFRRITSGDGSSTEVIGFGHSGVGGSTGFCY  904

Query  342  MKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
              + FAIAITLNKLS GGVTA+I +LV  EL +P P
Sbjct  905  PAHNFAIAITLNKLSQGGVTAQIARLVTQELGLPCP  940



>ref|XP_009586952.1| PREDICTED: uncharacterized protein LOC104084719 isoform X3 [Nicotiana 
tomentosiformis]
Length=330

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 116/173 (67%), Gaps = 23/173 (13%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHV  694
            A TLP +FN+L  RRAIIPAANGHCSARALARYYAAL +GG++PP   SSMP LGSH H+
Sbjct  29   ATTLPAIFNSLYARRAIIPAANGHCSARALARYYAALAEGGRVPPPHYSSMPTLGSHPHI  88

Query  693  pkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNAS------------GNEYVLVVN  550
            PKFPS +T       + +K+  ++  S     G ++N+S            GN YV + +
Sbjct  89   PKFPSQQT------VKKQKSRKKTAASDADGPGPTQNSSSSVDNGYGNDGKGNVYVRIPD  142

Query  549  DD-----DTPTDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHS  406
            D+     DT +D+ N KLF N ++H+AF+GVGEYE LT P+G+FGLGFKR +S
Sbjct  143  DNSCSGGDTSSDNRNIKLFHNQRVHDAFMGVGEYENLTDPNGEFGLGFKRSYS  195



>ref|NP_001168428.1| uncharacterized protein LOC100382198 [Zea mays]
 gb|ACN28190.1| unknown [Zea mays]
Length=640

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 142/226 (63%), Gaps = 9/226 (4%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  +P +FN L  RRAIIPAANGHCSARALARYYAAL  GG +PP  SS +MPPLGSH H
Sbjct  390  ASGVPAIFNTLNVRRAIIPAANGHCSARALARYYAALAAGGSVPPPHSSGAMPPLGSHVH  449

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
             PKFP+    KKK  A  +K               S  +S       +   D  +++ + 
Sbjct  450  TPKFPTAPLKKKKKGAGKKKGAGGGSMGDLKVQDISGGSSDRNGYCQLRTSDADSEAGSG  509

Query  516  -----KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRI---HSKDsgligfghsgmgg  361
                 ++F + +I +AF+GVGEYE + + DG+FGLGF+R     S    L  FGHSGMGG
Sbjct  510  SGGGGRMFGSDRILDAFMGVGEYEGMAHRDGKFGLGFRRYDDASSGSGRLRCFGHSGMGG  569

Query  360  stGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            STGFCD++N FAIA+T+NKLS G VT  +++LV  EL +PVP+E S
Sbjct  570  STGFCDVENGFAIAVTVNKLSLGSVTRGVVRLVLEELGLPVPDEYS  615



>gb|AGT16406.1| hypothetical protein SHCRBa_024_H17_F_120 [Saccharum hybrid cultivar 
R570]
Length=949

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 142/226 (63%), Gaps = 14/226 (6%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  LP +FN L  RRAIIPAANGHCSARALARYYAAL  GG +PPL SS S PPLGSH H
Sbjct  709  ASGLPALFNTLNVRRAIIPAANGHCSARALARYYAALATGGSVPPLHSSGSKPPLGSHVH  768

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYV-LVVNDDDTP-----  535
             PKFP+       L  +      + G  S  +     +   N Y  L  +D D+      
Sbjct  769  TPKFPTAP-----LKKKKGTGKKKCGRGSTGNLQDVSSTDKNGYSQLCTSDADSEAAVVL  823

Query  534  -TDSHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIH-SKDsgligfghsgmgg  361
             +   ++++F + KI +AF+GV EYE + + DG+FGLGF+R + +    L  FGHSGMGG
Sbjct  824  GSGGGSSRMFSSDKILDAFMGVSEYEGMVHQDGKFGLGFRRYYDASSGKLRCFGHSGMGG  883

Query  360  stGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            STGFCD++N FAIA+ +NKLS G VT  +I+LV  EL +PV +E S
Sbjct  884  STGFCDVENNFAIAVMVNKLSLGSVTRGVIRLVLEELGLPVQDEYS  929



>ref|XP_008648079.1| PREDICTED: uncharacterized protein LOC100382198 isoform X1 [Zea 
mays]
 gb|AFW75860.1| hypothetical protein ZEAMMB73_026023 [Zea mays]
Length=959

 Score =   103 bits (258),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 142/226 (63%), Gaps = 9/226 (4%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  +P +FN L  RRAIIPAANGHCSARALARYYAAL  GG +PP  SS +MPPLGSH H
Sbjct  709  ASGVPAIFNTLNVRRAIIPAANGHCSARALARYYAALAAGGSVPPPHSSGAMPPLGSHVH  768

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
             PKFP+    KKK  A  +K               S  +S       +   D  +++ + 
Sbjct  769  TPKFPTAPLKKKKKGAGKKKGAGGGSMGDLKVQDISGGSSDRNGYCQLRTSDADSEAGSG  828

Query  516  -----KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRI---HSKDsgligfghsgmgg  361
                 ++F + +I +AF+GVGEYE + + DG+FGLGF+R     S    L  FGHSGMGG
Sbjct  829  SGGGGRMFGSDRILDAFMGVGEYEGMAHRDGKFGLGFRRYDDASSGSGRLRCFGHSGMGG  888

Query  360  stGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEIS  223
            STGFCD++N FAIA+T+NKLS G VT  +++LV  EL +PVP+E S
Sbjct  889  STGFCDVENGFAIAVTVNKLSLGSVTRGVVRLVLEELGLPVPDEYS  934



>dbj|BAJ86975.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=938

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 143/241 (59%), Gaps = 24/241 (10%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmp-pLGSHRH  697
            A  +P MFN L  RRAIIPAANGH SARALARYYAAL  GG IPP  SS+    LGSH H
Sbjct  709  AAGVPAMFNTLNVRRAIIPAANGHLSARALARYYAALAAGGAIPPPHSSNAKPLLGSHVH  768

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYV-LVVNDDDTPTDSHN  520
             P+FP+              A S+      S  GS  +    EYV L  +D D+   +  
Sbjct  769  TPEFPTA-------------ATSKKKKKGSSKKGSGSSLEKGEYVQLRTSDADSEASAAT  815

Query  519  A----KLFKNPK--IHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggs  358
                 ++F N    I +AF+GVGEY  + +P+G+FGLGF+R         GFGHSGMGGS
Sbjct  816  GGAGGRMFSNSDRGIMDAFMGVGEYSGMIHPNGKFGLGFRRYGKSGCAPTGFGHSGMGGS  875

Query  357  tGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS---NLAQ  187
             GFCD ++ FAIA+T+NK++ G VT ++++LVC EL +PVP+E S+  E       NLA 
Sbjct  876  NGFCDPEHGFAIAVTVNKMALGSVTRRVVRLVCEELGVPVPDEFSVAGEKGPDMVLNLAP  935

Query  186  P  184
            P
Sbjct  936  P  936



>ref|XP_001766095.1| predicted protein [Physcomitrella patens]
 gb|EDQ69154.1| predicted protein [Physcomitrella patens]
Length=936

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 118/217 (54%), Gaps = 26/217 (12%)
 Frame = -1

Query  864  LPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHVpkf  685
            LP++FN L  RRAIIPAANGH SARALARYYA L   G +P  SSSS P LGSH      
Sbjct  720  LPVLFNTLFVRRAIIPAANGHFSARALARYYATLATAGAVPSASSSSEPRLGSHP-----  774

Query  684  pspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNAK---  514
                          +K   +  D              +       D + P  +   K   
Sbjct  775  --------------QKPLEKKLDPLGKGSKKDGMKHQDRISKAAADIEAPKIADTLKSSN  820

Query  513  LFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh----sgmggstGFC  346
            ++ NPKIH+AFL  GEY KL Y D +FGLGF+RI S  S L         SG+GGSTGFC
Sbjct  821  IYSNPKIHDAFLAAGEYSKLAYTDEKFGLGFRRITSGGSNLAEEVIGFGHSGVGGSTGFC  880

Query  345  DMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
               + F++AITLNKLS G VTA+I +LV SEL +P P
Sbjct  881  YPGHNFSLAITLNKLSQGEVTAQIARLVTSELGLPCP  917



>gb|EEC81263.1| hypothetical protein OsI_24357 [Oryza sativa Indica Group]
Length=926

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 140/227 (62%), Gaps = 12/227 (5%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpp--lssssmppLGSHR  700
            A  LP++FN L  RRAI+PAANGHCSARALARYYAAL  GG IPP   S  S PPLGSH 
Sbjct  687  ATGLPVLFNTLNIRRAILPAANGHCSARALARYYAALGAGGAIPPPHSSGGSEPPLGSHV  746

Query  699  HVpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHN  520
            H PKFP+  + KKK             D       S  +  G+   +VV           
Sbjct  747  HTPKFPTMPSKKKKKGGSKNDVGVADKDGYTQLRTSDGSDEGSTVSVVVA---GNGSGSG  803

Query  519  AKLFKN--PKIHEAFLGVGEYEKLTYPDGQFGLGFKRI-----HSKDsgligfghsgmgg  361
            + +F +   K+ +AF+GVG++  + +P+G+FGLGF+R        +      FGHSGMGG
Sbjct  804  SSMFVDGGAKMLDAFMGVGDFSGMIHPNGKFGLGFRRYGYGAGAGEKVATTTFGHSGMGG  863

Query  360  stGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM  220
            STGFCD+++  A+A+T+NK+S GGVT ++++LVC EL +PVP+E S+
Sbjct  864  STGFCDVEHGLAMAVTVNKMSLGGVTRRVVRLVCEELGVPVPDEFSV  910



>ref|XP_002450940.1| hypothetical protein SORBIDRAFT_05g021423 [Sorghum bicolor]
 gb|EES09928.1| hypothetical protein SORBIDRAFT_05g021423, partial [Sorghum bicolor]
Length=202

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = -1

Query  528  SHNAKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIH-SKDsgligfghsgmggstG  352
            S  +++F + KI +AF+GVGEYE +   DG+FGLGF+R + +    L  FGHSGMGGSTG
Sbjct  80   SGGSRMFSSDKILDAFMGVGEYEGMVQQDGKFGLGFRRYYDASSGKLRCFGHSGMGGSTG  139

Query  351  FCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLE  211
            FCD++N FAIA+ +NKL+ G VT  +I+LV  EL +PVP+E S   E
Sbjct  140  FCDVENNFAIAVMVNKLALGSVTRGVIRLVLEELGLPVPDEYSATGE  186



>ref|XP_002965001.1| hypothetical protein SELMODRAFT_266894 [Selaginella moellendorffii]
 gb|EFJ33839.1| hypothetical protein SELMODRAFT_266894 [Selaginella moellendorffii]
Length=891

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 123/212 (58%), Gaps = 17/212 (8%)
 Frame = -1

Query  852  FNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHVpkfpspk  673
            FN L  RRA IPAANGH SARALAR+YA L  GG++PP +SSS PPLGSH H P      
Sbjct  683  FNMLFIRRATIPAANGHFSARALARFYATLASGGRVPPGTSSSKPPLGSHAHRPHLGGSS  742

Query  672  tpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNAKLFKNPKI  493
            +      A+ +K    +G +       S + SG + +    ++D P     AK+F +  I
Sbjct  743  ST-----AKRKKGSRITGKNCCKTRSLSSDLSGGQ-IHFQEEEDAP-----AKIFTSGDI  791

Query  492  HEAFLGVGEYEKLTYPDGQ-FGLGFKRIHSKDsgligfghsg-----mggstGFCDMKNR  331
            H+AF+G G+Y  L   D + FGLGF ++ + D+              +GGS G+CD  N 
Sbjct  792  HDAFVGGGKYSGLVARDSEKFGLGFWKLKTGDTSAGAGKKMAFGHSGIGGSFGYCDPDND  851

Query  330  FAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
            FA+AIT+NK++ G V+  I++LVCSE+ IP P
Sbjct  852  FAVAITVNKMTLGQVSGDIVRLVCSEIGIPCP  883



>ref|XP_006371822.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
 gb|ERP49619.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
Length=951

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -1

Query  516  KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDMK  337
            K+F NP+IH+ F+GVGEY  L  P+G+FGLGF+R  S D    GFGHSGMGGSTGFCD+K
Sbjct  862  KIFNNPRIHDEFMGVGEYRNLVLPNGKFGLGFRRFSSSDGSFYGFGHSGMGGSTGFCDIK  921

Query  336  NRFAIAITLNKLSFGGVTAKIIQLVCSELN  247
            NRFAIA+TLNK+S G  T +I+ +    +N
Sbjct  922  NRFAIAVTLNKMSLGTATRRILSIARPLIN  951



>ref|XP_010227427.1| PREDICTED: uncharacterized protein LOC100845772 isoform X3 [Brachypodium 
distachyon]
Length=782

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = -1

Query  519  AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDM  340
            + +F N  I +AF+G+G+Y  + YP+G+FGLGF+R     S  +GFGHSGMGGSTGFCD 
Sbjct  661  STMFANSDILDAFMGIGDYSGMIYPNGKFGLGFRRYGRSGSAPMGFGHSGMGGSTGFCDP  720

Query  339  KNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS---NLAQP  184
            ++ FAIA+T+N++S G  T ++++ VC EL +PVP+E S+  E       NLA P
Sbjct  721  EHGFAIAVTVNRMSLGSSTRRVVRFVCEELGVPVPDEFSVSGEKGPDMVLNLAPP  775



>ref|XP_010227425.1| PREDICTED: uncharacterized protein LOC100845772 isoform X2 [Brachypodium 
distachyon]
Length=917

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = -1

Query  519  AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDM  340
            + +F N  I +AF+G+G+Y  + YP+G+FGLGF+R     S  +GFGHSGMGGSTGFCD 
Sbjct  796  STMFANSDILDAFMGIGDYSGMIYPNGKFGLGFRRYGRSGSAPMGFGHSGMGGSTGFCDP  855

Query  339  KNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS---NLAQP  184
            ++ FAIA+T+N++S G  T ++++ VC EL +PVP+E S+  E       NLA P
Sbjct  856  EHGFAIAVTVNRMSLGSSTRRVVRFVCEELGVPVPDEFSVSGEKGPDMVLNLAPP  910



>ref|XP_003563512.1| PREDICTED: uncharacterized protein LOC100845772 isoform X1 [Brachypodium 
distachyon]
Length=940

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = -1

Query  519  AKLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfghsgmggstGFCDM  340
            + +F N  I +AF+G+G+Y  + YP+G+FGLGF+R     S  +GFGHSGMGGSTGFCD 
Sbjct  819  STMFANSDILDAFMGIGDYSGMIYPNGKFGLGFRRYGRSGSAPMGFGHSGMGGSTGFCDP  878

Query  339  KNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS---NLAQP  184
            ++ FAIA+T+N++S G  T ++++ VC EL +PVP+E S+  E       NLA P
Sbjct  879  EHGFAIAVTVNRMSLGSSTRRVVRFVCEELGVPVPDEFSVSGEKGPDMVLNLAPP  933



>ref|XP_002977076.1| hypothetical protein SELMODRAFT_106221 [Selaginella moellendorffii]
 gb|EFJ21685.1| hypothetical protein SELMODRAFT_106221 [Selaginella moellendorffii]
Length=965

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 120/213 (56%), Gaps = 18/213 (8%)
 Frame = -1

Query  852  FNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHVpkfpspk  673
            FN L  RRA IPAANGH SARALAR+YA L  GG++PP +SSS PPLGSH H P      
Sbjct  756  FNMLFIRRATIPAANGHFSARALARFYATLASGGRVPPGTSSSKPPLGSHAHRPPLGGSS  815

Query  672  tpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNAKLFKNPKI  493
            +      A+ +K    +G +       S + SG + +    + D P     AK+F +  I
Sbjct  816  ST-----AKRKKGSRITGKNCCKTRSLSSDLSGGQ-IHFQEEQDAP-----AKIFTSGDI  864

Query  492  HEAFLGVGEYEKLTYPDGQ-FGLGFKRIHSKDsgligfghsgm------ggstGFCDMKN  334
            H+AF+G G+Y  L   D + FGLGF ++ + D+                GGS G+CD  N
Sbjct  865  HDAFVGGGKYSGLVTRDSEKFGLGFWKLKTGDTSAGAGKKKMAFGHSGIGGSFGYCDPDN  924

Query  333  RFAIAITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             FA+ IT+NK++ G V+  I++LVCSE+ IP P
Sbjct  925  DFAMVITVNKMTLGQVSGDIVRLVCSEIGIPCP  957



>gb|EMT12091.1| hypothetical protein F775_11903 [Aegilops tauschii]
Length=451

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 138/242 (57%), Gaps = 18/242 (7%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIppl-ssssmppLGSHRH  697
            A  +P MFN L  RRAIIPAANGH SARALARYYAAL  GG +PP  SS++ P LGSH H
Sbjct  214  AAGVPAMFNTLNVRRAIIPAANGHLSARALARYYAALAAGGALPPPHSSNAKPLLGSHVH  273

Query  696  VpkfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA  517
             P FP+  T KKK     +K+   S      +    R +  +  V V     T       
Sbjct  274  TPAFPTAATSKKKKKGSAKKSSGSSSSMEKVEYAQLRTSDADSEVSVAASGST-----GG  328

Query  516  KLFKNPKIH---EAFLGVGEYEKLTYPDG-----QFGLGFKRIHSKDsgligfghsgmgg  361
            +LF N + H   +AF+GVG Y  L  P+G     +  LG  R     +   GFGHSGMGG
Sbjct  329  RLFSN-RGHGSTDAFMGVGAYSGLIQPNGKQPTGELSLGVWRCGRPGAPPTGFGHSGMGG  387

Query  360  stGFCDMKNRFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESS---NLA  190
            S GFCD ++ FAIA+T+NK++ G VT ++++ VC EL +PVP+E S+  E       NLA
Sbjct  388  SNGFCDPEHGFAIAVTVNKMALGSVTRRVVRFVCEELGVPVPDEFSVSGEKGPDMVLNLA  447

Query  189  QP  184
             P
Sbjct  448  PP  449



>ref|XP_002977079.1| hypothetical protein SELMODRAFT_443434 [Selaginella moellendorffii]
 gb|EFJ21688.1| hypothetical protein SELMODRAFT_443434 [Selaginella moellendorffii]
Length=866

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 107/209 (51%), Gaps = 33/209 (16%)
 Frame = -1

Query  852  FNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHVpkfpspk  673
            FN L  RRA IP+ANGH SARALAR+YA L  GG++PP +SSS PPLGSH H        
Sbjct  680  FNMLFIRRATIPSANGHFSARALARFYAMLASGGRVPPGTSSSKPPLGSHAH--------  731

Query  672  tpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNAKLFKNPKI  493
                                      S  +      +    ++D P     AK+F +  I
Sbjct  732  -----------------RPHLGGSSRSLSSDLSGGQIHFQEEEDAP-----AKIFTSGDI  769

Query  492  HEAFLGVGEYEKLTYPDGQ-FGLGFKRIHSKDsgligfghsgmggstGF--CDMKNRFAI  322
            H+AF+G G Y  L   DG+ FGLGF +  + D+G         G    F  CD  N FA+
Sbjct  770  HDAFVGGGRYSGLVARDGEKFGLGFWKHKTADTGRKKMAFGHSGIGGSFGYCDPDNDFAM  829

Query  321  AITLNKLSFGGVTAKIIQLVCSELNIPVP  235
             IT+NK++FG V+  I++LVCSE+ IP P
Sbjct  830  VITVNKMTFGQVSGDIVRLVCSEIGIPCP  858



>ref|XP_002965004.1| hypothetical protein SELMODRAFT_439199 [Selaginella moellendorffii]
 gb|EFJ33842.1| hypothetical protein SELMODRAFT_439199 [Selaginella moellendorffii]
Length=1273

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 115/223 (52%), Gaps = 35/223 (16%)
 Frame = -1

Query  852   FNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmppLGSHRHVpkfpspk  673
             FN L  RRA IP+ANGH SARALAR+YA L  GG++PP +SSS PPLGSH H        
Sbjct  873   FNMLFIRRATIPSANGHFSARALARFYAMLASGGRVPPGTSSSKPPLGSHAH--------  924

Query  672   tpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNAKLFKNPKI  493
                                       S  +      +    ++D P     AK+F +  I
Sbjct  925   -----------------RPHLGGSSRSLSSDLSGGQIHFQEEEDAP-----AKIFTSGDI  962

Query  492   HEAFLGVGEYEKLTYPDGQ-FGLGFKRIHSKDsgligfghsgmggstGF--CDMKNRFAI  322
             H+AF+G G Y  L   DG+ FGLGF +  + D+G         G    F  CD  N FA+
Sbjct  963   HDAFVGGGRYSGLVARDGEKFGLGFWKHKTADTGRKKMAFGHSGIGGSFGYCDPDNDFAM  1022

Query  321   AITLNKLSFGGVTAKIIQLVCSELNIPVPEEISMKLESESSNL  193
              IT+ K++FG V+  I++LVCSE+ IP P  ++M+  S+ ++L
Sbjct  1023  VITVTKMTFGQVSGDIVRLVCSEIGIPCP--LAMERPSQLAHL  1063



>ref|XP_006656445.1| PREDICTED: uncharacterized protein LOC102706948 [Oryza brachyantha]
Length=949

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = -1

Query  498  KIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKDsgligfgh---sgmggstGFCDMKNRF  328
            K+ +AF+GVG++  + +P+G+FGLGF+R                SGMGGSTGFCD+++  
Sbjct  838  KMLDAFMGVGDFSGMIHPNGKFGLGFRRYGDGGKAKATSSTFGHSGMGGSTGFCDVEHGL  897

Query  327  AIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM  220
            A+A+T+NK+S GGVT ++++LVC EL +PVP+E S+
Sbjct  898  AMAVTVNKMSLGGVTRRVVRLVCEELGVPVPDEFSV  933



>ref|XP_006371809.1| hypothetical protein POPTR_0018s03850g [Populus trichocarpa]
 gb|ERP49606.1| hypothetical protein POPTR_0018s03850g [Populus trichocarpa]
Length=292

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 97/167 (58%), Gaps = 23/167 (14%)
 Frame = -1

Query  867  TLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKIpplssssmpp-LGSHRHVp  691
             +P +FN L  RRAIIP ANGHCSARALARYYAALVDGG +PP  SS   P LG+H H+ 
Sbjct  98   AVPALFNMLNVRRAIIPGANGHCSARALARYYAALVDGGLVPPPHSSLSKPPLGTHPHIL  157

Query  690  kfpspktpkkKLLARWRKAdsesgdssdsddgsSRNASGNEYVLVVNDDDTPTDSHNA--  517
            KFPS  T KK+   + + ADS S               GN Y L +N      D   A  
Sbjct  158  KFPSEITSKKQKGKKSKAADSAS------------KKKGNGYELKMNHSKDFKDGFAASE  205

Query  516  --------KLFKNPKIHEAFLGVGEYEKLTYPDGQFGLGFKRIHSKD  400
                    ++F NP+IH+ F+GVGEY  L  P+G+FGLGF+R  S D
Sbjct  206  NSRKNNAIRIFNNPRIHDEFMGVGEYRNLALPNGKFGLGFRRFSSSD  252



>gb|EEE66303.1| hypothetical protein OsJ_22534 [Oryza sativa Japonica Group]
Length=926

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 73/98 (74%), Gaps = 5/98 (5%)
 Frame = -1

Query  498  KIHEAFLGVGEYEKLTYPDGQFGLGFKRI-----HSKDsgligfghsgmggstGFCDMKN  334
            K+ +AF+GVG++  + +P+G+FGLGF+R        +      FGHSGMGGSTGFCD+++
Sbjct  813  KMLDAFMGVGDFSGMIHPNGKFGLGFRRYGYGAGAGEKVATTTFGHSGMGGSTGFCDVEH  872

Query  333  RFAIAITLNKLSFGGVTAKIIQLVCSELNIPVPEEISM  220
              A+A+T+NK+S GGVT ++++LVC EL +PVP+E S+
Sbjct  873  GLAMAVTVNKMSLGGVTRRVVRLVCEELGVPVPDEFSV  910



>gb|ACG36527.1| hypothetical protein [Zea mays]
Length=103

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = -1

Query  438  QFGLGFKRI---HSKDsgligfghsgmggstGFCDMKNRFAIAITLNKLSFGGVTAKIIQ  268
            ++GLGF+R     S    L  FGHSGMGGSTGFCD++N FAIA+T+NKLS G VT  +++
Sbjct  4    EYGLGFRRYDDASSXSGRLRCFGHSGMGGSTGFCDVENGFAIAVTVNKLSLGSVTRGVVR  63

Query  267  LVCSELNIPVPEEISMKLE  211
            LV  EL +PVP+E S   E
Sbjct  64   LVLEELGLPVPDEYSATGE  82



>gb|AAK82520.1| AT5g24810/F6A4_20 [Arabidopsis thaliana]
Length=690

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 89/164 (54%), Gaps = 25/164 (15%)
 Frame = -1

Query  873  AXTLPIMFNALTTRRAIIPAANGHCSaralaryyaaLVDGGKI-pplssssmppLGSHRH  697
            A  LP++FN L  RRAIIPAANGHCSARALARYYA L DGG + PP SS S PPLGSH H
Sbjct  527  ATNLPVLFNTLNVRRAIIPAANGHCSARALARYYATLADGGLVPPPHSSLSQPPLGSHTH  586

Query  696  VpkfpspktpkkKLL-----------ARWRKAdsesgdssdsddgsSRNASGNEYVLVV-  553
            VPKF S K   KK             ++  +      +       SSR ++      +V 
Sbjct  587  VPKFTSLKDTTKKKKGKEMAATEKGKSKDHQERKLYDEKQFMSASSSRESNTESLARLVD  646

Query  552  ----------NDDDTPTDSHNAKLFKNPKIHEAFLGVGEYEKLT  451
                      N DD   D HN  +F NP+IH+AF+G G+Y  L+
Sbjct  647  TNSSAGKTEINSDDHQHDIHN--MFSNPRIHDAFMGAGDYSTLS  688



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1977341620752