BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1300

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344171.1|  PREDICTED: probable inactive leucine-rich re...    206   2e-57   Solanum tuberosum [potatoes]
ref|XP_007044230.1|  Leucine-rich repeat protein kinase family pr...    205   3e-57   
ref|XP_009801886.1|  PREDICTED: probable inactive leucine-rich re...    203   1e-56   Nicotiana sylvestris
ref|XP_010066684.1|  PREDICTED: probable inactive leucine-rich re...    201   7e-56   Eucalyptus grandis [rose gum]
ref|XP_009630462.1|  PREDICTED: probable inactive leucine-rich re...    201   9e-56   Nicotiana tomentosiformis
gb|KJB31483.1|  hypothetical protein B456_005G193500                    200   2e-55   Gossypium raimondii
ref|XP_004238893.1|  PREDICTED: probable inactive leucine-rich re...    198   1e-54   Solanum lycopersicum
gb|KDO76897.1|  hypothetical protein CISIN_1g005102mg                   196   6e-54   Citrus sinensis [apfelsine]
ref|XP_006468755.1|  PREDICTED: probable inactive leucine-rich re...    196   6e-54   Citrus sinensis [apfelsine]
ref|XP_006448399.1|  hypothetical protein CICLE_v10014433mg             196   6e-54   Citrus clementina [clementine]
emb|CDP00668.1|  unnamed protein product                                195   9e-54   Coffea canephora [robusta coffee]
gb|KHN03071.1|  Putative inactive leucine-rich repeat receptor-li...    192   1e-53   Glycine soja [wild soybean]
ref|XP_004497046.1|  PREDICTED: probable inactive leucine-rich re...    194   2e-53   Cicer arietinum [garbanzo]
gb|KEH44189.1|  LRR receptor-like kinase                                192   9e-53   Medicago truncatula
emb|CAN73490.1|  hypothetical protein VITISV_040575                     192   1e-52   Vitis vinifera
ref|XP_002282768.1|  PREDICTED: probable inactive leucine-rich re...    192   1e-52   Vitis vinifera
ref|XP_011076286.1|  PREDICTED: probable inactive leucine-rich re...    192   2e-52   Sesamum indicum [beniseed]
ref|XP_003555049.1|  PREDICTED: probable inactive leucine-rich re...    192   2e-52   Glycine max [soybeans]
ref|XP_004299037.1|  PREDICTED: probable inactive leucine-rich re...    191   3e-52   Fragaria vesca subsp. vesca
ref|XP_008243284.1|  PREDICTED: probable inactive leucine-rich re...    191   3e-52   Prunus mume [ume]
ref|XP_010101692.1|  putative inactive leucine-rich repeat recept...    179   9e-52   
ref|XP_002526283.1|  ATP binding protein, putative                      189   1e-51   Ricinus communis
ref|XP_007142963.1|  hypothetical protein PHAVU_007G032100g             189   1e-51   Phaseolus vulgaris [French bean]
ref|XP_011038748.1|  PREDICTED: probable inactive leucine-rich re...    187   7e-51   Populus euphratica
ref|XP_003555253.1|  PREDICTED: probable inactive leucine-rich re...    186   2e-50   Glycine max [soybeans]
gb|KHN42429.1|  Putative inactive leucine-rich repeat receptor-li...    185   3e-50   Glycine soja [wild soybean]
gb|KHN06695.1|  Putative inactive leucine-rich repeat receptor-li...    185   3e-50   Glycine soja [wild soybean]
ref|XP_003536668.1|  PREDICTED: probable inactive leucine-rich re...    185   5e-50   Glycine max [soybeans]
ref|XP_010279368.1|  PREDICTED: probable inactive leucine-rich re...    183   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_008339638.1|  PREDICTED: probable inactive leucine-rich re...    183   3e-49   Malus domestica [apple tree]
ref|XP_010695919.1|  PREDICTED: probable inactive leucine-rich re...    182   3e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010262185.1|  PREDICTED: probable inactive leucine-rich re...    182   3e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002315920.1|  leucine-rich repeat transmembrane protein ki...    182   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_008467183.1|  PREDICTED: probable inactive leucine-rich re...    182   4e-49   Cucumis melo [Oriental melon]
ref|XP_008389257.1|  PREDICTED: probable inactive leucine-rich re...    182   5e-49   
ref|XP_004147142.2|  PREDICTED: probable inactive leucine-rich re...    182   7e-49   Cucumis sativus [cucumbers]
ref|XP_009357243.1|  PREDICTED: probable inactive leucine-rich re...    181   1e-48   Pyrus x bretschneideri [bai li]
gb|EPS65629.1|  hypothetical protein M569_09144                         181   1e-48   Genlisea aurea
ref|XP_012075725.1|  PREDICTED: probable inactive leucine-rich re...    181   2e-48   Jatropha curcas
ref|XP_009356227.1|  PREDICTED: probable inactive leucine-rich re...    174   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_008446637.1|  PREDICTED: probable inactive leucine-rich re...    172   1e-45   Cucumis melo [Oriental melon]
ref|XP_011070766.1|  PREDICTED: probable inactive leucine-rich re...    171   2e-45   
ref|XP_011655791.1|  PREDICTED: probable inactive leucine-rich re...    171   5e-45   Cucumis sativus [cucumbers]
dbj|BAJ89657.1|  predicted protein                                      169   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002311473.2|  leucine-rich repeat transmembrane protein ki...    169   2e-44   Populus trichocarpa [western balsam poplar]
gb|KFK33342.1|  hypothetical protein AALP_AA5G001600                    169   2e-44   Arabis alpina [alpine rockcress]
ref|XP_004968837.1|  PREDICTED: probable inactive leucine-rich re...    168   4e-44   Setaria italica
ref|XP_011022504.1|  PREDICTED: probable inactive leucine-rich re...    168   4e-44   Populus euphratica
ref|XP_006645941.1|  PREDICTED: probable inactive leucine-rich re...    166   6e-44   
ref|XP_010922469.1|  PREDICTED: probable inactive leucine-rich re...    167   6e-44   Elaeis guineensis
ref|XP_002457921.1|  hypothetical protein SORBIDRAFT_03g021850          167   6e-44   Sorghum bicolor [broomcorn]
ref|XP_008674174.1|  PREDICTED: probable inactive leucine-rich re...    167   9e-44   
ref|XP_008810049.1|  PREDICTED: probable inactive leucine-rich re...    167   1e-43   Phoenix dactylifera
gb|EMT20661.1|  Putative LRR receptor-like serine/threonine-prote...    166   2e-43   
ref|XP_006398506.1|  hypothetical protein EUTSA_v10000800mg             166   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002876736.1|  hypothetical protein ARALYDRAFT_484030             166   2e-43   
ref|XP_009418392.1|  PREDICTED: probable inactive leucine-rich re...    166   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010108889.1|  putative inactive leucine-rich repeat recept...    165   4e-43   Morus notabilis
ref|NP_001043190.1|  Os01g0514700                                       165   6e-43   
gb|EAZ12114.1|  hypothetical protein OsJ_01996                          164   8e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009394442.1|  PREDICTED: probable inactive leucine-rich re...    164   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX77808.1|  BnaC07g20620D                                          164   1e-42   
ref|XP_006843749.2|  PREDICTED: probable inactive leucine-rich re...    164   2e-42   Amborella trichopoda
ref|XP_011623083.1|  PREDICTED: probable inactive leucine-rich re...    163   2e-42   Amborella trichopoda
ref|NP_178230.1|  leucine-rich repeat transmembrane protein kinas...    163   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554434.1|  PREDICTED: probable inactive leucine-rich re...    163   3e-42   Tarenaya hassleriana [spider flower]
emb|CDY17688.1|  BnaA06g35070D                                          163   4e-42   Brassica napus [oilseed rape]
ref|XP_009101362.1|  PREDICTED: probable inactive leucine-rich re...    162   8e-42   Brassica rapa
ref|XP_006290656.1|  hypothetical protein CARUB_v10016748mg             161   2e-41   Capsella rubella
ref|XP_007227346.1|  hypothetical protein PRUPE_ppa002204mg             160   2e-41   
ref|XP_003567755.1|  PREDICTED: probable inactive leucine-rich re...    160   2e-41   Brachypodium distachyon [annual false brome]
ref|XP_010906986.1|  PREDICTED: probable inactive leucine-rich re...    160   4e-41   Elaeis guineensis
gb|EAY74284.1|  hypothetical protein OsI_02173                          159   4e-41   Oryza sativa Indica Group [Indian rice]
gb|EYU30010.1|  hypothetical protein MIMGU_mgv1a002330mg                159   6e-41   Erythranthe guttata [common monkey flower]
gb|KDO63201.1|  hypothetical protein CISIN_1g042348mg                   157   3e-40   Citrus sinensis [apfelsine]
ref|XP_006430721.1|  hypothetical protein CICLE_v10013476mg             157   4e-40   Citrus clementina [clementine]
ref|XP_006482200.1|  PREDICTED: probable inactive leucine-rich re...    156   9e-40   Citrus sinensis [apfelsine]
ref|XP_010916465.1|  PREDICTED: probable inactive leucine-rich re...    155   2e-39   
ref|XP_010502083.1|  PREDICTED: probable inactive leucine-rich re...    155   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008343005.1|  PREDICTED: probable inactive leucine-rich re...    154   3e-39   
emb|CDX84980.1|  BnaC05g20750D                                          154   3e-39   
ref|XP_006415859.1|  hypothetical protein EUTSA_v10006964mg             154   4e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010477947.1|  PREDICTED: probable inactive leucine-rich re...    154   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006306904.1|  hypothetical protein CARUB_v10008465mg             153   7e-39   Capsella rubella
ref|XP_010460394.1|  PREDICTED: probable inactive leucine-rich re...    153   7e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010499124.1|  PREDICTED: probable inactive leucine-rich re...    153   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008809165.1|  PREDICTED: probable inactive leucine-rich re...    153   1e-38   Phoenix dactylifera
ref|XP_008229314.1|  PREDICTED: probable inactive leucine-rich re...    153   1e-38   
ref|XP_011035109.1|  PREDICTED: probable inactive leucine-rich re...    151   2e-38   Populus euphratica
ref|XP_009395564.1|  PREDICTED: probable inactive leucine-rich re...    152   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY42116.1|  BnaA09g28440D                                          152   3e-38   Brassica napus [oilseed rape]
ref|XP_002305177.1|  hypothetical protein POPTR_0004s09480g             152   3e-38   
ref|XP_011035107.1|  PREDICTED: probable inactive leucine-rich re...    152   3e-38   Populus euphratica
ref|XP_011035108.1|  PREDICTED: probable inactive leucine-rich re...    151   3e-38   Populus euphratica
ref|XP_010536321.1|  PREDICTED: probable inactive leucine-rich re...    143   5e-38   
ref|XP_002528076.1|  ATP binding protein, putative                      150   6e-38   Ricinus communis
gb|KFK44531.1|  hypothetical protein AALP_AA1G268700                    151   6e-38   Arabis alpina [alpine rockcress]
ref|NP_564228.1|  leucine-rich repeat-containing protein kinase         150   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009341317.1|  PREDICTED: probable inactive leucine-rich re...    149   2e-37   
ref|XP_007216807.1|  hypothetical protein PRUPE_ppa023239mg             149   2e-37   Prunus persica
ref|XP_009115301.1|  PREDICTED: probable inactive leucine-rich re...    149   2e-37   Brassica rapa
ref|XP_009344127.1|  PREDICTED: probable inactive leucine-rich re...    149   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_010513827.1|  PREDICTED: probable inactive leucine-rich re...    148   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010424856.1|  PREDICTED: probable inactive leucine-rich re...    148   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010545857.1|  PREDICTED: probable inactive leucine-rich re...    142   8e-37   
ref|XP_010542164.1|  PREDICTED: probable inactive leucine-rich re...    142   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_011021296.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    141   1e-34   Populus euphratica
ref|XP_012078013.1|  PREDICTED: probable inactive leucine-rich re...    140   2e-34   Jatropha curcas
ref|XP_006383406.1|  hypothetical protein POPTR_0005s15180g             140   6e-34   
gb|KJB43117.1|  hypothetical protein B456_007G184800                    139   1e-33   Gossypium raimondii
ref|XP_007033179.1|  Leucine-rich repeat protein kinase family pr...    138   2e-33   
ref|XP_009393570.1|  PREDICTED: probable inactive leucine-rich re...    137   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX96124.1|  BnaA07g26070D                                          127   1e-32   
ref|XP_009413652.1|  PREDICTED: probable inactive leucine-rich re...    135   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010032652.1|  PREDICTED: probable inactive leucine-rich re...    135   3e-32   Eucalyptus grandis [rose gum]
ref|XP_010032651.1|  PREDICTED: probable inactive leucine-rich re...    135   3e-32   Eucalyptus grandis [rose gum]
ref|XP_004309737.1|  PREDICTED: probable inactive leucine-rich re...    132   4e-31   Fragaria vesca subsp. vesca
ref|XP_010528994.1|  PREDICTED: probable inactive leucine-rich re...    129   4e-30   
ref|XP_003638422.1|  Receptor protein kinase-like protein               120   4e-30   
ref|XP_010032653.1|  PREDICTED: probable inactive leucine-rich re...    129   4e-30   
ref|XP_006391437.1|  hypothetical protein EUTSA_v10018224mg             128   6e-30   Eutrema salsugineum [saltwater cress]
emb|CDY52887.1|  BnaC06g27800D                                          125   6e-29   Brassica napus [oilseed rape]
ref|XP_001758511.1|  predicted protein                                  121   6e-29   
ref|XP_009105234.1|  PREDICTED: probable inactive leucine-rich re...    124   2e-28   Brassica rapa
ref|NP_176855.1|  probable inactive leucine-rich repeat receptor-...    119   1e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01034.1|  hypothetical protein                                   119   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511585.1|  PREDICTED: probable inactive leucine-rich re...    117   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010474154.1|  PREDICTED: probable inactive leucine-rich re...    116   1e-25   
ref|XP_002888549.1|  hypothetical protein ARALYDRAFT_475779             115   2e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_006300314.1|  hypothetical protein CARUB_v10019896mg             115   2e-25   Capsella rubella
ref|XP_006845210.1|  PREDICTED: probable inactive leucine-rich re...    105   5e-22   Amborella trichopoda
ref|XP_010527771.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    104   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_012085656.1|  PREDICTED: probable inactive leucine-rich re...    104   1e-21   Jatropha curcas
ref|XP_007045046.1|  Leucine-rich repeat protein kinase family pr...    103   2e-21   
ref|XP_010105787.1|  putative inactive leucine-rich repeat recept...    103   3e-21   Morus notabilis
gb|KHG08504.1|  hypothetical protein F383_35684                         103   4e-21   Gossypium arboreum [tree cotton]
ref|XP_002312630.1|  leucine-rich repeat family protein                 102   4e-21   
ref|XP_011649930.1|  PREDICTED: probable inactive leucine-rich re...    102   7e-21   Cucumis sativus [cucumbers]
ref|XP_002265151.2|  PREDICTED: probable inactive leucine-rich re...    102   7e-21   Vitis vinifera
ref|XP_004138802.1|  PREDICTED: probable inactive leucine-rich re...    102   8e-21   Cucumis sativus [cucumbers]
ref|XP_006361554.1|  PREDICTED: probable inactive leucine-rich re...    102   9e-21   Solanum tuberosum [potatoes]
gb|KJB30948.1|  hypothetical protein B456_005G169100                    102   1e-20   Gossypium raimondii
ref|XP_007225190.1|  hypothetical protein PRUPE_ppa002123mg             101   1e-20   Prunus persica
ref|XP_004239201.1|  PREDICTED: probable inactive leucine-rich re...    101   1e-20   Solanum lycopersicum
ref|XP_008222077.1|  PREDICTED: probable inactive leucine-rich re...    101   2e-20   Prunus mume [ume]
ref|XP_004310210.1|  PREDICTED: probable inactive leucine-rich re...    101   2e-20   Fragaria vesca subsp. vesca
ref|XP_008368321.1|  PREDICTED: probable inactive leucine-rich re...  97.1    2e-20   
gb|KCW61968.1|  hypothetical protein EUGRSUZ_H04654                     100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_008446051.1|  PREDICTED: probable inactive leucine-rich re...    100   2e-20   Cucumis melo [Oriental melon]
ref|XP_004135515.2|  PREDICTED: probable inactive leucine-rich re...    100   2e-20   Cucumis sativus [cucumbers]
ref|XP_011071213.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    100   2e-20   
ref|XP_010025331.1|  PREDICTED: probable inactive leucine-rich re...    100   3e-20   Eucalyptus grandis [rose gum]
ref|XP_008441289.1|  PREDICTED: probable inactive leucine-rich re...    100   3e-20   Cucumis melo [Oriental melon]
gb|EYU42102.1|  hypothetical protein MIMGU_mgv1a001951mg                100   4e-20   Erythranthe guttata [common monkey flower]
ref|XP_003516395.1|  PREDICTED: probable inactive leucine-rich re...  99.8    5e-20   Glycine max [soybeans]
ref|XP_009800742.1|  PREDICTED: probable inactive leucine-rich re...  99.8    6e-20   Nicotiana sylvestris
ref|XP_011029672.1|  PREDICTED: probable inactive leucine-rich re...  99.8    6e-20   Populus euphratica
emb|CBI27592.3|  unnamed protein product                              99.8    6e-20   Vitis vinifera
ref|XP_009591095.1|  PREDICTED: probable inactive leucine-rich re...  99.8    6e-20   Nicotiana tomentosiformis
ref|XP_007134648.1|  hypothetical protein PHAVU_010G064900g           99.4    7e-20   Phaseolus vulgaris [French bean]
gb|KHN03089.1|  Putative inactive leucine-rich repeat receptor-li...  96.3    9e-20   Glycine soja [wild soybean]
ref|XP_006844018.1|  PREDICTED: probable LRR receptor-like serine...  99.4    1e-19   Amborella trichopoda
ref|XP_003623383.1|  Receptor protein kinase-like protein             99.0    1e-19   Medicago truncatula
gb|KHN12556.1|  Putative inactive leucine-rich repeat receptor-li...  97.4    1e-19   Glycine soja [wild soybean]
ref|XP_006438068.1|  hypothetical protein CICLE_v10030842mg           99.0    1e-19   Citrus clementina [clementine]
emb|CDP13327.1|  unnamed protein product                              99.0    1e-19   Coffea canephora [robusta coffee]
ref|XP_006484071.1|  PREDICTED: probable inactive leucine-rich re...  99.0    1e-19   Citrus sinensis [apfelsine]
gb|KDO81950.1|  hypothetical protein CISIN_1g005226mg                 99.0    1e-19   Citrus sinensis [apfelsine]
ref|XP_004492498.1|  PREDICTED: probable inactive leucine-rich re...  99.0    1e-19   Cicer arietinum [garbanzo]
ref|XP_002315617.2|  leucine-rich repeat family protein               94.7    1e-19   
ref|XP_011041520.1|  PREDICTED: probable inactive leucine-rich re...  98.6    1e-19   Populus euphratica
ref|XP_010930148.1|  PREDICTED: probable inactive leucine-rich re...  98.6    2e-19   Elaeis guineensis
ref|XP_001759884.1|  predicted protein                                97.8    3e-19   
ref|XP_003529180.1|  PREDICTED: probable inactive leucine-rich re...  97.4    3e-19   Glycine max [soybeans]
ref|XP_009372312.1|  PREDICTED: probable inactive leucine-rich re...  97.1    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_008340196.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  96.7    6e-19   
ref|XP_006576501.1|  PREDICTED: probable inactive leucine-rich re...  96.7    6e-19   Glycine max [soybeans]
ref|XP_010250769.1|  PREDICTED: probable inactive leucine-rich re...  96.7    6e-19   Nelumbo nucifera [Indian lotus]
gb|KHN40703.1|  Putative inactive leucine-rich repeat receptor-li...  95.5    7e-19   Glycine soja [wild soybean]
ref|XP_003552276.1|  PREDICTED: probable inactive leucine-rich re...  95.9    1e-18   Glycine max [soybeans]
gb|EPS65472.1|  hypothetical protein M569_09303                       94.4    3e-18   Genlisea aurea
ref|XP_006355906.1|  PREDICTED: leucine-rich repeat receptor-like...  94.0    6e-18   Solanum tuberosum [potatoes]
ref|XP_009105290.1|  PREDICTED: probable inactive leucine-rich re...  93.2    8e-18   Brassica rapa
gb|EYU17948.1|  hypothetical protein MIMGU_mgv1a022168mg              93.6    9e-18   Erythranthe guttata [common monkey flower]
emb|CDX96089.1|  BnaA07g26420D                                        92.8    1e-17   
ref|XP_004496523.1|  PREDICTED: probable inactive leucine-rich re...  92.8    1e-17   Cicer arietinum [garbanzo]
ref|XP_010667968.1|  PREDICTED: leucine-rich repeat receptor-like...  92.8    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004152065.1|  PREDICTED: leucine-rich repeat receptor-like...  92.8    2e-17   Cucumis sativus [cucumbers]
ref|XP_009406412.1|  PREDICTED: probable inactive leucine-rich re...  92.0    2e-17   
ref|XP_008350956.1|  PREDICTED: probable inactive leucine-rich re...  92.0    2e-17   Malus domestica [apple tree]
ref|XP_010248952.1|  PREDICTED: probable inactive leucine-rich re...  92.0    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010239181.1|  PREDICTED: probable inactive leucine-rich re...  88.2    2e-17   
ref|XP_008447373.1|  PREDICTED: leucine-rich repeat receptor-like...  92.0    3e-17   Cucumis melo [Oriental melon]
ref|XP_008783789.1|  PREDICTED: probable inactive leucine-rich re...  91.7    3e-17   Phoenix dactylifera
gb|KJB61249.1|  hypothetical protein B456_009G348000                  91.3    4e-17   Gossypium raimondii
ref|XP_004247132.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    4e-17   Solanum lycopersicum
ref|XP_002975437.1|  hypothetical protein SELMODRAFT_30410            91.7    4e-17   
ref|XP_009621771.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    4e-17   Nicotiana tomentosiformis
ref|XP_003520615.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    4e-17   Glycine max [soybeans]
ref|XP_009769366.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    4e-17   Nicotiana sylvestris
gb|AGT16770.1|  hypothetical protein SHCRBa_022_K23_R_30              91.3    4e-17   Saccharum hybrid cultivar R570
ref|XP_003604546.1|  Leucine-rich repeat receptor-like protein ki...  90.9    5e-17   Medicago truncatula
ref|XP_010928472.1|  PREDICTED: probable inactive leucine-rich re...  90.9    5e-17   Elaeis guineensis
gb|KHN10782.1|  Leucine-rich repeat receptor-like protein kinase ...  90.9    6e-17   Glycine soja [wild soybean]
ref|XP_004292244.2|  PREDICTED: leucine-rich repeat receptor-like...  91.3    7e-17   Fragaria vesca subsp. vesca
emb|CDY01814.1|  BnaC06g28540D                                        90.5    7e-17   
ref|XP_002988292.1|  hypothetical protein SELMODRAFT_127443           90.5    7e-17   
ref|XP_002963890.1|  hypothetical protein SELMODRAFT_80116            90.5    7e-17   
ref|XP_011080119.1|  PREDICTED: leucine-rich repeat receptor-like...  90.9    8e-17   Sesamum indicum [beniseed]
ref|XP_010682822.1|  PREDICTED: probable inactive leucine-rich re...  90.1    8e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002964083.1|  hypothetical protein SELMODRAFT_81328            90.5    9e-17   Selaginella moellendorffii
ref|XP_009343787.1|  PREDICTED: leucine-rich repeat receptor-like...  90.5    9e-17   Pyrus x bretschneideri [bai li]
ref|XP_010540915.1|  PREDICTED: leucine-rich repeat receptor-like...  90.1    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_002514942.1|  protein with unknown function                    90.1    1e-16   
gb|EYU46395.1|  hypothetical protein MIMGU_mgv1a000683mg              90.1    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_003625388.1|  Receptor-like protein kinase                     89.7    2e-16   Medicago truncatula
ref|NP_001060650.1|  Os07g0681100                                     89.4    2e-16   
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative   89.0    2e-16   Ricinus communis
gb|EAZ05160.1|  hypothetical protein OsI_27356                        89.0    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008364044.1|  PREDICTED: leucine-rich repeat receptor-like...  89.4    2e-16   
ref|XP_002456732.1|  hypothetical protein SORBIDRAFT_03g041570        89.4    2e-16   Sorghum bicolor [broomcorn]
gb|EAZ18160.1|  hypothetical protein OsJ_33710                        84.3    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004309604.1|  PREDICTED: probably inactive leucine-rich re...  89.0    2e-16   Fragaria vesca subsp. vesca
ref|XP_010447946.1|  PREDICTED: leucine-rich repeat receptor-like...  84.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...  88.6    2e-16   Setaria italica
ref|XP_002865012.1|  hypothetical protein ARALYDRAFT_496872           88.6    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_012085218.1|  PREDICTED: leucine-rich repeat receptor-like...  89.0    3e-16   Jatropha curcas
ref|XP_010531616.1|  PREDICTED: probable inactive leucine-rich re...  88.6    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_010921194.1|  PREDICTED: probable inactive receptor kinase...  86.3    4e-16   Elaeis guineensis
gb|KDP26461.1|  hypothetical protein JCGZ_17619                       88.6    4e-16   Jatropha curcas
ref|XP_008674748.1|  PREDICTED: receptor-like protein kinase HSL1     88.6    4e-16   Zea mays [maize]
ref|XP_003553510.2|  PREDICTED: leucine-rich repeat receptor-like...  88.6    4e-16   Glycine max [soybeans]
ref|XP_008795724.1|  PREDICTED: probable inactive leucine-rich re...  88.2    4e-16   Phoenix dactylifera
ref|XP_004970775.1|  PREDICTED: receptor-like protein kinase HSL1...  88.6    4e-16   
gb|KFK41150.1|  hypothetical protein AALP_AA2G092300                  88.2    4e-16   Arabis alpina [alpine rockcress]
ref|XP_004970774.1|  PREDICTED: receptor-like protein kinase HSL1...  88.2    4e-16   
ref|XP_010264856.1|  PREDICTED: leucine-rich repeat receptor-like...  88.6    4e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010558914.1|  PREDICTED: probable LRR receptor-like serine...  88.2    5e-16   Tarenaya hassleriana [spider flower]
ref|NP_176918.1|  Leucine-rich repeat protein kinase family protein   87.8    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007162602.1|  hypothetical protein PHAVU_001G165100g           88.2    5e-16   Phaseolus vulgaris [French bean]
ref|XP_007144405.1|  hypothetical protein PHAVU_007G153400g           88.2    5e-16   Phaseolus vulgaris [French bean]
ref|NP_001067731.1|  Os11g0300700                                     84.3    5e-16   
ref|XP_006300793.1|  hypothetical protein CARUB_v10019872mg           87.8    5e-16   Capsella rubella
ref|XP_002888603.1|  predicted protein                                87.8    5e-16   Arabidopsis lyrata subsp. lyrata
gb|EMT29311.1|  Phytosulfokine receptor 1                             85.9    6e-16   
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090        87.4    6e-16   Sorghum bicolor [broomcorn]
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...  87.4    6e-16   Oryza brachyantha
ref|XP_006391267.1|  hypothetical protein EUTSA_v10018190mg           87.8    6e-16   Eutrema salsugineum [saltwater cress]
emb|CDP03798.1|  unnamed protein product                              87.8    6e-16   Coffea canephora [robusta coffee]
ref|XP_010102197.1|  Leucine-rich repeat receptor-like protein ki...  87.8    6e-16   Morus notabilis
gb|KHN05886.1|  Leucine-rich repeat receptor-like protein kinase ...  87.8    7e-16   Glycine soja [wild soybean]
ref|XP_009396270.1|  PREDICTED: probable LRR receptor-like serine...  87.8    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006588706.1|  PREDICTED: leucine-rich repeat receptor-like...  87.8    7e-16   Glycine max [soybeans]
ref|XP_001754230.1|  predicted protein                                84.0    7e-16   
ref|XP_004973865.1|  PREDICTED: probable inactive leucine-rich re...  87.0    7e-16   Setaria italica
dbj|BAJ94587.1|  predicted protein                                    87.4    7e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO60347.1|  hypothetical protein CISIN_1g001752mg                 87.8    8e-16   Citrus sinensis [apfelsine]
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                 87.0    8e-16   Citrus sinensis [apfelsine]
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg           87.0    8e-16   Citrus clementina [clementine]
ref|XP_006480075.1|  PREDICTED: leucine-rich repeat receptor-like...  87.8    8e-16   
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg           87.0    8e-16   Citrus clementina [clementine]
ref|XP_002522003.1|  protein with unknown function                    87.4    8e-16   
ref|XP_001774014.1|  predicted protein                                87.0    8e-16   
gb|EPS60741.1|  hypothetical protein M569_14060                       87.0    8e-16   Genlisea aurea
ref|XP_006443728.1|  hypothetical protein CICLE_v10023610mg           87.8    9e-16   
ref|XP_010244265.1|  PREDICTED: probable LRR receptor-like serine...  87.0    9e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...  86.7    1e-15   Eucalyptus grandis [rose gum]
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...  86.7    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_010674258.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    1e-15   
emb|CDY10964.1|  BnaA03g46230D                                        82.0    1e-15   Brassica napus [oilseed rape]
ref|XP_007050157.1|  Leucine-rich repeat receptor-like protein ki...  87.4    1e-15   
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...  86.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007149806.1|  hypothetical protein PHAVU_005G100400g           87.0    1e-15   Phaseolus vulgaris [French bean]
ref|NP_201529.1|  receptor-like kinase                                86.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KEH42461.1|  LRR receptor-like kinase family protein               86.7    1e-15   Medicago truncatula
ref|XP_008235589.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    1e-15   Prunus mume [ume]
ref|XP_011083069.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  87.0    1e-15   
gb|AAL06915.1|  AT5g67280/K3G17_4                                     86.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...  86.3    1e-15   
ref|XP_008218358.1|  PREDICTED: leucine-rich repeat receptor-like...  86.7    2e-15   
ref|XP_007208420.1|  hypothetical protein PRUPE_ppa000734mg           86.7    2e-15   
gb|EAY76695.1|  hypothetical protein OsI_04648                        86.7    2e-15   
ref|NP_001044979.1|  Os01g0878300                                     86.7    2e-15   
gb|AAX96427.1|  Protein kinase domain                                 83.6    2e-15   
ref|XP_010415324.1|  PREDICTED: probable inactive leucine-rich re...  86.3    2e-15   
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...  85.9    2e-15   
ref|XP_010470658.1|  PREDICTED: probable inactive leucine-rich re...  85.9    2e-15   
ref|XP_010511694.1|  PREDICTED: probable inactive leucine-rich re...  85.9    2e-15   
dbj|BAJ97282.1|  predicted protein                                    86.3    2e-15   
gb|EMS64651.1|  Receptor-like protein kinase HSL1                     86.3    2e-15   
ref|XP_010447945.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    2e-15   
ref|XP_010438416.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    2e-15   
dbj|BAJ87631.1|  predicted protein                                    86.3    2e-15   
gb|EEC75189.1|  hypothetical protein OsI_11426                        85.1    2e-15   
gb|ACI95776.1|  PAN1                                                  85.9    2e-15   
ref|XP_007199694.1|  hypothetical protein PRUPE_ppa000726mg           86.3    2e-15   
ref|XP_008646984.1|  PREDICTED: uncharacterized protein LOC100501...  85.9    2e-15   
ref|XP_010433191.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    2e-15   
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    2e-15   
gb|KHN24190.1|  Putative inactive leucine-rich repeat receptor-li...  85.5    2e-15   
ref|XP_004516649.1|  PREDICTED: probable leucine-rich repeat rece...  85.5    2e-15   
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...  85.5    3e-15   
ref|XP_002867439.1|  hypothetical protein ARALYDRAFT_328832           85.9    3e-15   
ref|XP_009372149.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  85.9    3e-15   
gb|EMT09037.1|  Putative inactive receptor kinase                     85.5    3e-15   
dbj|BAK07296.1|  predicted protein                                    85.5    3e-15   
ref|XP_008372397.1|  PREDICTED: leucine-rich repeat receptor-like...  85.9    3e-15   
ref|NP_194594.1|  putative leucine-rich repeat transmembrane prot...  85.9    3e-15   
dbj|BAJ93317.1|  predicted protein                                    85.5    3e-15   
ref|XP_003518066.1|  PREDICTED: probable inactive leucine-rich re...  85.5    3e-15   
emb|CDY35204.1|  BnaA01g08270D                                        85.9    3e-15   
ref|XP_009335228.1|  PREDICTED: leucine-rich repeat receptor-like...  85.9    3e-15   
gb|KFK29405.1|  hypothetical protein AALP_AA7G129800                  85.9    3e-15   
ref|XP_003572363.2|  PREDICTED: probable inactive leucine-rich re...  85.5    3e-15   
ref|XP_008365946.1|  PREDICTED: leucine-rich repeat receptor-like...  85.9    3e-15   
ref|NP_001050019.1|  Os03g0332900                                     85.1    3e-15   
emb|CAN80590.1|  hypothetical protein VITISV_040789                   85.1    3e-15   
ref|XP_006285784.1|  hypothetical protein CARUB_v10007258mg           85.9    3e-15   
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...  85.1    3e-15   
gb|EPS59286.1|  hypothetical protein M569_15521                       85.1    3e-15   
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...  85.1    3e-15   
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor           85.1    3e-15   
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...  85.1    4e-15   
ref|XP_006366775.1|  PREDICTED: leucine-rich repeat receptor-like...  85.5    4e-15   
emb|CDY03526.1|  BnaC01g15560D                                        82.0    4e-15   
dbj|BAF79945.1|  receptor-like kinase                                 85.5    4e-15   
ref|XP_002966360.1|  hypothetical protein SELMODRAFT_60230            85.5    4e-15   
ref|XP_002978200.1|  hypothetical protein SELMODRAFT_50240            85.5    4e-15   
ref|XP_006412927.1|  hypothetical protein EUTSA_v10024302mg           85.5    4e-15   
dbj|BAK01563.1|  predicted protein                                    85.1    4e-15   
ref|XP_011077132.1|  PREDICTED: leucine-rich repeat receptor-like...  85.5    4e-15   
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...  84.7    4e-15   
gb|KHN25658.1|  Putative inactive receptor kinase                     84.0    4e-15   
ref|XP_008373745.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  85.1    4e-15   
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...  84.7    4e-15   
gb|AFK38063.1|  unknown                                               80.1    5e-15   
gb|AEW08175.1|  hypothetical protein 2_2125_01                        80.1    5e-15   
ref|XP_009394541.1|  PREDICTED: probable LRR receptor-like serine...  85.1    5e-15   
ref|XP_004495057.1|  PREDICTED: leucine-rich repeat receptor-like...  85.1    5e-15   
ref|XP_008349015.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  84.0    5e-15   
ref|XP_009796121.1|  PREDICTED: probable LRR receptor-like serine...  84.7    5e-15   
ref|NP_001168844.1|  uncharacterized LOC100382649 precursor           84.7    5e-15   
ref|XP_002463642.1|  hypothetical protein SORBIDRAFT_01g003440        84.7    5e-15   
gb|ACN30771.1|  unknown                                               84.7    5e-15   
ref|NP_001042446.1|  Os01g0223600                                     84.0    5e-15   
ref|XP_006290696.1|  hypothetical protein CARUB_v10016797mg           84.7    6e-15   
ref|XP_002535195.1|  Receptor protein kinase CLAVATA1 precursor, ...  84.7    6e-15   
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...  84.3    6e-15   
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...  84.3    6e-15   
ref|XP_004495591.1|  PREDICTED: leucine-rich repeat receptor-like...  84.7    6e-15   
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...  84.3    6e-15   
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g           84.3    6e-15   
gb|KDO67927.1|  hypothetical protein CISIN_1g002250mg                 84.7    6e-15   
ref|XP_010262458.1|  PREDICTED: leucine-rich repeat receptor-like...  84.7    6e-15   
ref|XP_002449308.1|  hypothetical protein SORBIDRAFT_05g007490        84.7    7e-15   
ref|XP_010232642.1|  PREDICTED: receptor-like protein kinase HSL1     84.7    7e-15   
ref|XP_006645116.1|  PREDICTED: receptor-like protein kinase HSL1...  84.7    7e-15   
ref|XP_010245135.1|  PREDICTED: leucine-rich repeat receptor-like...  84.7    7e-15   
ref|XP_009351047.1|  PREDICTED: probably inactive leucine-rich re...  84.7    7e-15   
gb|EMT12910.1|  Putative inactive receptor kinase                     84.0    7e-15   
gb|EAZ44661.1|  hypothetical protein OsJ_29285                        84.0    7e-15   
gb|EMT18303.1|  Receptor-like protein kinase HSL1                     84.3    7e-15   
emb|CDP00835.1|  unnamed protein product                              84.3    8e-15   
dbj|BAC43224.1|  putative receptor-like protein kinase                84.0    8e-15   
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg           84.0    8e-15   
ref|NP_191342.1|  leucine-rich repeat protein kinase-like protein     84.0    8e-15   
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                 84.0    8e-15   
dbj|BAA94519.1|  putative receptor-like kinase                        84.0    8e-15   
emb|CBI37195.3|  unnamed protein product                              84.7    8e-15   
gb|KHN16761.1|  Putative inactive receptor kinase                     82.4    8e-15   
gb|KEH41571.1|  LRR receptor-like kinase                              84.0    8e-15   
emb|CDO99209.1|  unnamed protein product                              80.1    8e-15   
ref|XP_006422685.1|  hypothetical protein CICLE_v10027748mg           84.3    8e-15   
ref|XP_006486805.1|  PREDICTED: receptor-like protein kinase HAIK...  84.3    8e-15   
ref|XP_006393926.1|  hypothetical protein EUTSA_v10003700mg           84.0    9e-15   
ref|XP_003535720.1|  PREDICTED: probable leucine-rich repeat rece...  84.0    9e-15   
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...  84.0    9e-15   
gb|AFO11665.1|  At2g26730-like protein                                78.2    9e-15   
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...  84.0    9e-15   
ref|XP_010094441.1|  putative inactive receptor kinase                84.0    9e-15   
ref|XP_007142938.1|  hypothetical protein PHAVU_007G029900g           84.0    9e-15   
ref|XP_003590988.1|  Receptor-like protein kinase                     84.3    1e-14   
gb|AEX11047.1|  hypothetical protein 0_1169_01                        79.3    1e-14   
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...  83.6    1e-14   
ref|XP_012091018.1|  PREDICTED: probable inactive receptor kinase...  83.6    1e-14   
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...  83.6    1e-14   
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                   84.0    1e-14   
ref|XP_002269886.3|  PREDICTED: leucine-rich repeat receptor-like...  84.3    1e-14   
ref|XP_010046357.1|  PREDICTED: leucine-rich repeat receptor-like...  84.0    1e-14   
ref|XP_009395855.1|  PREDICTED: probable LRR receptor-like serine...  84.0    1e-14   
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                 83.6    1e-14   
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg           83.6    1e-14   
ref|XP_009129466.1|  PREDICTED: leucine-rich repeat receptor-like...  84.0    1e-14   
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...  83.6    1e-14   
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...  83.6    1e-14   
ref|XP_008389021.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  82.0    1e-14   
dbj|BAJ86920.1|  predicted protein                                    80.1    1e-14   
ref|XP_010036153.1|  PREDICTED: leucine-rich repeat receptor-like...  84.0    1e-14   
ref|XP_006408370.1|  hypothetical protein EUTSA_v10020304mg           83.2    1e-14   
emb|CDP04037.1|  unnamed protein product                              80.5    1e-14   
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...  83.2    1e-14   
ref|XP_003614178.1|  Receptor-like protein kinase                     84.0    1e-14   
emb|CDY38373.1|  BnaC01g09820D                                        83.6    1e-14   
ref|XP_006402836.1|  hypothetical protein EUTSA_v10005826mg           83.2    1e-14   
ref|XP_002301848.1|  leucine-rich repeat transmembrane protein ki...  83.6    1e-14   
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g           83.2    1e-14   
ref|XP_009127628.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    1e-14   
ref|XP_006400197.1|  hypothetical protein EUTSA_v10012966mg           83.2    1e-14   
gb|KEH21182.1|  LRR receptor-like kinase                              83.2    2e-14   
ref|XP_010243347.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    2e-14   
ref|XP_007153491.1|  hypothetical protein PHAVU_003G040200g           83.6    2e-14   
ref|XP_006293826.1|  hypothetical protein CARUB_v10022811mg           83.2    2e-14   
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...  83.2    2e-14   
gb|KCW47263.1|  hypothetical protein EUGRSUZ_K01060                   83.6    2e-14   
ref|XP_010057719.1|  PREDICTED: probable inactive leucine-rich re...  83.2    2e-14   
ref|XP_003592627.1|  Leucine-rich repeat receptor-like protein ki...  83.2    2e-14   
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...  83.2    2e-14   
ref|XP_001752184.1|  predicted protein                                83.2    2e-14   
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...  83.2    2e-14   
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...  83.2    2e-14   
ref|XP_006293827.1|  hypothetical protein CARUB_v10022811mg           82.8    2e-14   
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...  82.8    2e-14   
gb|KHN18649.1|  Putative inactive receptor kinase                     82.8    2e-14   
gb|KJB11032.1|  hypothetical protein B456_001G237400                  83.2    2e-14   
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...  82.8    2e-14   
ref|XP_002992978.1|  hypothetical protein SELMODRAFT_270002           82.8    2e-14   
ref|XP_010271084.1|  PREDICTED: probable LRR receptor-like serine...  83.2    2e-14   
ref|XP_012086772.1|  PREDICTED: probable inactive receptor kinase...  82.8    2e-14   
ref|XP_002518813.1|  receptor-kinase, putative                        82.8    2e-14   
ref|XP_002870624.1|  kinase family protein                            81.3    2e-14   
ref|XP_002454913.1|  hypothetical protein SORBIDRAFT_03g001310        82.8    2e-14   
gb|AGV54373.1|  leucine-rich repeat receptor-like protein             82.4    2e-14   
ref|XP_010035801.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  83.2    2e-14   
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...  82.8    2e-14   
ref|XP_004967473.1|  PREDICTED: probable inactive receptor kinase...  82.8    2e-14   
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...  82.8    2e-14   
ref|XP_008340491.1|  PREDICTED: inactive leucine-rich repeat rece...  82.8    2e-14   
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...  82.4    2e-14   
emb|CDY69287.1|  BnaCnng62860D                                        80.9    2e-14   
gb|EMT10528.1|  Putative inactive receptor kinase                     82.8    2e-14   
ref|XP_004490219.1|  PREDICTED: receptor-like protein kinase 2-like   83.2    2e-14   
gb|KHN05626.1|  Receptor-like protein kinase 2                        82.8    2e-14   
gb|AAY32333.1|  RLK1                                                  82.8    2e-14   
gb|KHG05767.1|  Leucine-rich repeat receptor-like protein kinase ...  83.2    2e-14   
emb|CDP05105.1|  unnamed protein product                              82.4    2e-14   
emb|CDY47625.1|  BnaA01g13400D                                        82.8    2e-14   
ref|XP_006339847.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-14   
ref|XP_004231881.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-14   
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    2e-14   
ref|XP_010091806.1|  Leucine-rich repeat receptor-like protein ki...  83.2    2e-14   
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...  82.4    2e-14   
ref|XP_002991819.1|  hypothetical protein SELMODRAFT_42017            82.4    2e-14   
ref|XP_006283316.1|  hypothetical protein CARUB_v10004355mg           82.4    2e-14   
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...  82.4    3e-14   
ref|XP_002876440.1|  hypothetical protein ARALYDRAFT_486237           82.4    3e-14   
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...  82.4    3e-14   
gb|ABF73316.1|  clavata-like receptor                                 82.8    3e-14   
gb|EPS62971.1|  hypothetical protein M569_11816                       82.4    3e-14   
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...  82.4    3e-14   
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390           82.8    3e-14   
ref|XP_011658521.1|  PREDICTED: receptor-like protein kinase HSL1     82.8    3e-14   
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...  82.4    3e-14   
ref|XP_002518685.1|  Interleukin-1 receptor-associated kinase, pu...  82.4    3e-14   
ref|XP_009103436.1|  PREDICTED: probable LRR receptor-like serine...  82.4    3e-14   
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...  82.4    3e-14   
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg           82.4    3e-14   
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg           82.4    3e-14   
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...  82.4    3e-14   
gb|KFK37686.1|  hypothetical protein AALP_AA3G015500                  82.0    3e-14   
gb|KEH38374.1|  LRR receptor-like kinase                              82.8    3e-14   
ref|XP_009804334.1|  PREDICTED: leucine-rich repeat receptor-like...  82.8    3e-14   
ref|XP_002534272.1|  ATP binding protein, putative                    82.4    3e-14   
ref|XP_009391821.1|  PREDICTED: probable inactive leucine-rich re...  82.4    3e-14   
ref|XP_002882256.1|  hypothetical protein ARALYDRAFT_896266           82.0    3e-14   
gb|EAZ09034.1|  hypothetical protein OsI_31296                        82.0    3e-14   
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    3e-14   
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg              82.0    3e-14   
ref|NP_001169295.1|  uncharacterized LOC100383159 precursor           82.4    3e-14   
ref|XP_010684496.1|  PREDICTED: receptor-like protein kinase HSL1     82.4    3e-14   
gb|AFO11639.1|  At2g26730-like protein                                76.6    3e-14   
ref|XP_004979190.1|  PREDICTED: probable inactive leucine-rich re...  82.4    3e-14   
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...  82.0    3e-14   
ref|XP_010928374.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  82.4    3e-14   
emb|CBI22555.3|  unnamed protein product                              82.0    4e-14   
emb|CBI29890.3|  unnamed protein product                              82.0    4e-14   
emb|CDP13882.1|  unnamed protein product                              82.0    4e-14   
ref|XP_009381155.1|  PREDICTED: probable LRR receptor-like serine...  82.4    4e-14   
ref|XP_001774015.1|  predicted protein                                82.0    4e-14   
gb|EYU40778.1|  hypothetical protein MIMGU_mgv1a019401mg              82.0    4e-14   
ref|XP_004241646.1|  PREDICTED: probable inactive receptor kinase...  82.0    4e-14   
emb|CBI33340.3|  unnamed protein product                              82.4    4e-14   
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...  82.0    4e-14   
ref|XP_004289190.1|  PREDICTED: probable LRR receptor-like serine...  82.0    4e-14   
ref|XP_006365414.1|  PREDICTED: probable inactive receptor kinase...  82.0    4e-14   
ref|NP_001063115.1|  Os09g0400500                                     82.0    4e-14   
emb|CAN79986.1|  hypothetical protein VITISV_039668                   82.4    4e-14   
ref|XP_010427674.1|  PREDICTED: probable inactive leucine-rich re...  82.0    4e-14   
ref|XP_009403261.1|  PREDICTED: probable inactive leucine-rich re...  82.0    4e-14   
ref|XP_009411373.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    4e-14   
gb|EPS74415.1|  hypothetical protein M569_00340                       82.0    4e-14   



>ref|XP_006344171.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Solanum tuberosum]
Length=714

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 120/156 (77%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----------tleSCYQAPESQKALKPSQKWD  634
            NIAG +P L SN M S +       +A           T  SCYQAPE+ K +KPSQKWD
Sbjct  559  NIAGASPTLQSNHMTSDKPQQSKQGSALSESGTVTSTTTSGSCYQAPEALKVVKPSQKWD  618

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            IYSYGVILLEMITGR+PI+ VGSTEMD+VNW+H CI+EKKPLSDVLD YLA+DADKEEEM
Sbjct  619  IYSYGVILLEMITGRTPIIQVGSTEMDLVNWIHWCIEEKKPLSDVLDSYLAQDADKEEEM  678

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMACVHSSPERRPSMRYI +ALERL   +E
Sbjct  679  IAVLKIAMACVHSSPERRPSMRYISDALERLQASSE  714



>ref|XP_007044230.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY00062.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=716

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 125/156 (80%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM-----------astetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P + SNRM           +++  +T   ++  L S YQAPE+ K +KPSQKWD
Sbjct  561  NIAGGSPTMQSNRMPSDKPQERLQKSASSEATAVFSSMNLGSYYQAPEAMKVVKPSQKWD  620

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLEMITGRSP+VHVG+TEMD+VNW+ LCI+EKKPLSDVLDPYLA DADKEEE+
Sbjct  621  VYSYGVILLEMITGRSPVVHVGTTEMDLVNWIQLCIEEKKPLSDVLDPYLAPDADKEEEI  680

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L I MACVHSSPERRP+MR++ +ALERL + T+
Sbjct  681  IAVLKITMACVHSSPERRPTMRHVFDALERLVLSTD  716



>ref|XP_009801886.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana sylvestris]
Length=713

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 12/157 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa------------tleSCYQAPESQKALKPSQKW  637
            NIAG +P L SN MAS +       +A            T  SCYQAPE+ K +KPSQKW
Sbjct  557  NIAGASPTLHSNHMASEKPQQSKQGSAPSEAATTVTSTTTSGSCYQAPEALKVVKPSQKW  616

Query  636  DIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            D+YSYGVILLEMITGR+P++ VGS+EMD+VNW+H CI+EKKPLSDVLDPYLA+DADKEEE
Sbjct  617  DVYSYGVILLEMITGRTPVIQVGSSEMDLVNWIHWCIEEKKPLSDVLDPYLAQDADKEEE  676

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            MIA+L IAMACVHSSPERRPSMR+I + LERLP  ++
Sbjct  677  MIAVLKIAMACVHSSPERRPSMRHISDTLERLPASSD  713



>ref|XP_010066684.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Eucalyptus grandis]
 gb|KCW64657.1| hypothetical protein EUGRSUZ_G02237 [Eucalyptus grandis]
Length=714

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 124/156 (79%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMa-----------stetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L SNRMA           ++   +   ++  L S YQAPE+ K +KPSQKWD
Sbjct  559  NIAGGSPTLQSNRMASEKPQERIQKSTSSEFSTIISSTNLGSYYQAPEALKVIKPSQKWD  618

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YS+GVILLEMITGR PIV VG+ EM++V+W+ LCI+EKKPLSDVLDPYLAEDADKEEE+
Sbjct  619  VYSFGVILLEMITGRYPIVQVGTAEMNVVHWIQLCIEEKKPLSDVLDPYLAEDADKEEEI  678

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMACVHSSPERRP+MR+I +ALERL +PT+
Sbjct  679  IAVLKIAMACVHSSPERRPAMRHISDALERLAIPTD  714



>ref|XP_009630462.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana tomentosiformis]
Length=713

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 12/157 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa------------tleSCYQAPESQKALKPSQKW  637
            NIAG +P L SN MAS +       +A            T  SCYQAPE+ K +KPSQKW
Sbjct  557  NIAGASPTLHSNHMASEKPQQSKQGSAPSEAATTVTSTTTSGSCYQAPEALKVVKPSQKW  616

Query  636  DIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            D+YSYGVILLEMITGR+P++ VGS+EMD+VNW+H CI+EKKPLSDVLDPYLA+DADKEEE
Sbjct  617  DVYSYGVILLEMITGRTPVIQVGSSEMDLVNWIHWCIEEKKPLSDVLDPYLAQDADKEEE  676

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            MIA+L IAMA VHSSPERRPSMR++ +ALERLP  ++
Sbjct  677  MIAVLKIAMASVHSSPERRPSMRHVSDALERLPASSD  713



>gb|KJB31483.1| hypothetical protein B456_005G193500 [Gossypium raimondii]
Length=717

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 123/155 (79%), Gaps = 9/155 (6%)
 Frame = -1

Query  780  NIAGGTPPLXSNR---------MastetstiastaatleSCYQAPESQKALKPSQKWDIY  628
            NIAGG+P   SNR         +  + +S  A   + L S YQAPE+ K +KPSQKWD+Y
Sbjct  560  NIAGGSPTTQSNRIPSDKPLERLQKSASSEAAPLYSNLGSFYQAPEALKVVKPSQKWDVY  619

Query  627  SYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIA  448
            SYGVILLEMITGRSP+VHVG++EMD+VNW+ LCI+EKKPLSDVLDPYLA DADKEEE+IA
Sbjct  620  SYGVILLEMITGRSPVVHVGTSEMDLVNWIQLCIEEKKPLSDVLDPYLAPDADKEEEIIA  679

Query  447  ILNIAMACVHSSPERRPSMRYILEALERLPVPTEH  343
            +L I MACVHSSPERRP+MR++L+AL+RL + T+ 
Sbjct  680  VLKITMACVHSSPERRPTMRHVLDALDRLVLSTDQ  714



>ref|XP_004238893.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Solanum lycopersicum]
Length=715

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 119/156 (76%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----------tleSCYQAPESQKALKPSQKWD  634
            NIAG +P L SN M S +       +A           T  SCYQAPE+ K +KPSQKWD
Sbjct  560  NIAGTSPTLQSNHMTSEKPQQSKQGSAPSESGTVTSTTTSGSCYQAPEALKVVKPSQKWD  619

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            IYSYGVILLEMITGR+PI+ VGSTEMD+VNW+H CI+EKKPLSDVLD  LA+DADKEEEM
Sbjct  620  IYSYGVILLEMITGRTPIIQVGSTEMDLVNWIHWCIEEKKPLSDVLDSCLAQDADKEEEM  679

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMACVHSSPERRPSMR+I +AL+RL   +E
Sbjct  680  IAVLKIAMACVHSSPERRPSMRHISDALDRLQASSE  715



>gb|KDO76897.1| hypothetical protein CISIN_1g005102mg [Citrus sinensis]
Length=714

 Score =   196 bits (498),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 124/156 (79%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM-----------astetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L SNRM           + +   T  ++++ L S YQAPES K +KPSQKWD
Sbjct  559  NIAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLGSYYQAPESLKVVKPSQKWD  618

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            IYSYGVILLEMITGR+ +V VGS+EMD+VNW+ LCI+EKKPL+DVLDPYLA DADKEEE+
Sbjct  619  IYSYGVILLEMITGRTAVVQVGSSEMDLVNWMQLCIEEKKPLADVLDPYLAPDADKEEEI  678

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMACVHSSPE+RP+MR+I +AL+RL V ++
Sbjct  679  IAVLKIAMACVHSSPEKRPTMRHISDALDRLIVSSD  714



>ref|XP_006468755.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Citrus sinensis]
Length=714

 Score =   196 bits (498),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 124/156 (79%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM-----------astetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L SNRM           + +   T  ++++ L S YQAPES K +KPSQKWD
Sbjct  559  NIAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLGSYYQAPESLKVVKPSQKWD  618

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            IYSYGVILLEMITGR+ +V VGS+EMD+VNW+ LCI+EKKPL+DVLDPYLA DADKEEE+
Sbjct  619  IYSYGVILLEMITGRTAVVQVGSSEMDLVNWMQLCIEEKKPLADVLDPYLAPDADKEEEI  678

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMACVHSSPE+RP+MR+I +AL+RL V ++
Sbjct  679  IAVLKIAMACVHSSPEKRPTMRHISDALDRLIVSSD  714



>ref|XP_006448399.1| hypothetical protein CICLE_v10014433mg [Citrus clementina]
 gb|ESR61639.1| hypothetical protein CICLE_v10014433mg [Citrus clementina]
Length=714

 Score =   196 bits (498),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 124/156 (79%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM-----------astetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L SNRM           + +   T  ++++ L S YQAPES K +KPSQKWD
Sbjct  559  NIAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLGSYYQAPESLKVVKPSQKWD  618

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            IYSYGVILLEMITGR+ +V VGS+EMD+VNW+ LCI+EKKPL+DVLDPYLA DADKEEE+
Sbjct  619  IYSYGVILLEMITGRTAVVQVGSSEMDLVNWMQLCIEEKKPLADVLDPYLAPDADKEEEI  678

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMACVHSSPE+RP+MR+I +AL+RL V ++
Sbjct  679  IAVLKIAMACVHSSPEKRPTMRHISDALDRLIVSSD  714



>emb|CDP00668.1| unnamed protein product [Coffea canephora]
Length=698

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 124/156 (79%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L S+RM S                  ++AA++ S YQAPES K +KPSQKWD
Sbjct  543  NIAGGSPTLQSSRMISEKPQQRQQGSAPSEVGTVASAASIGSFYQAPESLKVVKPSQKWD  602

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLEMITG+S +V VG++E+DIV+W+ LCI+EKKPLSDVLDP+LA+DADKEEEM
Sbjct  603  VYSYGVILLEMITGKSTLVQVGTSEIDIVHWMQLCIEEKKPLSDVLDPFLADDADKEEEM  662

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMAC+ +SP+RRPSMR++L+ LERLPV +E
Sbjct  663  IAVLKIAMACIQTSPDRRPSMRHVLDTLERLPVSSE  698



>gb|KHN03071.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=505

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC------YQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+ ++     + +T  +       YQAPE+ K +KPSQKWD+YSYG
Sbjct  355  NIAGGSPTLQSNRVAAEKSQERQRSLSTEVTTSILGNGYQAPETLKVVKPSQKWDVYSYG  414

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLE+ITGR PIV VG++EMD+V W+  CIDEKKPLSDVLD YLAEDADKEEE+IA+L 
Sbjct  415  VILLELITGRLPIVQVGNSEMDLVQWIQCCIDEKKPLSDVLDLYLAEDADKEEEIIAVLK  474

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+ACVHSSPE+RP MR++L+ L+RL +P++
Sbjct  475  IAIACVHSSPEKRPIMRHVLDVLDRLSIPSD  505



>ref|XP_004497046.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Cicer arietinum]
Length=711

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC------YQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+ +      + +T          YQAPE+ K +KPSQKWDIYSYG
Sbjct  561  NIAGGSPTLQSNRVAAEKLQERQKSLSTEVGTNILGDGYQAPEALKVVKPSQKWDIYSYG  620

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLEMITGR PIV VG++EMD+V W+  CI+EKKPLSDVLDPYLAEDADKEEE+IA+L 
Sbjct  621  VILLEMITGRLPIVQVGNSEMDLVQWIQFCIEEKKPLSDVLDPYLAEDADKEEEIIAVLK  680

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACV+SS E+RP+MR++L+AL+RL V ++
Sbjct  681  IAMACVNSSSEKRPTMRHVLDALDRLSVSSD  711



>gb|KEH44189.1| LRR receptor-like kinase [Medicago truncatula]
Length=709

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 120/151 (79%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMas------tetstiastaatleSCYQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+       ++ +       + S YQAPE+ K +KPSQKWD+YSYG
Sbjct  559  NIAGGSPTLQSNRVAAEKLHERQKSLSNEVATNIIGSGYQAPEALKVVKPSQKWDVYSYG  618

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLEM+TGR PIV VG++EMD+V W+  CI+EKKPLSDVLDPYLAEDADKEEEMI +L 
Sbjct  619  VILLEMMTGRLPIVQVGNSEMDLVQWIQFCIEEKKPLSDVLDPYLAEDADKEEEMIGVLK  678

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACV+SS E+RP+MR++L+AL+RL V ++
Sbjct  679  IAMACVNSSTEKRPTMRHVLDALDRLSVSSD  709



>emb|CAN73490.1| hypothetical protein VITISV_040575 [Vitis vinifera]
Length=713

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L S+RM S                  S+ + L S YQAPE+ K +KPSQKWD
Sbjct  558  NIAGGSPTLQSSRMTSEKPPQRQQSNPPSEVGAVSSTSNLGSYYQAPEALKVVKPSQKWD  617

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLEMITGR P+V VGS+EMD+V W+ LCI+EKKPL+DVLDPYLA+DADKEEEM
Sbjct  618  VYSYGVILLEMITGRLPVVQVGSSEMDLVRWIQLCIEEKKPLADVLDPYLAQDADKEEEM  677

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            +A+L IAMACVHSSPERRP+MR++ + L+RL + T+
Sbjct  678  VAVLKIAMACVHSSPERRPAMRHVSDILDRLAMSTD  713



>ref|XP_002282768.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Vitis vinifera]
 emb|CBI26974.3| unnamed protein product [Vitis vinifera]
Length=713

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L S+RM S                  S+ + L S YQAPE+ K +KPSQKWD
Sbjct  558  NIAGGSPTLQSSRMTSEKPPQRQQSNPPSEVGAVSSTSNLGSYYQAPEALKVVKPSQKWD  617

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLEMITGR P+V VGS+EMD+V W+ LCI+EKKPL+DVLDPYLA+DADKEEEM
Sbjct  618  VYSYGVILLEMITGRLPVVQVGSSEMDLVRWIQLCIEEKKPLADVLDPYLAQDADKEEEM  677

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            +A+L IAMACVHSSPERRP+MR++ + L+RL + T+
Sbjct  678  VAVLKIAMACVHSSPERRPAMRHVSDILDRLAMSTD  713



>ref|XP_011076286.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Sesamum indicum]
Length=714

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 122/156 (78%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM-----------astetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L S+RM           +S   +   ++ ++  S Y APES K +KPSQKWD
Sbjct  559  NIAGGSPTLQSSRMVSEKPQRGPQSSSASDAATVASVSSFSSYYHAPESLKVVKPSQKWD  618

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            IYSYGVILLEMITGRSP+V VG++EMD+V W+ LCI+EKKP+SDVLDP LA+DADKEEEM
Sbjct  619  IYSYGVILLEMITGRSPLVQVGNSEMDLVQWMQLCIEEKKPVSDVLDPNLAQDADKEEEM  678

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMAC + SPE+RPSMR++ +ALERLP+P++
Sbjct  679  IAVLKIAMACTNISPEKRPSMRHVSDALERLPLPSD  714



>ref|XP_003555049.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=710

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC------YQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+ ++     + +T  +       YQAPE+ K +KPSQKWD+YSYG
Sbjct  560  NIAGGSPTLQSNRVAAEKSQERQRSLSTEVTTSILGNGYQAPETLKVVKPSQKWDVYSYG  619

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLE+ITGR PIV VG++EMD+V W+  CIDEKKPLSDVLD YLAEDADKEEE+IA+L 
Sbjct  620  VILLELITGRLPIVQVGNSEMDLVQWIQCCIDEKKPLSDVLDLYLAEDADKEEEIIAVLK  679

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+ACVHSSPE+RP MR++L+ L+RL +P++
Sbjct  680  IAIACVHSSPEKRPIMRHVLDVLDRLSIPSD  710



>ref|XP_004299037.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Fragaria vesca subsp. vesca]
Length=714

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 12/156 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM------------astetstiastaatleSCYQAPESQKALKPSQKW  637
            NIAGGTP L SNRM            +++  S +  +++ L SCYQAPE+ K +KPSQKW
Sbjct  558  NIAGGTPTLESNRMGTIDKPQERHQKSASTESAVVCSSSNLGSCYQAPEALKVVKPSQKW  617

Query  636  DIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            D+YSYGVILLEMITGR PIV VGS+EMD+V+W+ LCID+KKPL DVLDP+L +D + EEE
Sbjct  618  DVYSYGVILLEMITGRLPIVQVGSSEMDLVHWIQLCIDDKKPLLDVLDPHLMQDVEMEEE  677

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
            +IA+L IAMACVHSSPERRP MR++ EAL+RL  P 
Sbjct  678  IIAVLKIAMACVHSSPERRPIMRHVSEALDRLATPA  713



>ref|XP_008243284.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Prunus mume]
Length=715

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 11/151 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatl-----------eSCYQAPESQKALKPSQKWD  634
            NIAGG+P L SNRMA+ ++      +A+             SCYQAPE+ K +KPSQKWD
Sbjct  560  NIAGGSPTLQSNRMATEKSQERQQKSASTEATVISPSSNLGSCYQAPEALKVVKPSQKWD  619

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLEMITGR PIV VGS+EMD+V+W+ +CIDEKKPL DVLDP L +D DKEEE+
Sbjct  620  VYSYGVILLEMITGRLPIVQVGSSEMDLVHWIQVCIDEKKPLLDVLDPNLMQDVDKEEEI  679

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERL  361
            IA+L IAMACVHSSPERRP MR+I +AL+RL
Sbjct  680  IAVLKIAMACVHSSPERRPIMRHISDALDRL  710



>ref|XP_010101692.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB89356.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=204

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 121/153 (79%), Gaps = 11/153 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMa-----------stetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAG +P L S+RMA           +T  +T  +++ TL SCY APE+ K +KPSQKWD
Sbjct  49   NIAGASPTLQSSRMASEKPQERQQKSTTSDTTTVASSTTLGSCYIAPEALKVVKPSQKWD  108

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLE+ITGR P+V VGS+EMD+V+W+ LCI+EKKPLS+VLDPYL +D D+++E+
Sbjct  109  VYSYGVILLEIITGRMPVVLVGSSEMDLVHWIQLCIEEKKPLSEVLDPYLVQDGDRDDEI  168

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            IA++ IAMAC+ +SPE+RP+MR++ EALERL +
Sbjct  169  IAVIKIAMACIQTSPEKRPTMRHVSEALERLAI  201



>ref|XP_002526283.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF36072.1| ATP binding protein, putative [Ricinus communis]
Length=715

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 119/156 (76%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L SNR+               +     +A ++ S YQAPE+ K +KPSQKWD
Sbjct  560  NIAGGSPTLQSNRITVEKPHEKQQKSAPSSEVAMVSATSMGSYYQAPEALKVVKPSQKWD  619

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLEMITGRSP+VHVG++EMD+V W+ LCI+E+KPL+DVLDPYLA D DKEEE+
Sbjct  620  VYSYGVILLEMITGRSPLVHVGTSEMDLVQWIQLCIEEQKPLADVLDPYLAPDVDKEEEI  679

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L IAMACVH+S ERRP+MR++ + L RL +P++
Sbjct  680  IAVLKIAMACVHNSSERRPTMRHVSDVLSRLVIPSD  715



>ref|XP_007142963.1| hypothetical protein PHAVU_007G032100g [Phaseolus vulgaris]
 gb|ESW14957.1| hypothetical protein PHAVU_007G032100g [Phaseolus vulgaris]
Length=713

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 120/151 (79%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMas------tetstiastaatleSCYQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+       ++ +   T   L + Y APE+ K +KPSQKWD+YSYG
Sbjct  563  NIAGGSPTLQSNRVAAEKQHGRQKSISTEVTTNVLGNGYMAPEALKVVKPSQKWDVYSYG  622

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLEMITG+S IV VG++EMD+V W+  CI+EKKPL +VLDPYLAEDADKEEE+I +L 
Sbjct  623  VILLEMITGKSSIVQVGNSEMDLVQWIQFCIEEKKPLLEVLDPYLAEDADKEEEIIGVLK  682

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACVHSSPE+RP+MR++L+AL+RL + ++
Sbjct  683  IAMACVHSSPEKRPTMRHVLDALDRLTISSD  713



>ref|XP_011038748.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Populus euphratica]
Length=716

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 11/155 (7%)
 Frame = -1

Query  777  IAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWDI  631
            IAGG+P L SNR+AS             +     ++  L S YQAPE+ K LKPSQKWD+
Sbjct  562  IAGGSPTLESNRIASEKLQERQQKGAPSSEVATVSSTNLGSYYQAPEALKVLKPSQKWDV  621

Query  630  YSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMI  451
            YSYGVILLEMITGRSP+VHVG+TEM +V+W+ LCI+E+KPL+DVLDPYLA D DKEEE+I
Sbjct  622  YSYGVILLEMITGRSPMVHVGTTEMHLVHWIQLCIEEQKPLADVLDPYLAPDVDKEEEII  681

Query  450  AILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            A+L IAMACVHSSPERRP+MR++ +   RL + ++
Sbjct  682  AVLKIAMACVHSSPERRPTMRHVSDVFNRLAMSSD  716



>ref|XP_003555253.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=710

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC------YQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+ +      + +T  +       Y APE+ K +KPSQKWD+YSYG
Sbjct  560  NIAGGSPTLQSNRVAAEQLQGRQKSISTEVTTNVLGNGYMAPEALKVVKPSQKWDVYSYG  619

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLEMITGRS IV VG++E+D+V W+ LCI+EKKP+ +VLDPYL EDADKEEE+I +L 
Sbjct  620  VILLEMITGRSSIVLVGNSEIDLVQWIQLCIEEKKPVLEVLDPYLGEDADKEEEIIGVLK  679

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACVHSSPE+RP+MR++L+AL+RL + ++
Sbjct  680  IAMACVHSSPEKRPTMRHVLDALDRLSISSD  710



>gb|KHN42429.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=667

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC------YQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+ +      + +T  +       Y APE+ K +KPSQKWD+YSYG
Sbjct  517  NIAGGSPTLQSNRVAAEQLQGRQKSISTEVTTNVLGNGYMAPEALKVVKPSQKWDVYSYG  576

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLEMITGRS IV VG++E+D+V W+ LCI+EKKP+ +VLDPYL EDADKEEE+I +L 
Sbjct  577  VILLEMITGRSSIVLVGNSEIDLVQWIQLCIEEKKPVLEVLDPYLGEDADKEEEIIGVLK  636

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACVHSSPE+RP+MR++L+AL+RL + ++
Sbjct  637  IAMACVHSSPEKRPTMRHVLDALDRLSISSD  667



>gb|KHN06695.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=668

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 121/151 (80%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMas------tetstiastaatleSCYQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+       ++ +   T+  L + Y APE+ K +KPSQKWD+YSYG
Sbjct  518  NIAGGSPTLQSNRVAAEKLQGRQKSLSNEVTSNVLGNGYMAPEAMKVVKPSQKWDVYSYG  577

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLE+ITGRS IV VG++EMD+V W+ LCI+EKKPL +VLDPYL EDAD+EEE+I +L 
Sbjct  578  VILLEIITGRSSIVLVGNSEMDLVQWIQLCIEEKKPLLEVLDPYLGEDADREEEIIGVLK  637

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACVHSSPE+RP+MR++L+AL++L + ++
Sbjct  638  IAMACVHSSPEKRPTMRHVLDALDKLTISSD  668



>ref|XP_003536668.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=712

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 118/151 (78%), Gaps = 6/151 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC------YQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+ +      + +   +       Y APE+ K +KPSQKWD+YSYG
Sbjct  562  NIAGGSPTLQSNRVAAEKLQGRQKSLSNEVTSNVLGNGYMAPEAMKVVKPSQKWDVYSYG  621

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLE+ITGRS IV VG++EMD+V W+ LCI+EKKPL +VLDPYL EDAD+EEE+I +L 
Sbjct  622  VILLEIITGRSSIVLVGNSEMDLVQWIQLCIEEKKPLLEVLDPYLGEDADREEEIIGVLK  681

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACVHSSPE+RP+MR++L+AL++L + ++
Sbjct  682  IAMACVHSSPEKRPTMRHVLDALDKLTISSD  712



>ref|XP_010279368.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nelumbo nucifera]
Length=711

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 8/148 (5%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastets--------tiastaatleSCYQAPESQKALKPSQKWDIYS  625
            NIAGG+P L SNRM S +             S      S YQAPE+ K++KPSQKWD YS
Sbjct  559  NIAGGSPTLQSNRMTSEKQQQQETPFEVASVSPTMNSASFYQAPEAPKSVKPSQKWDAYS  618

Query  624  YGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAI  445
            YGVILLEMI+GRSPIV VG+TEMD+V W+ LCI+EKKPLSDV+DP++A +++KEEEM+A+
Sbjct  619  YGVILLEMISGRSPIVQVGTTEMDLVRWIQLCIEEKKPLSDVVDPFMARESEKEEEMVAM  678

Query  444  LNIAMACVHSSPERRPSMRYILEALERL  361
            L IA+ACV ++PE+RPSMR+I +AL+RL
Sbjct  679  LKIALACVQANPEKRPSMRHICDALDRL  706



>ref|XP_008339638.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=715

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 113/152 (74%), Gaps = 12/152 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaat------------leSCYQAPESQKALKPSQKW  637
            NIAGG+P L SNR+ + ++      +A             L SCYQAPES K +KPSQKW
Sbjct  559  NIAGGSPTLQSNRIPTEKSQERQQKSAAPSEVSVVSSSSNLGSCYQAPESLKVVKPSQKW  618

Query  636  DIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            D+YSYGVILLEMITGR PIV VGS+EMD+V W+ L I+EKKPL DVLDP L  D DKEEE
Sbjct  619  DVYSYGVILLEMITGRLPIVQVGSSEMDLVQWIQLNIEEKKPLLDVLDPNLMHDVDKEEE  678

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +IA+L IAMACVHSSPERRP MR+I +AL+RL
Sbjct  679  IIAVLKIAMACVHSSPERRPIMRHISDALDRL  710



>ref|XP_010695919.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Beta vulgaris subsp. vulgaris]
Length=706

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 117/151 (77%), Gaps = 10/151 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastet----------stiastaatleSCYQAPESQKALKPSQKWDI  631
            NIAGG+P L S+RM S +T             + +A    S YQAPES KA+KPSQKWD+
Sbjct  552  NIAGGSPTLQSSRMTSEKTPQKQAGSAPSEAGSFSAMNAISYYQAPESLKAVKPSQKWDV  611

Query  630  YSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMI  451
            YSYGVILLEMITGRS +V VG++EMD+V W+   IDEKKPL DVLDP LA++ADKE+E+I
Sbjct  612  YSYGVILLEMITGRSALVQVGTSEMDLVQWIQHSIDEKKPLIDVLDPSLAQEADKEDEII  671

Query  450  AILNIAMACVHSSPERRPSMRYILEALERLP  358
            A+L IAMACVHSSPE+RP+MR++ +AL+RLP
Sbjct  672  AVLKIAMACVHSSPEKRPTMRHVYDALDRLP  702



>ref|XP_010262185.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nelumbo nucifera]
Length=713

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 112/149 (75%), Gaps = 9/149 (6%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMa---------stetstiastaatleSCYQAPESQKALKPSQKWDIY  628
            NIAGG+P L SNRM          ++      S      SCYQAPE+ K++KPSQKWD+Y
Sbjct  560  NIAGGSPTLQSNRMTSEKPYQQQNASSEVASVSPTMNSASCYQAPEAPKSVKPSQKWDVY  619

Query  627  SYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIA  448
            SYGVILLEMI+GR P+V VG+TEMD+V W+ LCI+EKKPL DV+DP+ A ++DKEEEM+ 
Sbjct  620  SYGVILLEMISGRPPVVQVGTTEMDLVGWIQLCIEEKKPLWDVVDPFFARESDKEEEMVG  679

Query  447  ILNIAMACVHSSPERRPSMRYILEALERL  361
            +L IA+ACV ++PE+RPSMR++ +AL RL
Sbjct  680  VLKIALACVQTNPEKRPSMRHVCDALYRL  708



>ref|XP_002315920.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF02091.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=716

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 117/155 (75%), Gaps = 11/155 (7%)
 Frame = -1

Query  777  IAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWDI  631
            IAGG+P L SNR+AS             +     ++  L S YQAPE+ K LKPSQKWD+
Sbjct  562  IAGGSPTLESNRIASEKPQERQQKGAPSSEVATVSSTNLGSYYQAPEALKVLKPSQKWDV  621

Query  630  YSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMI  451
            YSYGVILLEMITGRS +VHVG++EM +V+W+ LCI+E+KPL+DVLDPYLA D DKEEE+I
Sbjct  622  YSYGVILLEMITGRSSMVHVGTSEMYLVHWIQLCIEEQKPLADVLDPYLAPDVDKEEEII  681

Query  450  AILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            A+L IAMACVHSSPERRP+MR++ +   RL + ++
Sbjct  682  AVLKIAMACVHSSPERRPTMRHVSDVFNRLAMSSD  716



>ref|XP_008467183.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=716

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 118/152 (78%), Gaps = 12/152 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMa-----------stetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGGTP L S+R+A           +  +  I S+++   +CYQAPES K LKPSQKWD
Sbjct  557  NIAGGTPTLQSSRVASEKPLDPKQPKTVTSEIICSSSSNTGTCYQAPESLKVLKPSQKWD  616

Query  633  IYSYGVILLEMITGRSPIVHVGST-EMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            +YSYGVILLEMITGR P++ V S+ EMD+V+W+ LCI+E+KPLS+V+DPYL +DADKEEE
Sbjct  617  VYSYGVILLEMITGRFPLIQVSSSSEMDLVHWIQLCIEEQKPLSEVIDPYLVQDADKEEE  676

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERL  361
             I+IL IAM+C H SPERRP+MR++ +A+ERL
Sbjct  677  FISILKIAMSCAHGSPERRPTMRHVSDAIERL  708



>ref|XP_008389257.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=716

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 117/152 (77%), Gaps = 12/152 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM------------astetstiastaatleSCYQAPESQKALKPSQKW  637
            NIAGG+P L SNR+            A    +++ S+++ L SCYQAPE+ K +KPSQKW
Sbjct  560  NIAGGSPTLQSNRIPTEISQERQQTSAVPTEASLVSSSSNLGSCYQAPEALKVVKPSQKW  619

Query  636  DIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            D+YSYGVILLEMITGR PIV VGS EMD+V+W+ L I+EKKPL DVLDP L +D DKEEE
Sbjct  620  DVYSYGVILLEMITGRLPIVQVGSAEMDLVHWIQLNIEEKKPLLDVLDPNLMQDVDKEEE  679

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +IA+L IAMACVHSSPERRP MR+I +AL+RL
Sbjct  680  IIAVLKIAMACVHSSPERRPIMRHISDALDRL  711



>ref|XP_004147142.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis sativus]
 gb|KGN51534.1| hypothetical protein Csa_5G576760 [Cucumis sativus]
Length=717

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 119/152 (78%), Gaps = 12/152 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMa-----------stetstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGGTP L S+RMA           +  +  I S+++   +CYQAPES K LKPSQKWD
Sbjct  557  NIAGGTPTLQSSRMASEKPLDPKQPKTVTSEIICSSSSNTGTCYQAPESLKVLKPSQKWD  616

Query  633  IYSYGVILLEMITGRSPIVHVGST-EMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            +YSYG+ILLEMITGR P++ V S+ EMD+V+W+ LCI+E+KPLS+V+DP+L +DADKEEE
Sbjct  617  VYSYGMILLEMITGRFPLIQVSSSSEMDLVHWIQLCIEEQKPLSEVIDPHLIQDADKEEE  676

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERL  361
             I+IL IAM+CVH SPERRP+MR++ +A+ERL
Sbjct  677  FISILKIAMSCVHGSPERRPTMRHVSDAIERL  708



>ref|XP_009357243.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=715

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 12/152 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM------------astetstiastaatleSCYQAPESQKALKPSQKW  637
            NIAGG+P L SNR+            A+   +++ S ++ L SCYQAPES K +KPSQKW
Sbjct  559  NIAGGSPTLQSNRIPTEKSQERQHKSAAPTEASVVSLSSNLGSCYQAPESLKVVKPSQKW  618

Query  636  DIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            D+YSYGVILLEMITGR PIV VGS+EMD+V W  L I+EKKPL DVLDP L  D DKE+E
Sbjct  619  DVYSYGVILLEMITGRLPIVQVGSSEMDLVQWTQLNIEEKKPLLDVLDPNLMHDVDKEDE  678

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +IA+L IAMACVHSSPERRP MR+I +AL+RL
Sbjct  679  IIAVLKIAMACVHSSPERRPIMRHISDALDRL  710



>gb|EPS65629.1| hypothetical protein M569_09144 [Genlisea aurea]
Length=719

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 118/158 (75%), Gaps = 13/158 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetst-------------iastaatleSCYQAPESQKALKPSQK  640
            NIA GTP L S+R+AS                    S+ ++   CYQAPE+ K+LKPS+K
Sbjct  560  NIAVGTPTLQSSRIASERGQQEQHSIGTASDLGITFSSTSSHSYCYQAPEALKSLKPSKK  619

Query  639  WDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEE  460
            WD++SYG+ILLEMITG+SP V VG+TEM++V+W+HLCI+EKKP+ DVLDP LA D D+EE
Sbjct  620  WDVFSYGMILLEMITGKSPSVQVGNTEMNLVSWMHLCIEEKKPVCDVLDPNLARDGDREE  679

Query  459  EMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            EMI +L IAMAC  +SPE+RPSMR +L+AL+++P+P +
Sbjct  680  EMIGVLKIAMACTQTSPEKRPSMRSVLDALDKIPLPLD  717



>ref|XP_012075725.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Jatropha curcas]
 gb|KDP35025.1| hypothetical protein JCGZ_09313 [Jatropha curcas]
Length=715

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 116/156 (74%), Gaps = 11/156 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAG +P L S R+A+             +     ++  L S YQAPE+ K +KPSQKWD
Sbjct  560  NIAGASPTLQSTRIAAEKPQERQQKSGPSSEVATVSSTNLVSYYQAPEALKVVKPSQKWD  619

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGV+LLEMITGRSP+VHV + EMD+V W+ LCI+E+KPL+DVLDPYLA D DKEEE+
Sbjct  620  VYSYGVMLLEMITGRSPVVHVDTLEMDLVQWIQLCIEEQKPLADVLDPYLAPDVDKEEEI  679

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IA+L +AMACVHS PERRP+MR++ +AL RL V ++
Sbjct  680  IAVLKVAMACVHSCPERRPTMRHVSDALSRLVVSSD  715



>ref|XP_009356227.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=716

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 115/152 (76%), Gaps = 12/152 (8%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM------------astetstiastaatleSCYQAPESQKALKPSQKW  637
            NIAGG+P L SNR+            A    +++ S++  L SCYQAPE+ K +KPSQK 
Sbjct  560  NIAGGSPTLQSNRIPTEISQERQQTSAVPTEASLVSSSGNLGSCYQAPEALKMVKPSQKS  619

Query  636  DIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEE  457
            D+YSYGVILLEMITGR PIV VGS+EM +V+W+ L I+EKKPL DVLDP L +D DKEEE
Sbjct  620  DVYSYGVILLEMITGRLPIVQVGSSEMALVHWIQLNIEEKKPLLDVLDPNLMQDVDKEEE  679

Query  456  MIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +IA+L IAMACVHSSPERRP MR+I +AL+RL
Sbjct  680  IIAVLKIAMACVHSSPERRPIMRHISDALDRL  711



>ref|XP_008446637.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=717

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 9/151 (6%)
 Frame = -1

Query  780  NIAGGTPPLXSN---------RMastetstiastaatleSCYQAPESQKALKPSQKWDIY  628
            NIAGG+P + S+         +   + TS  ++ ++++ + YQAPE+ K +KPSQKWD+Y
Sbjct  564  NIAGGSPTVQSSHIAEEKSQEKQLKSATSEASTFSSSMSTYYQAPEALKVVKPSQKWDVY  623

Query  627  SYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIA  448
            SYGVILLEMITGR PIV VG++EMD+V W+ LCI+EKKPLSDV+DP LA D D +EE+IA
Sbjct  624  SYGVILLEMITGRLPIVQVGASEMDLVQWIQLCIEEKKPLSDVIDPSLAPDDDADEEIIA  683

Query  447  ILNIAMACVHSSPERRPSMRYILEALERLPV  355
            +L IA+ACV +SPERRP+MR++ +AL +L V
Sbjct  684  VLKIALACVQNSPERRPAMRHVCDALSKLAV  714



>ref|XP_011070766.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Sesamum indicum]
Length=706

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 109/151 (72%), Gaps = 11/151 (7%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC-----------YQAPESQKALKPSQKWD  634
            NI GG+P + S RM S +      ++   E+            YQAPE+ K  KPSQKWD
Sbjct  551  NITGGSPTVQSGRMVSEKPQQWQQSSTASEAAMFSPVVSFSPNYQAPEALKVAKPSQKWD  610

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYG+ILLEMITGR P+V VG++EMD+V W+   I EKKPL++VLDPYL +DADKEEEM
Sbjct  611  VYSYGIILLEMITGRMPLVQVGNSEMDLVQWMQQRIKEKKPLANVLDPYLVQDADKEEEM  670

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERL  361
            IA+LNIAMAC  SSP+ RPSMR++ +ALER+
Sbjct  671  IAVLNIAMACTQSSPDARPSMRHVSDALERV  701



>ref|XP_011655791.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis sativus]
 gb|KGN52108.1| hypothetical protein Csa_5G610420 [Cucumis sativus]
Length=718

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 116/151 (77%), Gaps = 9/151 (6%)
 Frame = -1

Query  780  NIAGGTPPLXSN---------RMastetstiastaatleSCYQAPESQKALKPSQKWDIY  628
            NIAGG+P + S+         +   + TS  ++ ++++ + YQAPE+ K +KPSQKWD+Y
Sbjct  565  NIAGGSPTVQSSHIAEEKSQEKQLKSATSEASTFSSSMSTYYQAPEALKVVKPSQKWDVY  624

Query  627  SYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIA  448
            SYGVILLEMITGR PIV VG++EMD+V W+ LCI+EKKPLSDV+DP LA D D +EE+IA
Sbjct  625  SYGVILLEMITGRLPIVQVGTSEMDLVQWIQLCIEEKKPLSDVIDPSLAPDDDADEEIIA  684

Query  447  ILNIAMACVHSSPERRPSMRYILEALERLPV  355
            +L IA+ACV ++PERRP+MR++ +AL +L V
Sbjct  685  VLKIALACVQNNPERRPAMRHVCDALGKLAV  715



>dbj|BAJ89657.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=701

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 109/146 (75%), Gaps = 6/146 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastet------stiastaatleSCYQAPESQKALKPSQKWDIYSYG  619
            NIAGG P   S+R+   +       S+++   +   SCYQAPE+ K LKPSQKWD+YSYG
Sbjct  550  NIAGGAPSSQSDRIGVEKAQSLLPDSSLSPLVSKEGSCYQAPEALKTLKPSQKWDVYSYG  609

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLEMITGRSP+  + + +MD+V W+  CI+EKKP +DVLDP+LA D+++E EMIA+L 
Sbjct  610  VILLEMITGRSPVALLETMQMDLVQWVRFCIEEKKPSADVLDPFLARDSEQEGEMIAVLK  669

Query  438  IAMACVHSSPERRPSMRYILEALERL  361
            +A+ACVH++PERRP MR + E LERL
Sbjct  670  VALACVHANPERRPPMRNVAETLERL  695



>ref|XP_002311473.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE88840.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=724

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 12/155 (8%)
 Frame = -1

Query  777  IAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWDI  631
            IAGG+P   SNR                +     ++  L S YQAPE+ K LKPSQKWD+
Sbjct  569  IAGGSPTRESNRSTLEKPQERQQKGEPSSEVATVSSTNLVSYYQAPEALKVLKPSQKWDV  628

Query  630  YSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADK-EEEM  454
            YS GVILLEMITGRSP+V VG++EMD+V+W+ LCI+E+KPL DVLDPYLA D DK EEE+
Sbjct  629  YSCGVILLEMITGRSPVVCVGTSEMDLVHWIQLCIEEQKPLVDVLDPYLAPDVDKEEEEI  688

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
            +A+L IAMACVHS+PERRP+MR++ +   RL + +
Sbjct  689  VAVLKIAMACVHSNPERRPTMRHVSDVFNRLVISS  723



>gb|KFK33342.1| hypothetical protein AALP_AA5G001600 [Arabis alpina]
Length=708

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 118/155 (76%), Gaps = 10/155 (6%)
 Frame = -1

Query  780  NIAGGTPP-LXSNRMast---------etstiastaatleSCYQAPESQKALKPSQKWDI  631
            NIAGG+ P L SNR   T           S+  +  ++  S YQAPE+ K +KPSQKWD+
Sbjct  554  NIAGGSSPTLQSNRKIQTEEKQQHHHKSVSSEFTAHSSSGSYYQAPETLKMVKPSQKWDV  613

Query  630  YSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMI  451
            YSYGVILLE+I GRSP++ VG++E+D+V W+ LCI+EKKP+ DVLDP LA +ADKE+E++
Sbjct  614  YSYGVILLELIAGRSPVLEVGTSEIDLVRWIQLCIEEKKPMCDVLDPCLAPEADKEDEIV  673

Query  450  AILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            A+L IA++CV+SSPE+RP+MR++ + L+RLPV ++
Sbjct  674  AVLKIAISCVNSSPEKRPTMRHVSDTLDRLPVASD  708



>ref|XP_004968837.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Setaria italica]
Length=709

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 111/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----tleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAG +P   S+R+   +  +  S A+     +  SCYQAPE+ K LKPSQKWD+YSYGV
Sbjct  561  NIAGASPITQSDRVGLEKAQSQQSDASVSPLMSKGSCYQAPEALKTLKPSQKWDVYSYGV  620

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            +LLEMITGRSP V + + +MD+V W+  CI++KKP +DVLDP+LA D+++E+EMIA+L +
Sbjct  621  VLLEMITGRSPAVLLETMQMDLVQWVQFCIEDKKPSADVLDPFLARDSEREDEMIAVLKV  680

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PERRPSMR++ E L+RL
Sbjct  681  ALACVQANPERRPSMRHVAETLDRL  705



>ref|XP_011022504.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Populus euphratica]
Length=724

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 109/151 (72%), Gaps = 12/151 (8%)
 Frame = -1

Query  777  IAGGTPPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQKWDI  631
            IAGG+P   SNR                +     ++  L S YQAPE+ K LKPSQKWD+
Sbjct  569  IAGGSPTRESNRSTLEKPQERQQKGEPSSEVATVSSTNLVSYYQAPEALKVLKPSQKWDV  628

Query  630  YSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADK-EEEM  454
            YS GVILLEMITGRSP+V VG++EMD+V+W+ LCI+E+KPL DVLDPYLA D DK EEE+
Sbjct  629  YSCGVILLEMITGRSPVVCVGTSEMDLVHWIQLCIEEQKPLVDVLDPYLAPDVDKEEEEI  688

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERL  361
            +A+L IA+ACVHS+PERRP+MR++ +   RL
Sbjct  689  VAVLKIAIACVHSNPERRPTMRHVSDVFNRL  719



>ref|XP_006645941.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like, partial [Oryza brachyantha]
Length=524

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSN-----RMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P   S+     +  S ++    S   +   CYQAPE+ K LKPSQKWD+YSYGV
Sbjct  376  NIAGGSPFTQSDHAGIEKAQSQQSDASVSPLVSKGQCYQAPEALKTLKPSQKWDVYSYGV  435

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLEMI+GRSP+V + + +MD+V W+  CI+EKKP +DVLDP LA D+++E+EMIA L +
Sbjct  436  ILLEMISGRSPVVLLETMQMDLVQWVQFCIEEKKPSADVLDPSLARDSEREDEMIAALKV  495

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PERRPSMR++ E L+RL
Sbjct  496  ALACVQANPERRPSMRHVAETLDRL  520



>ref|XP_010922469.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=712

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 112/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatl-----eSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P L S+R+A+ +T    S   +       SCY APE+ K LKPSQKWD+YSYGV
Sbjct  562  NIAGGSPLLQSDRIAAEKTPNQQSDVTSSPFLTRGSCYHAPEALKTLKPSQKWDVYSYGV  621

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLEMI+GRSP+V + + EMD+V W+  CI+EKKPL DVLDP LA + D+E+E+IA+L I
Sbjct  622  ILLEMISGRSPLVLLETLEMDLVRWVQFCIEEKKPLLDVLDPSLAREIDREDEIIALLKI  681

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PE+RPSMR++++AL+R 
Sbjct  682  ALACVQANPEKRPSMRHVVDALDRF  706



>ref|XP_002457921.1| hypothetical protein SORBIDRAFT_03g021850 [Sorghum bicolor]
 gb|EES03041.1| hypothetical protein SORBIDRAFT_03g021850 [Sorghum bicolor]
Length=712

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 112/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----tleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAG +P + S+R+   +  +  S A+     +  SCYQAPE+ K LKPSQKWD+YSYGV
Sbjct  564  NIAGASPFVQSDRVGLEKEQSQQSDASVSPLMSKGSCYQAPEALKTLKPSQKWDVYSYGV  623

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            +LLEMITGRSP + + + +MD+V W+  CI++KKP +DVLDP+LA+D+++E+EMI +L +
Sbjct  624  VLLEMITGRSPSILLETMQMDLVQWVQFCIEDKKPSADVLDPFLAQDSEQEDEMITVLKV  683

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PERRPSMR++ E LERL
Sbjct  684  ALACVQANPERRPSMRHVAETLERL  708



>ref|XP_008674174.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Zea mays]
 tpg|DAA54864.1| TPA: putative leucine-rich repat protein kinase family protein 
[Zea mays]
Length=709

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 109/145 (75%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM-----astetstiastaatleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAG +P L S+++        +     S   +  SCYQAPE+ K LKPSQKWD+YSYGV
Sbjct  563  NIAGASPFLQSDQVELEKEQIQQIDASVSPLMSKGSCYQAPEALKTLKPSQKWDVYSYGV  622

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            +LLEMITGRSP V + + +MD+V W+  CI++KKP +DVLDP+LA+D+++E EMIA+L +
Sbjct  623  VLLEMITGRSPSVLLETMQMDLVQWVQFCIEDKKPSADVLDPFLAQDSEQEGEMIAVLKV  682

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PERRPSMR++ E LERL
Sbjct  683  ALACVQANPERRPSMRHVAETLERL  707



>ref|XP_008810049.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Phoenix dactylifera]
Length=712

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 113/145 (78%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----tleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P L S+R+++ ++ +  S        T  SCY APE+ K LKPSQKWD+YS+GV
Sbjct  562  NIAGGSPLLQSDRISAEKSQSQRSDVTVSPSVTKGSCYHAPEALKTLKPSQKWDVYSHGV  621

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLEMI+GRSP+V + + EMD+V W+  CI+EKKPL DVLDP+LA + D+E+E+IA+L I
Sbjct  622  ILLEMISGRSPLVLLETLEMDLVRWVQFCIEEKKPLLDVLDPFLARELDREDEIIAVLKI  681

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PE+RPSMR++++ L+R 
Sbjct  682  ALACVQANPEKRPSMRHVVDTLDRF  706



>gb|EMT20661.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=672

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CYQAPE+ K LKPSQKWD+YSYGVILLEMITGRSP+  + + +MD+V W+  CI +KKP 
Sbjct  558  CYQAPEALKTLKPSQKWDVYSYGVILLEMITGRSPVALLETMQMDLVQWVQFCIQDKKPS  617

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +DVLDP+LA D+++E EMIA+L +A+ACVH++PERRP+MR + E LERL
Sbjct  618  ADVLDPFLARDSEQEGEMIAVLKVALACVHANPERRPTMRNVTETLERL  666



>ref|XP_006398506.1| hypothetical protein EUTSA_v10000800mg [Eutrema salsugineum]
 gb|ESQ39959.1| hypothetical protein EUTSA_v10000800mg [Eutrema salsugineum]
Length=714

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 115/152 (76%), Gaps = 10/152 (7%)
 Frame = -1

Query  780  NIAGGTPP-LXSNRMast---------etstiastaatleSCYQAPESQKALKPSQKWDI  631
            NIAGG+ P + SNR+  T           S+  +  ++  S YQAPE+ K +KPSQKWD+
Sbjct  560  NIAGGSSPTIQSNRIIQTEERQQHHHKSVSSEFTAHSSSGSYYQAPETLKMVKPSQKWDV  619

Query  630  YSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMI  451
            YSYGVILLE+I GRSP+V VG+ EMD+V W+ +CI+EKKPL DVLDP LA +ADKE+E++
Sbjct  620  YSYGVILLELIAGRSPVVEVGTLEMDLVRWVQVCIEEKKPLCDVLDPCLAPEADKEDEIV  679

Query  450  AILNIAMACVHSSPERRPSMRYILEALERLPV  355
            A+L IA++CV+SSPE+RP+MR++ + L+RL V
Sbjct  680  AVLKIAISCVNSSPEKRPTMRHVSDTLDRLSV  711



>ref|XP_002876736.1| hypothetical protein ARALYDRAFT_484030 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52995.1| hypothetical protein ARALYDRAFT_484030 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K +KPSQKWD+YSYG+ILLE+I GRSP V VG++EMD+V W+ +CI+EKKPL 
Sbjct  604  YQAPETLKMVKPSQKWDVYSYGIILLELIAGRSPAVEVGTSEMDLVRWVQVCIEEKKPLC  663

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            DVLDP LA +ADKE+E++A+L IA++CV+SSPE+RP+MR++ + L+RLPV
Sbjct  664  DVLDPCLAPEADKEDEIVAVLKIAISCVNSSPEKRPTMRHVSDTLDRLPV  713



>ref|XP_009418392.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=714

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 111/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----tleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P L S+R+A  +     S  A     +  S YQAPE+   LKPSQKWD+YS+GV
Sbjct  566  NIAGGSPFLQSDRIAVEKIQGQHSDVAFGPIMSKGSGYQAPEASMMLKPSQKWDVYSFGV  625

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLE+I+ RSP+V + + EMD+V+W HLCI+EKKPLSDVLDP+LA++ D E+E+IA+L I
Sbjct  626  ILLELISSRSPLVLLDTVEMDLVSWFHLCIEEKKPLSDVLDPFLAQELDTEDEIIAVLKI  685

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ CV ++PE+RPSMR++ + LERL
Sbjct  686  ALVCVQANPEKRPSMRHVTDTLERL  710



>ref|XP_010108889.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC20529.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=706

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y+APE+  A KPSQKWD+YS+GVI+LEMI+G+ P++ VGS EMDIV W HL I+E KPL 
Sbjct  598  YKAPEASSARKPSQKWDVYSFGVIMLEMISGKFPLIQVGSVEMDIVRWFHLSIEEGKPLL  657

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            DVLDP+LA D D ++E+IA+LN+A+ACVH SPE+RPSMRY+ E L RL
Sbjct  658  DVLDPFLAHDLDMQDEIIAVLNVALACVHKSPEKRPSMRYVCEVLARL  705



>ref|NP_001043190.1| Os01g0514700 [Oryza sativa Japonica Group]
 dbj|BAB92230.1| CLV1 receptor kinase-like protein [Oryza sativa Japonica Group]
 dbj|BAF05104.1| Os01g0514700 [Oryza sativa Japonica Group]
Length=705

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 107/145 (74%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSN-----RMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P   S+     +  S ++    S      SCYQAPE+ K LKPSQKWD+YSYGV
Sbjct  557  NIAGGSPFTQSDHAGIEKAQSQQSDASVSPLVGKGSCYQAPEALKTLKPSQKWDVYSYGV  616

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLEMITGRSP+V + + +MD+V W+  CI+EKKP +DVLDP LA D+++E+EMIA L +
Sbjct  617  ILLEMITGRSPVVLLETMQMDLVQWVQFCIEEKKPSADVLDPSLARDSEREDEMIAALKV  676

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PERRPSMR++ E L+ L
Sbjct  677  ALACVQANPERRPSMRHVAETLDHL  701



>gb|EAZ12114.1| hypothetical protein OsJ_01996 [Oryza sativa Japonica Group]
Length=690

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 107/145 (74%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSN-----RMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P   S+     +  S ++    S      SCYQAPE+ K LKPSQKWD+YSYGV
Sbjct  542  NIAGGSPFTQSDHAGIEKAQSQQSDASVSPLVGKGSCYQAPEALKTLKPSQKWDVYSYGV  601

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLEMITGRSP+V + + +MD+V W+  CI+EKKP +DVLDP LA D+++E+EMIA L +
Sbjct  602  ILLEMITGRSPVVLLETMQMDLVQWVQFCIEEKKPSADVLDPSLARDSEREDEMIAALKV  661

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PERRPSMR++ E L+ L
Sbjct  662  ALACVQANPERRPSMRHVAETLDHL  686



>ref|XP_009394442.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=712

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 112/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----tleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P L S+R+A  +T +  S  A     +  SCYQAPE+ K LKPSQKWD+Y+YGV
Sbjct  564  NIAGGSPFLQSDRIADEKTQSQQSDVAFGPVISRGSCYQAPEALKTLKPSQKWDVYAYGV  623

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLE+I+GRSP+V + + EMD+V W+  CI+EKKPL DVLDP+LA++ D+E+E+I +L I
Sbjct  624  ILLELISGRSPLVLLETMEMDLVCWIQFCIEEKKPLLDVLDPFLAQELDREDEIITVLKI  683

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV + PE+RPSMR+  + ++RL
Sbjct  684  ALACVQADPEKRPSMRHATDTIQRL  708



>emb|CDX77808.1| BnaC07g20620D [Brassica napus]
Length=705

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 116/153 (76%), Gaps = 11/153 (7%)
 Frame = -1

Query  780  NIAGGT--PPLXSNRMast---------etstiastaatleSCYQAPESQKALKPSQKWD  634
            NIAGG+  P + SNR+  T           S+  +  ++  S YQAPE+ K +KPSQKWD
Sbjct  550  NIAGGSSSPTVQSNRIIQTEERQQHHHKSISSEFTAHSSSGSYYQAPETLKTVKPSQKWD  609

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLE+I GRSP++ VG++E+D+V W+ +CI+EKKPL DVLDP LA + DKE+E+
Sbjct  610  VYSYGVILLELIAGRSPVLDVGTSEIDLVRWIQVCIEEKKPLCDVLDPCLAPEVDKEDEI  669

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            +A+L +A++CV+SSPE+RP+MR++ + L+RLP+
Sbjct  670  VAVLKVAISCVNSSPEKRPTMRHVSDTLDRLPM  702



>ref|XP_006843749.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Amborella trichopoda]
Length=711

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetsti--astaatleSCYQAPESQKALKPSQKWDIYSYGVILL  607
            NIAG +P   S R+ S    +   A+      SCYQAPE+ K LKPSQKWD+YSYGVILL
Sbjct  565  NIAGNSPENQSGRVTSETNKSDVPATLVVNQGSCYQAPEALKLLKPSQKWDVYSYGVILL  624

Query  606  EMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMA  427
            E+++GRSP V +GS EMD+V W+  CI+EKK LS+VLDP L ED  +EEE++ +L IA+A
Sbjct  625  ELVSGRSPAVLLGSLEMDLVKWVQHCIEEKKQLSEVLDPVLMEDLKREEEILGLLKIALA  684

Query  426  CVHSSPERRPSMRYILEALERL  361
            CV  +PERRPSMR++LE LERL
Sbjct  685  CVQVNPERRPSMRHVLEILERL  706



>ref|XP_011623083.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Amborella trichopoda]
 gb|ERN05424.1| hypothetical protein AMTR_s00007p00232420 [Amborella trichopoda]
Length=705

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetsti--astaatleSCYQAPESQKALKPSQKWDIYSYGVILL  607
            NIAG +P   S R+ S    +   A+      SCYQAPE+ K LKPSQKWD+YSYGVILL
Sbjct  559  NIAGNSPENQSGRVTSETNKSDVPATLVVNQGSCYQAPEALKLLKPSQKWDVYSYGVILL  618

Query  606  EMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMA  427
            E+++GRSP V +GS EMD+V W+  CI+EKK LS+VLDP L ED  +EEE++ +L IA+A
Sbjct  619  ELVSGRSPAVLLGSLEMDLVKWVQHCIEEKKQLSEVLDPVLMEDLKREEEILGLLKIALA  678

Query  426  CVHSSPERRPSMRYILEALERL  361
            CV  +PERRPSMR++LE LERL
Sbjct  679  CVQVNPERRPSMRHVLEILERL  700



>ref|NP_178230.1| leucine-rich repeat transmembrane protein kinase-like protein 
[Arabidopsis thaliana]
 gb|AAD14521.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59280.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC05416.1| leucine-rich repeat transmembrane protein kinase-like protein 
[Arabidopsis thaliana]
Length=716

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 115/156 (74%), Gaps = 14/156 (9%)
 Frame = -1

Query  780  NIAGGTPP-LXSNRMast-------------etstiastaatleSCYQAPESQKALKPSQ  643
            NIAGG+ P + SNR+  T               S+  +  ++  S YQAPE+ K +KPSQ
Sbjct  558  NIAGGSSPTIQSNRIIQTDQQPQERQQHHHKSVSSEFTAHSSSGSYYQAPETLKMVKPSQ  617

Query  642  KWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKE  463
            KWD+YSYG+ILLE+I GRSP V VG++EMD+V W+ +CI+EKKPL DVLDP LA +A+ E
Sbjct  618  KWDVYSYGIILLELIAGRSPAVEVGTSEMDLVRWVQVCIEEKKPLCDVLDPCLAPEAETE  677

Query  462  EEMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            +E++A+L IA++CV+SSPE+RP+MR++ + L+RLPV
Sbjct  678  DEIVAVLKIAISCVNSSPEKRPTMRHVSDTLDRLPV  713



>ref|XP_010554434.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Tarenaya hassleriana]
Length=699

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 110/144 (76%), Gaps = 7/144 (5%)
 Frame = -1

Query  780  NIAGGT--PPLXSNRMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGVILL  607
            NIAGG+  P L S+R      S+  + ++     Y APE+ K +KPSQKWD+YSYGVILL
Sbjct  559  NIAGGSSSPRLQSSRRHGKSISSDFTASSGSY--YMAPEALKTVKPSQKWDVYSYGVILL  616

Query  606  EMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMA  427
            E+ITGRSP+V VG++EMDIV W  LC+DEKKPLSDVLDP L    DKE+E++A+L IAMA
Sbjct  617  EVITGRSPLVQVGTSEMDIVRWFQLCVDEKKPLSDVLDPCL---VDKEDEILAVLKIAMA  673

Query  426  CVHSSPERRPSMRYILEALERLPV  355
            C++SSPE+RPSMR++ + L+++ +
Sbjct  674  CLNSSPEKRPSMRHVSDTLDKISI  697



>emb|CDY17688.1| BnaA06g35070D [Brassica napus]
Length=778

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 117/158 (74%), Gaps = 13/158 (8%)
 Frame = -1

Query  780  NIAGGT--PPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQK  640
            NIAGG+  P + SNR+  T             S+  +  ++  S YQAPE+ K +KPSQK
Sbjct  621  NIAGGSSSPTVQSNRIIQTEERQQQQHHHKSISSEFTAHSSSGSYYQAPETLKTVKPSQK  680

Query  639  WDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEE  460
            WD+YSYGVILLE+I GRSP++ VG++E+D+V W+ +CI+EKKPL DVLDP LA + DKE+
Sbjct  681  WDVYSYGVILLELIAGRSPVLDVGTSEIDLVRWIQVCIEEKKPLCDVLDPCLAPEVDKED  740

Query  459  EMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            E++A+L +A++CV+SSPE+RP+MR++ + L+RLP+  +
Sbjct  741  EIVAVLKVAISCVNSSPEKRPTMRHVSDTLDRLPMAGD  778



>ref|XP_009101362.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=710

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 116/155 (75%), Gaps = 13/155 (8%)
 Frame = -1

Query  780  NIAGGT--PPLXSNRMast-----------etstiastaatleSCYQAPESQKALKPSQK  640
            NIAGG+  P + SNR+  T             S+  +  ++  S YQAPE+ K +KPSQK
Sbjct  553  NIAGGSSSPTVQSNRIIQTEERQQQQHHHKSISSEFTAHSSSGSYYQAPETLKTVKPSQK  612

Query  639  WDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEE  460
            WD+YSYGVILLE+I GRSP++ VG++E+D+V W+ +CI+EKKPL DVLDP LA + DKE+
Sbjct  613  WDVYSYGVILLELIAGRSPVLDVGTSEIDLVRWIQVCIEEKKPLCDVLDPCLAPEVDKED  672

Query  459  EMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            E++A+L +A++CV++SPE+RP+MR++ + L+RLP+
Sbjct  673  EIVAVLKVAISCVNTSPEKRPTMRHVSDTLDRLPM  707



>ref|XP_006290656.1| hypothetical protein CARUB_v10016748mg [Capsella rubella]
 gb|EOA23554.1| hypothetical protein CARUB_v10016748mg [Capsella rubella]
Length=720

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 115/156 (74%), Gaps = 14/156 (9%)
 Frame = -1

Query  780  NIAGGTPP-LXSNRMast-------------etstiastaatleSCYQAPESQKALKPSQ  643
            NIAGG+ P + SNR+  T               S+  +  ++  S YQAPE+   +KPSQ
Sbjct  562  NIAGGSSPTIQSNRIIQTDQQPQERQQHHHKSVSSEFTAHSSSGSYYQAPETLTMVKPSQ  621

Query  642  KWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKE  463
            KWD+YSYG+ILLE+I GRSP + +GS+E+D+V W+ +CI+EKKPL DVLDP LA +ADKE
Sbjct  622  KWDVYSYGIILLELIAGRSPAMELGSSEIDLVRWIQVCIEEKKPLCDVLDPCLAPEADKE  681

Query  462  EEMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            +E++A+L IA++CV+SSPE+RP+MR++ + L+RLPV
Sbjct  682  DEIVAVLKIAISCVNSSPEKRPTMRHVSDTLDRLPV  717



>ref|XP_007227346.1| hypothetical protein PRUPE_ppa002204mg [Prunus persica]
 gb|EMJ28545.1| hypothetical protein PRUPE_ppa002204mg [Prunus persica]
Length=701

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 105/151 (70%), Gaps = 26/151 (17%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----------tleSCYQAPESQKALKPSQKWD  634
            NIAGG+P L SNRMA+ ++      +A            L SCYQAPE+ K +KPSQKWD
Sbjct  561  NIAGGSPSLQSNRMATEKSQERQQKSAPTEATVISPSSNLGSCYQAPEALKVVKPSQKWD  620

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEM  454
            +YSYGVILLEMITGR PIV VGS+EMD+V+W+ LCIDEKKPL D+               
Sbjct  621  VYSYGVILLEMITGRLPIVQVGSSEMDLVHWIQLCIDEKKPLLDI---------------  665

Query  453  IAILNIAMACVHSSPERRPSMRYILEALERL  361
            IA+L IAMACVHSSPERRP MR+I +AL+RL
Sbjct  666  IAVLKIAMACVHSSPERRPIMRHISDALDRL  696



>ref|XP_003567755.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brachypodium distachyon]
Length=694

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CYQAPE+   LKPSQKWD+YSYGVILLE+ITGRSP+V + + +MD+V W+  CI+EKK  
Sbjct  582  CYQAPEALITLKPSQKWDVYSYGVILLEIITGRSPVVLLETMQMDLVQWVQFCIEEKKES  641

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
            +DVLDP+LA ++++E+EMIA+L IA+AC+ ++PERRPSMR++ + LERL V +
Sbjct  642  ADVLDPFLARESEREDEMIAVLKIALACIQANPERRPSMRHVTQTLERLNVSS  694



>ref|XP_010906986.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=712

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CYQAPE+ K LKPSQKWD+YSYGVILLEMI+GRSPIV +   EMD+V W+ LCIDE KPL
Sbjct  600  CYQAPEALKTLKPSQKWDVYSYGVILLEMISGRSPIVLLEKLEMDLVRWVQLCIDENKPL  659

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             D LDP+LA + DK++E+IA+L IA ACV ++P++RPSMR++++ L+RL
Sbjct  660  LDNLDPFLARELDKKDEIIAVLKIASACVQANPDKRPSMRHVVDTLDRL  708



>gb|EAY74284.1| hypothetical protein OsI_02173 [Oryza sativa Indica Group]
Length=708

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 104/140 (74%), Gaps = 5/140 (4%)
 Frame = -1

Query  780  NIAGGTPPLXSN-----RMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGV  616
            NIAGG+P   S+     +  S ++    S      SCYQAPE+ K LKPSQKWD++SYGV
Sbjct  557  NIAGGSPFTQSDHAGIEKAQSQQSDASVSPLVGKRSCYQAPEALKTLKPSQKWDVFSYGV  616

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLEMITGRSP+V + + +MD+V W+  CI+EKKP +DVLDP LA D+++E+EMIA L +
Sbjct  617  ILLEMITGRSPVVLLETMQMDLVQWVQFCIEEKKPSADVLDPSLARDSEREDEMIAALKV  676

Query  435  AMACVHSSPERRPSMRYILE  376
            A+ACV ++PERRPSMR++ E
Sbjct  677  ALACVQANPERRPSMRHVAE  696



>gb|EYU30010.1| hypothetical protein MIMGU_mgv1a002330mg [Erythranthe guttata]
Length=687

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APE+ K  KPSQKWD+YSYGVILLEM++GRSP+  VG++EMDIV W+  CIDEKKP+
Sbjct  575  CYRAPEAAKGAKPSQKWDVYSYGVILLEMVSGRSPLDRVGNSEMDIVRWIGTCIDEKKPI  634

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
             DV DP L  ++DKEEE++ +L IA+AC   SPERRPSMR + + L++L + T
Sbjct  635  FDVWDPQLLRESDKEEEIVGVLKIAIACTERSPERRPSMRGVFDVLDKLTLST  687



>gb|KDO63201.1| hypothetical protein CISIN_1g042348mg, partial [Citrus sinensis]
Length=686

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KP+QKWDIYSYGVILLEMI+G+ P++ +GS E++IV W+ L ++++KP++
Sbjct  561  YQAPEASKVRKPTQKWDIYSYGVILLEMISGKLPMIQIGSMELNIVQWIQLILEDRKPMT  620

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTEH  343
            D+LDP+LA D DKE+E++++L IA+ CVH SP++RPSMR++ ++L+R+ + TE 
Sbjct  621  DILDPFLAHDLDKEDEIVSVLKIALDCVHKSPDKRPSMRHVCDSLDRVNISTEQ  674



>ref|XP_006430721.1| hypothetical protein CICLE_v10013476mg [Citrus clementina]
 gb|ESR43961.1| hypothetical protein CICLE_v10013476mg [Citrus clementina]
Length=712

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KP+QKWDIYSYGVILLEMI+G+ P++ +GS E++IV W+ L ++++KP++
Sbjct  587  YQAPEASKVRKPTQKWDIYSYGVILLEMISGKLPMIQIGSMELNIVQWIQLILEDRKPMT  646

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTEH  343
            D+LDP+LA D DKE+E++++L IA+ CVH SP++RPSMR++ ++L+R+ + TE 
Sbjct  647  DILDPFLAHDLDKEDEIVSVLKIALDCVHKSPDKRPSMRHVCDSLDRVNISTEQ  700



>ref|XP_006482200.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Citrus sinensis]
Length=712

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KP+QKWDIYSYGVIL+EMI+G+ P++ +GS E++IV W+ L ++++KP++
Sbjct  587  YQAPEASKVRKPTQKWDIYSYGVILIEMISGKLPMIQIGSMELNIVQWIQLILEDRKPMT  646

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTEH  343
            D+LDP+LA D DKE+E++++L IA+ CVH SP++RPSMR++ ++L+R+ + TE 
Sbjct  647  DILDPFLAHDLDKEDEIVSVLKIALDCVHKSPDKRPSMRHVCDSLDRVNISTEQ  700



>ref|XP_010916465.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=708

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+   LKPSQKWD+YSYGVILLE+I+GRSP+V + ++EMD+V W+  CIDE+KPL 
Sbjct  597  YQAPEAFTTLKPSQKWDVYSYGVILLELISGRSPVVLMDNSEMDLVRWVQFCIDERKPLL  656

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            DVLDP+LA++ +KE+++IA+L IA+ACV  +PE+RP++R++ + LERL
Sbjct  657  DVLDPFLAKEPEKEDQIIAVLKIALACVQFNPEKRPAVRHVSDTLERL  704



>ref|XP_010502083.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=720

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 114/156 (73%), Gaps = 14/156 (9%)
 Frame = -1

Query  780  NIAGGTPP-LXSNRMast-------------etstiastaatleSCYQAPESQKALKPSQ  643
            NIAGG+ P + SNR+  T               S+  +  ++  S YQAPE+ K +KPSQ
Sbjct  562  NIAGGSSPTIQSNRIIQTDQQPQERQQHHHKSVSSEFTAHSSSGSYYQAPETLKMVKPSQ  621

Query  642  KWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKE  463
            KWD+YS+G+ILLE+I G+SP + VG++EMDIV  + +CI+EKKPL DVLDP L  +A+KE
Sbjct  622  KWDVYSFGIILLELIAGKSPAMEVGTSEMDIVRLIQVCIEEKKPLCDVLDPCLDPEANKE  681

Query  462  EEMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            +E++A+L IA++CV+SSPE+RP+MR++ + L+RLPV
Sbjct  682  DEIVAVLKIAISCVNSSPEKRPTMRHVSDTLDRLPV  717



>ref|XP_008343005.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=699

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APE+ K  KPSQKWD+YS+GV++LEMI+ + P + +GS EMD++    LCI+E+KPL
Sbjct  590  CYKAPEASKVTKPSQKWDVYSFGVVILEMISAKMPFMRIGSLEMDLIQQFQLCIEERKPL  649

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             D+LDP+LA D D +EE++A+L IA+ACVH SPE+RPSMR++ + L RL
Sbjct  650  CDLLDPFLAPDVDMKEEIVAVLKIALACVHKSPEKRPSMRFVCDNLARL  698



>emb|CDX84980.1| BnaC05g20750D [Brassica napus]
Length=699

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG TEM+IV W+ +CIDEKK +
Sbjct  587  YQAPEAMKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKTEMEIVKWIQMCIDEKKEM  646

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  ED + EEE+IA+L +AMACV  SPE+RP+M+++ +AL ++
Sbjct  647  SDILDPYLVPEDTEIEEEVIAVLKVAMACVSISPEKRPAMKHVADALNQI  696



>ref|XP_006415859.1| hypothetical protein EUTSA_v10006964mg [Eutrema salsugineum]
 gb|ESQ34212.1| hypothetical protein EUTSA_v10006964mg [Eutrema salsugineum]
Length=701

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE++KA +KPSQKWD+YS+GVILLEMITGR PIV VG +EM+IV W+ +CIDEKK +
Sbjct  589  YQAPEAKKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKSEMEIVKWIQMCIDEKKEM  648

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  ED + EEE+IA+L IAMACV   PE+RPSM++I +AL ++
Sbjct  649  SDILDPYLVPEDTEIEEEVIAVLKIAMACVSIVPEKRPSMKHIADALNQI  698



>ref|XP_010477947.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=702

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG +EM+IV W+ +CIDEKK +
Sbjct  591  YQAPEAAKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKSEMEIVKWIQMCIDEKKEM  650

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  +D + EEE+IA+L IAMACV +SPE+RP M++I +AL ++
Sbjct  651  SDILDPYLVPDDTEIEEEVIAVLKIAMACVSTSPEKRPPMKHIADALTQI  700



>ref|XP_006306904.1| hypothetical protein CARUB_v10008465mg [Capsella rubella]
 gb|EOA39802.1| hypothetical protein CARUB_v10008465mg [Capsella rubella]
Length=700

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+ KA +KPSQKWD+YS+GVILLE+ITGR PIV VG +EM+IV W+ +CIDEKK +
Sbjct  588  YQAPEATKATVKPSQKWDVYSFGVILLELITGRLPIVFVGKSEMEIVKWIQMCIDEKKEM  647

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  +D + EEE+IA+L IAMACV ++PE+RPSM++I +AL ++
Sbjct  648  SDILDPYLVPDDTEIEEEVIAVLKIAMACVSTNPEKRPSMKHIADALTQI  697



>ref|XP_010460394.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
 ref|XP_010460395.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=703

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG +EM+IV W+ +CIDEKK +
Sbjct  591  YQAPEAAKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKSEMEIVKWIQMCIDEKKEM  650

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  +D + EEE+IA+L IAMACV +SPE+RP M++I +AL ++
Sbjct  651  SDILDPYLVPDDTEIEEEVIAVLKIAMACVSTSPEKRPPMKHIADALTQI  700



>ref|XP_010499124.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=703

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG +EM+IV W+ +CIDEKK +
Sbjct  591  YQAPEAAKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKSEMEIVKWIQMCIDEKKEM  650

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  +D + EEE+IA+L IAMACV +SPE+RP M++I +AL ++
Sbjct  651  SDILDPYLVPDDTEIEEEVIAVLKIAMACVSTSPEKRPPMKHIADALTQI  700



>ref|XP_008809165.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Phoenix dactylifera]
Length=709

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = -1

Query  780  NIAGGTPPLXSN-RMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGVILLE  604
            NIAG +P + S  +  +  +    S   +    YQAPE+   LKPSQKWD+YSYGVILLE
Sbjct  565  NIAGESPTMQSTEKPQNQISDVAVSPIMSSALSYQAPEAFSTLKPSQKWDVYSYGVILLE  624

Query  603  MITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMAC  424
            +I+GRSP+V + ++EMD+V W+  CIDE+KPL DVLDP+LA++ +KE+++I +L IA+AC
Sbjct  625  LISGRSPVVLMDNSEMDLVRWVQFCIDERKPLLDVLDPFLAKEPEKEDQIITVLKIALAC  684

Query  423  VHSSPERRPSMRYILEALER  364
            V  +PE+RP MR++ + LER
Sbjct  685  VQFNPEKRPPMRHVSDTLER  704



>ref|XP_008229314.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Prunus mume]
Length=729

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y+APE+ K  KPSQKWD+YS+GVI+LEMI+ + P   +GS EMD++ W  L IDE+KPL 
Sbjct  600  YKAPEASKVTKPSQKWDVYSFGVIILEMISAKMPFKRIGSLEMDLIQWFQLSIDERKPLV  659

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
            D+LDP+LA D D EEE++A+L +A+AC H +PERRPSMR++ + L R+ +P+
Sbjct  660  DLLDPFLAPDVDMEEEIVAVLKMALACAHKAPERRPSMRFVCDNLARILLPS  711



>ref|XP_011035109.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X3 [Populus euphratica]
Length=620

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APES K +KPSQKWD+YS+GVILLE+I+G+SPI+ +  + MD+V W+ L I E KP 
Sbjct  509  CYEAPESSKVIKPSQKWDVYSFGVILLEIISGKSPIMQMSLSGMDLVRWVQLSI-EVKPP  567

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            S+VLDP+LA D+DKE EMIA+L IA+ACVH+SP++RPSM+ + E LERL
Sbjct  568  SEVLDPFLARDSDKEHEMIAVLKIALACVHASPDKRPSMKNVSENLERL  616



>ref|XP_009395564.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=697

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 110/145 (76%), Gaps = 5/145 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaa-----tleSCYQAPESQKALKPSQKWDIYSYGV  616
            N+A G+P L S+R+ +  T++  S  A     T  SCYQAPE  + +KPSQKWD+YSYG 
Sbjct  551  NLAEGSPFLQSDRVFAETTASQQSDVAFGRIITKGSCYQAPEVFRTMKPSQKWDVYSYGA  610

Query  615  ILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            ILLE+I+G+SP+V + + EMD+V+W+  CI+EK+ L DVLDP+LA++ D+E+E++++L I
Sbjct  611  ILLELISGKSPLVLLETMEMDLVHWVQFCIEEKRSLLDVLDPFLAQEIDREDEIVSVLKI  670

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+ACV ++PE RPSM ++ + LERL
Sbjct  671  ALACVQANPEMRPSMWHVADTLERL  695



>emb|CDY42116.1| BnaA09g28440D [Brassica napus]
Length=696

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG  EM+IV W+ +CIDEKK +
Sbjct  584  YQAPEAMKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKMEMEIVKWIQMCIDEKKEM  643

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  ED + EEE+IA+L +AMACV  SPE+RP+M+++ +AL ++
Sbjct  644  SDILDPYLVPEDTEIEEEVIAVLKVAMACVSISPEKRPAMKHVADALNQI  693



>ref|XP_002305177.1| hypothetical protein POPTR_0004s09480g [Populus trichocarpa]
 gb|EEE85688.1| hypothetical protein POPTR_0004s09480g [Populus trichocarpa]
Length=699

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APES K +KPSQKWD+YS+GVILLE+I+G+SPI+ +  + MD+V W+ L I E KP 
Sbjct  588  CYEAPESSKVIKPSQKWDVYSFGVILLEIISGKSPIMQMSLSGMDLVRWIQLSI-EVKPP  646

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
            S+VLDP+LA D+DKE EMIA+L IA+ACVH+SP++RPSM+ + E LERL   T
Sbjct  647  SEVLDPFLARDSDKEHEMIAVLKIALACVHASPDKRPSMKNVSENLERLVSST  699



>ref|XP_011035107.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Populus euphratica]
Length=699

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APES K +KPSQKWD+YS+GVILLE+I+G+SPI+ +  + MD+V W+ L I E KP 
Sbjct  588  CYEAPESSKVIKPSQKWDVYSFGVILLEIISGKSPIMQMSLSGMDLVRWVQLSI-EVKPP  646

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            S+VLDP+LA D+DKE EMIA+L IA+ACVH+SP++RPSM+ + E LERL
Sbjct  647  SEVLDPFLARDSDKEHEMIAVLKIALACVHASPDKRPSMKNVSENLERL  695



>ref|XP_011035108.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Populus euphratica]
Length=658

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APES K +KPSQKWD+YS+GVILLE+I+G+SPI+ +  + MD+V W+ L I E KP 
Sbjct  547  CYEAPESSKVIKPSQKWDVYSFGVILLEIISGKSPIMQMSLSGMDLVRWVQLSI-EVKPP  605

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            S+VLDP+LA D+DKE EMIA+L IA+ACVH+SP++RPSM+ + E LERL
Sbjct  606  SEVLDPFLARDSDKEHEMIAVLKIALACVHASPDKRPSMKNVSENLERL  654



>ref|XP_010536321.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Tarenaya hassleriana]
Length=195

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGVILLEM  601
            NIA G+P   SNR+ + E S   ++       YQAPE+ KA+KPSQKWD+YS+GVILLEM
Sbjct  52   NIAVGSPTSESNRVVTDEQSQDRASKLGSY--YQAPEAMKAVKPSQKWDVYSFGVILLEM  109

Query  600  ITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYL--AEDADKEEEMIAILNIAMA  427
            ITGR P+V VG++EM IV W+ +CI+EKK ++D+LD  L      + EEE+I++L IAMA
Sbjct  110  ITGRLPVVSVGNSEMGIVQWIQMCIEEKKEMADILDRSLEEDNAEEVEEEIISVLKIAMA  169

Query  426  CVHSSPERRPSMRYILEALERL  361
            CV SSPE+RP+M++I EAL ++
Sbjct  170  CVSSSPEKRPTMKHISEALNQI  191



>ref|XP_002528076.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF34326.1| ATP binding protein, putative [Ricinus communis]
Length=692

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y+APE  K+ KPSQKWD+YS+GVILLEMI+G+SP++   ++EM +V W+ L   E KPLS
Sbjct  582  YEAPEVSKSSKPSQKWDVYSFGVILLEMISGKSPVMQTSASEMGLVQWIQLST-EVKPLS  640

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
            DVLDP+L  D DK+EEM+AILNIA+ CVH+SP++RPSMR + ++LERL   T
Sbjct  641  DVLDPFLVHDLDKKEEMVAILNIALTCVHTSPDKRPSMRNVSDSLERLSSST  692



>gb|KFK44531.1| hypothetical protein AALP_AA1G268700 [Arabis alpina]
Length=702

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG +EM+IV W+ +CIDEKK +
Sbjct  590  YQAPEAMKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKSEMEIVKWIQMCIDEKKEM  649

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL  ED + EEE+IA+L IAMACV   PE+RP M++I +AL ++
Sbjct  650  SDILDPYLVPEDTEIEEEVIAVLKIAMACVSIIPEKRPPMKHIADALNQI  699



>ref|NP_564228.1| leucine-rich repeat-containing protein kinase [Arabidopsis thaliana]
 gb|AAG28814.1|AC079374_17 unknown protein [Arabidopsis thaliana]
 gb|AAL08297.1| At1g25320/F4F7_17 [Arabidopsis thaliana]
 gb|AAQ65094.1| At1g25320/F4F7_17 [Arabidopsis thaliana]
 gb|ACN59233.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30606.1| leucine-rich repeat-containing protein kinase [Arabidopsis thaliana]
Length=702

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            Y APE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG +EM+IV W+ +CIDEKK +
Sbjct  590  YLAPEATKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKSEMEIVKWIQMCIDEKKEM  649

Query  507  SDVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            SD+LDPYL   D + EEE+IA+L IAMACV +SPE+RP M++I +AL ++
Sbjct  650  SDILDPYLVPNDTEIEEEVIAVLKIAMACVSTSPEKRPPMKHIADALTQI  699



>ref|XP_009341317.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=700

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APE+ K  KPSQKWD+YS+GV++LEMI+ + P + +GS EMD++    L ++E+KPL
Sbjct  591  CYKAPEASKVTKPSQKWDVYSFGVVILEMISAKMPFMRIGSLEMDLIQQFQLHVEERKPL  650

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             D+LDP+LA D D +EE++A+L IA+ACVH SPE+RPSMR++ + L RL
Sbjct  651  CDLLDPFLAPDVDMKEEIVAVLKIALACVHKSPEKRPSMRFVCDNLARL  699



>ref|XP_007216807.1| hypothetical protein PRUPE_ppa023239mg [Prunus persica]
 gb|EMJ18006.1| hypothetical protein PRUPE_ppa023239mg [Prunus persica]
Length=708

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y+APE+ K  KPSQKWD+YS+GVI+LEMI+ + P   +GS EMD++ W  L IDE+KPL 
Sbjct  600  YKAPEASKVTKPSQKWDVYSFGVIILEMISAKMPFKRIGSLEMDLIQWFQLSIDERKPLV  659

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            D+LDP+LA D D EEE+IA+L +A+AC H +PE RPSMR++ + L RL
Sbjct  660  DLLDPFLAPDVDMEEEIIAVLKMALACAHKAPEGRPSMRFVCDNLARL  707



>ref|XP_009115301.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=696

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = -1

Query  681  QAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            QAPE+ KA +KPSQKWD+YS+GVILLEMITGR PIV VG  EM+IV W+ +CIDEKK +S
Sbjct  585  QAPEAMKATVKPSQKWDVYSFGVILLEMITGRLPIVFVGKMEMEIVKWIQMCIDEKKEMS  644

Query  504  DVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            D+LDPYL  ED + EEE+IA+L +AMACV  SPE+RP+M+++ +AL ++
Sbjct  645  DILDPYLVPEDTEIEEEVIAVLKVAMACVSISPEKRPAMKHVADALNQI  693



>ref|XP_009344127.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=700

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APE+ K  KPSQKWD+YS+GV++LEMI+ + P + +GS EMD++    L ++E+KPL
Sbjct  591  CYKAPEASKVTKPSQKWDVYSFGVVILEMISAKMPFMRIGSLEMDLIQQFQLHVEERKPL  650

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             D+LDP+LA D D +EE++A+L IA+ACVH SPE+RPSMR++ + L RL
Sbjct  651  CDLLDPFLAPDVDMKEEIVAVLKIALACVHKSPEKRPSMRFVCDNLARL  699



>ref|XP_010513827.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=722

 Score =   148 bits (374),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 112/156 (72%), Gaps = 14/156 (9%)
 Frame = -1

Query  780  NIAGGTPP-LXSNRMast-------------etstiastaatleSCYQAPESQKALKPSQ  643
            NIAGG+ P + SNR+  T               S+  +  ++  S YQAPE+ K +KPSQ
Sbjct  564  NIAGGSSPTIQSNRIIQTDQQPQERQQHHHKSVSSDFTAHSSSGSYYQAPETLKMVKPSQ  623

Query  642  KWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKE  463
            KWD+YS+G+ILLE+I G+SP + VG++EMD+V  + +CI+EKKPL DVLDP L  +A+KE
Sbjct  624  KWDVYSFGIILLELIAGKSPAMEVGTSEMDLVRLIQVCIEEKKPLCDVLDPCLDPEANKE  683

Query  462  EEMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            +E++A+L IA++C +SSPE+RP+MR++ + L+RL V
Sbjct  684  DEIVAVLKIAISCANSSPEKRPAMRHVSDTLDRLLV  719



>ref|XP_010424856.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=720

 Score =   148 bits (373),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 114/159 (72%), Gaps = 14/159 (9%)
 Frame = -1

Query  780  NIAGGTPP-LXSNRMast-------------etstiastaatleSCYQAPESQKALKPSQ  643
            NIAGG+ P + SNR+  T               S+  +  ++  S YQAPE+ K +KPSQ
Sbjct  562  NIAGGSSPTIQSNRIIQTDHQPQERQQHHHKSVSSDFTAHSSSGSYYQAPETLKMVKPSQ  621

Query  642  KWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKE  463
            KWD+YS+G+ILLE+I G+SP + VG++EMD+V  + +CI+EKKPL DVLDP L  +ADKE
Sbjct  622  KWDVYSFGIILLELIAGKSPAMEVGTSEMDLVRLIQVCIEEKKPLCDVLDPCLDPEADKE  681

Query  462  EEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
            +E++A+L IA++CV+SSP++RP+M ++ + L+RL V ++
Sbjct  682  DEIVAVLKIAISCVNSSPDKRPTMWHVSDTLDRLLVASD  720



>ref|XP_010545857.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830, partial [Tarenaya hassleriana]
Length=287

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGVILLEM  601
            NIA G+P   SNR+ + E S   ++       YQAPE+ KA+KPSQKWD+YS+GVILLEM
Sbjct  144  NIAVGSPTSESNRVVTDEQSQDRASKLGS--YYQAPEAMKAVKPSQKWDVYSFGVILLEM  201

Query  600  ITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYL--AEDADKEEEMIAILNIAMA  427
            ITGR P+V VG++EM IV W+ +CI+EKK ++D+LD  L      + EEE+I++L IAMA
Sbjct  202  ITGRLPVVSVGNSEMGIVQWIQMCIEEKKEMADILDRSLEEDNAEEVEEEIISVLKIAMA  261

Query  426  CVHSSPERRPSMRYILEALERL  361
            CV SSPE+RP+M++I EAL ++
Sbjct  262  CVSSSPEKRPTMKHISEALNQI  283



>ref|XP_010542164.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Tarenaya hassleriana]
 ref|XP_010542165.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Tarenaya hassleriana]
Length=694

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGVILLEM  601
            NIA G+P   SNR+ + E S   ++       YQAPE+ KA+KPSQKWD+YS+GVILLEM
Sbjct  551  NIAVGSPTSESNRVVTDEQSQDRASKLGSY--YQAPEAMKAVKPSQKWDVYSFGVILLEM  608

Query  600  ITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYL--AEDADKEEEMIAILNIAMA  427
            ITGR P+V VG++EM IV W+ +CI+EKK ++D+LD  L      + EEE+I++L IAMA
Sbjct  609  ITGRLPVVSVGNSEMGIVQWIQMCIEEKKEMADILDRSLEEDNAEEVEEEIISVLKIAMA  668

Query  426  CVHSSPERRPSMRYILEALERL  361
            CV SSPE+RP+M++I EAL ++
Sbjct  669  CVSSSPEKRPTMKHISEALNQI  690



>ref|XP_011021296.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Populus euphratica]
Length=693

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APES K +KPSQKWD+YS+GVILLEMI+G+SP++ V  + MD+V W+ L   E KP 
Sbjct  582  CYEAPESSKLIKPSQKWDVYSFGVILLEMISGKSPMMQVSLSGMDLVQWIQLSF-EVKPP  640

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            S+VLDP+L  ++DKE EM+A+L IA+ACVH+SP++RPSM+   + L RL
Sbjct  641  SEVLDPFLTRESDKEYEMVAVLKIALACVHASPDKRPSMKNASDNLLRL  689



>ref|XP_012078013.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Jatropha curcas]
 gb|KDP33010.1| hypothetical protein JCGZ_13041 [Jatropha curcas]
Length=689

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y+APE  K  KPSQKWD+YS+GVILLEMI+G+SP++   S+EM +V W+ L   E KPLS
Sbjct  579  YEAPEVSKVSKPSQKWDVYSFGVILLEMISGKSPVMQTSSSEMGLVQWIQLS-TEVKPLS  637

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
            DVLDP+L  D +K++++ ++L IA+ACVH SP++RPSMR + ++LERL +
Sbjct  638  DVLDPFLVHDLEKKDQIASVLKIALACVHMSPDKRPSMRIVSDSLERLAL  687



>ref|XP_006383406.1| hypothetical protein POPTR_0005s15180g [Populus trichocarpa]
 gb|ERP61203.1| hypothetical protein POPTR_0005s15180g [Populus trichocarpa]
Length=697

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY+APES K +KPSQKWD+YS+GVILLEMI+G+SP++ V  + MD+V W+ L   E KP 
Sbjct  586  CYEAPESSKLIKPSQKWDVYSFGVILLEMISGKSPMMQVSLSGMDLVQWIQLSF-EVKPP  644

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            S+VLDP+L  ++DKE EM+A+L IA+ACV +SP++RPSM+   + L RL
Sbjct  645  SEVLDPFLTRESDKEHEMVAVLKIALACVQASPDKRPSMKNASDNLGRL  693



>gb|KJB43117.1| hypothetical protein B456_007G184800 [Gossypium raimondii]
Length=691

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y+APE+    KPSQKWD+YS+GVI LEMI+G+ P + VGS+EMD+V W+ L +DE+KPLS
Sbjct  582  YRAPEALNDTKPSQKWDVYSFGVISLEMISGKLPSIQVGSSEMDLVQWIQLGMDERKPLS  641

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             ++DP LA    +E+ + AIL +A+AC+H SP+RRPSMR++  +LE+L
Sbjct  642  SIIDPSLAHSWVEEDNITAILKLALACIHKSPDRRPSMRFVSYSLEKL  689



>ref|XP_007033179.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY04105.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=708

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+GVILLEMI+G+ P + VGS EMD+V W+ L I+E+KPLS
Sbjct  597  YQAPEASKDTKPSQKWDVYSFGVILLEMISGKLPSIQVGSLEMDMVQWIQLSIEERKPLS  656

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             ++DP L  +  +E+ + AIL +A+AC+H SP+RRP+MR +  + ++L
Sbjct  657  SIIDPSLTHNWGEEDNIAAILKLALACIHKSPDRRPTMRCVSYSFDKL  704



>ref|XP_009393570.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=715

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K+L+PSQKWDIYSYGVILLE+I GRSP+  + +++MD+V W+ + I+EKK L 
Sbjct  602  YQAPEALKSLRPSQKWDIYSYGVILLELICGRSPVALMETSDMDLVRWVQISIEEKKTLL  661

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            DV+DP L  + ++E+E+ A+L IA+ACV  +PE RPS R++ ++LERL
Sbjct  662  DVVDPCLTRELEREDEVTAVLKIALACVQFNPESRPSSRHVADSLERL  709



>emb|CDX96124.1| BnaA07g26070D [Brassica napus]
Length=125

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+G+++LEM+TG+ P++ + S+E D+V W+    +  KP+ 
Sbjct  14   YQAPEASKMTKPSQKWDVYSFGLVVLEMVTGKFPVMQMSSSETDLVMWVEAAAERNKPVW  73

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             VLDP LA D D E+ M+ ++ I + CV  SP++RPSMR + E+ E+L
Sbjct  74   YVLDPVLARDRDMEDSMVQVVKIGLDCVKKSPDKRPSMRNVFESFEKL  121



>ref|XP_009413652.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=674

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K+L+PSQKWD+YSYGVILLE+I GRSP+V + +++MD+V W+ + I+E+K L 
Sbjct  565  YQAPEAIKSLRPSQKWDVYSYGVILLELICGRSPVVLMETSDMDLVRWVQISIEERKTLL  624

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            DV+DP L  + ++E+E+   L IA+ CV  +PE RPSMR++++ L+RL
Sbjct  625  DVVDPNLTRETEREDEITTALKIALGCVQLNPESRPSMRHVVDLLQRL  672



>ref|XP_010032652.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Eucalyptus grandis]
 gb|KCW52084.1| hypothetical protein EUGRSUZ_J01519 [Eucalyptus grandis]
Length=706

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+G+ILLEMITG+ PIV VGS   D+V W+ + +DE+ P+S
Sbjct  593  YQAPEASKPTKPSQKWDVYSFGMILLEMITGKMPIVEVGSLRFDLVRWVQMSVDERIPIS  652

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
             ++DP L  D DKEEEM  +L++A+AC++ SPERRPSMR++L  L++L + T 
Sbjct  653  SIIDPILLHDLDKEEEMATVLHMALACLNKSPERRPSMRHVLNNLDKLTIFTN  705



>ref|XP_010032651.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Eucalyptus grandis]
Length=740

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+G+ILLEMITG+ PIV VGS   D+V W+ + +DE+ P+S
Sbjct  627  YQAPEASKPTKPSQKWDVYSFGMILLEMITGKMPIVEVGSLRFDLVRWVQMSVDERIPIS  686

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
             ++DP L  D DKEEEM  +L++A+AC++ SPERRPSMR++L  L++L + T 
Sbjct  687  SIIDPILLHDLDKEEEMATVLHMALACLNKSPERRPSMRHVLNNLDKLTIFTN  739



>ref|XP_004309737.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Fragaria vesca subsp. vesca]
 ref|XP_011471029.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Fragaria vesca subsp. vesca]
Length=688

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY APE+ K  KPSQK D+YS+GVI+LEMI+ + P +  GS ++D+V W  + I+E+ P+
Sbjct  579  CYNAPEATKVAKPSQKCDVYSFGVIMLEMISAKMPYIRTGSLDVDLVEWFQISIEERNPV  638

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             DVLD +LA D D EEE++A++ IA+ACV   PE+RPSMR + + L RL
Sbjct  639  HDVLDRFLAPDVDMEEEIVAVMKIALACVAEVPEKRPSMRGVCDNLARL  687



>ref|XP_010528994.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Tarenaya hassleriana]
Length=657

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+G+++LEM+TG+SP++    +E D V W+ L ++  KP+ 
Sbjct  549  YQAPEASKITKPSQKWDVYSFGLVVLEMVTGKSPVLKTDGSETDSVMWVRLAVERSKPIR  608

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             VLDP L   +  EE ++ ++ I MACV+ SP+RRPSMR +LE+LE L
Sbjct  609  YVLDPVLVRYSGMEESVVEVIEIGMACVNKSPDRRPSMRNVLESLENL  656



>ref|XP_003638422.1| Receptor protein kinase-like protein [Medicago truncatula]
Length=140

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 39/151 (26%)
 Frame = -1

Query  780  NIAGGTPPLXSNRMastetstiastaatleSC------YQAPESQKALKPSQKWDIYSYG  619
            NIAGG+P L SNR+A+ +      + +   +       YQAPE+ K +KPSQKWD+YSYG
Sbjct  23   NIAGGSPTLQSNRVAAEKLHERQKSLSNEVATNIIGSGYQAPEALKVVKPSQKWDVYSYG  82

Query  618  VILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILN  439
            VILLEM+TGR PIV V                                 DKEEEMI +L 
Sbjct  83   VILLEMMTGRLPIVQV---------------------------------DKEEEMIGVLK  109

Query  438  IAMACVHSSPERRPSMRYILEALERLPVPTE  346
            IAMACV+SS E+RP+MR++L+AL+RL V ++
Sbjct  110  IAMACVNSSTEKRPTMRHVLDALDRLSVSSD  140



>ref|XP_010032653.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Eucalyptus grandis]
 gb|KCW52085.1| hypothetical protein EUGRSUZ_J01520 [Eucalyptus grandis]
Length=706

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  K SQKWD+YS+G+ILLEMITG+ PIV VGS   D+V W+ + +DE+ P+S
Sbjct  593  YQAPEASKPTKRSQKWDVYSFGMILLEMITGKMPIVEVGSLRFDLVRWVQMSVDERIPIS  652

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPTE  346
             ++DP L  D DKEEEM  +L +A+AC++ SPERRPS R++L  L++L + T 
Sbjct  653  SIIDPILLHDLDKEEEMATVLRMALACLNKSPERRPSTRHVLNNLDKLAIFTN  705



>ref|XP_006391437.1| hypothetical protein EUTSA_v10018224mg [Eutrema salsugineum]
 gb|ESQ28723.1| hypothetical protein EUTSA_v10018224mg [Eutrema salsugineum]
Length=682

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+G+++LE++TG+SP++   S+E D+V W+    ++ KP+ 
Sbjct  571  YQAPEASKMTKPSQKWDVYSFGLVVLELVTGKSPVMQTKSSETDLVMWVESASEKNKPVW  630

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             VLDP LA D D EE M+ ++ I +ACV  SP++RP MR + E+ E+L
Sbjct  631  YVLDPVLARDRDMEESMVQVIKIGLACVQKSPDKRPIMRNVFESFEKL  678



>emb|CDY52887.1| BnaC06g27800D [Brassica napus]
Length=687

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+G+++LEM+TG+ P++ + ++E D+V W+    +  KP+ 
Sbjct  576  YQAPEASKMTKPSQKWDVYSFGLVVLEMVTGKFPVMQMSNSETDLVMWVEAAAERNKPVW  635

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             VLDP LA D D E+ M+ ++ I + CV  SP++RPSMR + E+ E+L
Sbjct  636  YVLDPVLARDRDMEDSMVQVVKIGLDCVKKSPDKRPSMRNVFESFEKL  683



>ref|XP_001758511.1| predicted protein [Physcomitrella patens]
 gb|EDQ76489.1| predicted protein, partial [Physcomitrella patens]
Length=292

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+  A KP+QK D+YS+GV+LLE++TGRSP   + + E+D+V W  L + EK+P S
Sbjct  185  YQAPETATAKKPNQKSDVYSFGVVLLEVLTGRSPFAQLAAGELDLVTWTRLGLQEKRPHS  244

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            D+ DPYL +    E EMI  L +A+AC   +P+ RP MR++    E+L
Sbjct  245  DIFDPYLVKSTTDESEMIETLQVALACTAVNPDSRPKMRHVANFFEQL  292



>ref|XP_009105234.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=686

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K  KPSQKWD+YS+G+++LEM+TG+ P++ + S+E D+V W+    +  KP+ 
Sbjct  575  YQAPEASKMTKPSQKWDVYSFGLVVLEMVTGKFPVMQMSSSETDLVMWVEAAAERNKPIW  634

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             VLDP LA D D E+ M+ ++ I + CV  SP++RP MR + E+ E+L
Sbjct  635  YVLDPVLARDRDMEDSMVQVVKIGLDCVKKSPDKRPIMRNVFESFEKL  682



>ref|NP_176855.1| probable inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9C9N5.1|Y1668_ARATH RecName: Full=Probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG60082.1|AC013288_16 receptor protein kinase, putative [Arabidopsis thaliana]
 gb|ACN59265.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE34560.1| probable inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=685

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -1

Query  684  YQAPES-QKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+  K  KPSQKWD+YS+G+++LEM+TG+SP+    S+EMD+V W+    +  KP 
Sbjct  577  YQAPEAASKMTKPSQKWDVYSFGLVILEMVTGKSPV----SSEMDLVMWVESASERNKPA  632

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
              VLDP LA D D E+ M+ ++ I +ACV  +P++RP MR +LE+ E+L
Sbjct  633  WYVLDPVLARDRDLEDSMVQVIKIGLACVQKNPDKRPHMRSVLESFEKL  681



>dbj|BAF01034.1| hypothetical protein [Arabidopsis thaliana]
Length=685

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -1

Query  684  YQAPES-QKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+  K  KPSQKWD+YS+G+++LEM+TG+SP+    S+EMD+V W+    +  KP 
Sbjct  577  YQAPEAASKMTKPSQKWDVYSFGLVILEMVTGKSPV----SSEMDLVMWVESASERNKPA  632

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
              VLDP LA D D E+ M+ ++ I +ACV  +P++RP MR +LE+ E+L
Sbjct  633  WYVLDPVLARDRDLEDSMVQVIKIGLACVQKNPDKRPHMRSVLESFEKL  681



>ref|XP_010511585.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=680

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 79/109 (72%), Gaps = 5/109 (5%)
 Frame = -1

Query  684  YQAPE-SQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE S +  KPSQKWD+YS+G+++LE++TG+SP+    ++EMD+V W+    +  KP+
Sbjct  572  YQAPEASSRMTKPSQKWDVYSFGLVILELVTGKSPV----NSEMDLVMWVESASERNKPV  627

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
              VLDP LA D D E+ M+ ++ I +ACVH +P++RP MR I ++ E+L
Sbjct  628  WYVLDPVLARDRDLEDSMVQVIKIGLACVHKNPDKRPLMRNIYDSFEKL  676



>ref|XP_010474154.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=708

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -1

Query  684  YQAPES-QKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+  K  KPSQKWD+YS+G+++LE++TG+SP+    ++EMD+V W+    +  KP+
Sbjct  600  YQAPEAASKMTKPSQKWDVYSFGLLILELVTGKSPV----NSEMDLVTWVESASERNKPV  655

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
              VLDP LA D D E+ M+ ++ I +ACVH +P++RP MR I ++ E+ 
Sbjct  656  WYVLDPVLARDRDLEDSMVQVIKIGLACVHKNPDKRPLMRNIYDSFEKF  704



>ref|XP_002888549.1| hypothetical protein ARALYDRAFT_475779 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64808.1| hypothetical protein ARALYDRAFT_475779 [Arabidopsis lyrata subsp. 
lyrata]
Length=681

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -1

Query  684  YQAPES-QKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+  K  KPSQKWD+YS+G+++LE++TG+SP+    ++EMD+V W+    +  KP+
Sbjct  573  YQAPEAASKMTKPSQKWDVYSFGLVILELVTGKSPV----NSEMDLVMWVQSASERNKPV  628

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
              VLDP LA D D E+ M+ ++ I +ACV  +P++RP MR + E+ E+L
Sbjct  629  WYVLDPVLARDRDLEDSMVQVIKIGLACVQKNPDKRPLMRNVYESFEKL  677



>ref|XP_006300314.1| hypothetical protein CARUB_v10019896mg [Capsella rubella]
 gb|EOA33212.1| hypothetical protein CARUB_v10019896mg [Capsella rubella]
Length=686

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 79/109 (72%), Gaps = 5/109 (5%)
 Frame = -1

Query  684  YQAPES-QKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            YQAPE+  K  KPSQKWD+YS+G+++LE++TG+SP+    ++E+D+V W+    +  KP+
Sbjct  578  YQAPEAASKMTKPSQKWDVYSFGLVILELVTGKSPV----NSEIDLVMWVESASERNKPV  633

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
              VLDP LA D D E+ M+ ++ I +ACVH +P++RP MR I ++ E+L
Sbjct  634  WYVLDPALARDRDLEDSMVQVIKIGLACVHKNPDKRPLMRNIYDSFEKL  682



>ref|XP_006845210.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Amborella trichopoda]
 gb|ERN06885.1| hypothetical protein AMTR_s00005p00251950 [Amborella trichopoda]
Length=720

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = -1

Query  687  CYQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKP  511
            CY+APE++    +P+QKWD+YS+GV+LLEM+TGRSP     +T  ++V+W+    +E+  
Sbjct  604  CYKAPEARIVGARPAQKWDVYSFGVVLLEMLTGRSPEAQWAATGEELVSWVRKAFEEEMA  663

Query  510  LSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            LS+++DP L  +   ++E++A  ++A+ C  + PE RP M+ + +ALE++
Sbjct  664  LSEIVDPALLREVHAKKEVLAAFHVALTCTEAEPEARPRMKSVSDALEKI  713



>ref|XP_010527771.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Tarenaya hassleriana]
Length=669

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 88/140 (63%), Gaps = 29/140 (21%)
 Frame = -1

Query  780  NIAGGTPP--LXSNRMastetstiastaatleSCYQAPESQKALKPSQKWDIYSYGVILL  607
            NIAGG+ P  L   R + +  S+  +  +     Y APE+ KA+KPSQKWD+YSYGVILL
Sbjct  551  NIAGGSSPTMLQXKRHSKSIISSEFTALSH----YMAPEALKAVKPSQKWDVYSYGVILL  606

Query  606  EMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMA  427
            E+ITGRSP+V VG++E D+V+W+   ++E+KPLSD                      A+A
Sbjct  607  EVITGRSPVVEVGTSETDLVSWI---MEERKPLSDC--------------------KAIA  643

Query  426  CVHSSPERRPSMRYILEALE  367
            CV+++P++RP+MR   + L+
Sbjct  644  CVNTNPDKRPTMRLASDTLD  663



>ref|XP_012085656.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Jatropha curcas]
 gb|KDP26784.1| hypothetical protein JCGZ_17942 [Jatropha curcas]
Length=713

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APES+  + +P+QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    +E
Sbjct  599  YRAPESRVPSSRPTQKWDVYSFGVVLLELLTGKSPELSPTTSTSVELPDLVRWVKKGFEE  658

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A+ ++A+AC  + PE RP M+ + E LER+
Sbjct  659  ENPLSDMVDPMLLQEVHAKKEVLAVFHVALACTETDPEVRPRMKTVSENLERI  711



>ref|XP_007045046.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY00878.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=715

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH---VGSTEM-DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP +      STE+ D+V W+    +E
Sbjct  601  YRAPEARVPGNRPTQKWDVYSFGVVLLELLTGKSPELSPTTSTSTEIPDLVRWVRKGFEE  660

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A+ ++A+AC    PE RP M+ + E LER+
Sbjct  661  ENPLSDMVDPLLLQEVHAKKEVLAVFHVALACTEGDPEVRPRMKTVSENLERI  713



>ref|XP_010105787.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC06140.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=721

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GVILLE++TG+SP +    ST +   D+V W+    +E
Sbjct  607  YRAPEARVPGSRPTQKWDVYSFGVILLELLTGKSPELSPTTSTSVEVPDLVRWVRKGFEE  666

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E+IA  ++A+AC  + PE RP M+ I E LER+
Sbjct  667  ENPLSDMVDPMLLQEVHAKKEVIAAFHVALACTEADPEIRPRMKTISENLERI  719



>gb|KHG08504.1| hypothetical protein F383_35684 [Gossypium arboreum]
Length=716

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    + +QKWD+YS+GV+LLE++TG+SP +    ST M   D+V W+    +E
Sbjct  602  YRAPEARVPGNRATQKWDVYSFGVVLLELLTGKSPELSPTTSTSMEILDLVRWVRKGFEE  661

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +KPLSD++DP L ++   ++E++A+ ++A+AC  + PE RP M+ + E LER+
Sbjct  662  EKPLSDMVDPMLLQEVHAKKEVLAVFHVALACTEADPEIRPRMKTVSENLERI  714



>ref|XP_002312630.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE89997.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=587

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+ PE++    +P+QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    +E
Sbjct  473  YRPPEARVSGNRPTQKWDVYSFGVVLLELLTGKSPELSPSASTSIEVPDLVRWVRKGFEE  532

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E+IA+ ++A+AC  + PE RP M+ + E LER+
Sbjct  533  ENPLSDMVDPLLLQEVHAKKEVIAVFHVALACAEADPEVRPRMKTVSENLERI  585



>ref|XP_011649930.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Cucumis sativus]
Length=610

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ KA KPSQKWD+YS GVILLE+ITG+ P++  GS+EM++V W+ L +DE K + 
Sbjct  500  YQAPEALKAGKPSQKWDVYSLGVILLEIITGKFPVIQWGSSEMELVEWVELGMDEGKRVL  559

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             V+DP +     ++EE  A + IA+AC   +PE+RP MR + E LE+L
Sbjct  560  CVMDPSMC-GEVEKEEAAAAIEIAVACTRKNPEKRPCMRIVSECLEKL  606



>ref|XP_002265151.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Vitis vinifera]
Length=709

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            Y+APE++ A  +P+QKWD+YS+GV+LLE++TG+SP +   +T       D+V W+    +
Sbjct  594  YKAPEARVANSRPTQKWDVYSFGVVLLELLTGKSPELSSPTTSTSTEVPDLVKWVRKGFE  653

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD++DP L ++   ++E++A+ ++A+AC    PE RP M+ + E LER+
Sbjct  654  EENPLSDMVDPLLLQEVQAKKEVLAVFHVALACTEGDPELRPRMKTLSENLERI  707



>ref|XP_004138802.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Cucumis sativus]
 gb|KGN63140.1| hypothetical protein Csa_2G404910 [Cucumis sativus]
Length=645

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ KA KPSQKWD+YS GVILLE+ITG+ P++  GS+EM++V W+ L +DE K + 
Sbjct  535  YQAPEALKAGKPSQKWDVYSLGVILLEIITGKFPVIQWGSSEMELVEWVELGMDEGKRVL  594

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             V+DP +     ++EE  A + IA+AC   +PE+RP MR + E LE+L
Sbjct  595  CVMDPSMC-GEVEKEEAAAAIEIAVACTRKNPEKRPCMRIVSECLEKL  641



>ref|XP_006361554.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Solanum tuberosum]
Length=716

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP + V +T       D+V W+    +
Sbjct  601  YRAPEARITGNRPTQKWDVYSFGVVLLELLTGKSPDLSVPTTSTSTEVPDLVRWVRKGFE  660

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD+++P L ++   ++E++A+ +IA+AC  + P+ RP M+ I E +E++
Sbjct  661  EQNPLSDMVEPMLLQEVHAKKEVLAVFHIALACTEADPDIRPRMKTISENIEKV  714



>gb|KJB30948.1| hypothetical protein B456_005G169100 [Gossypium raimondii]
Length=716

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    + +QKWD+YS+GV+LLE++TG+SP +    ST M   D+V W+    +E
Sbjct  602  YRAPEARVPGNRATQKWDVYSFGVVLLELLTGKSPELSPTTSTSMEILDLVRWVRKGFEE  661

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +KPLSD++DP L ++   ++E++A+  +A+AC  + PE RP M+ + + LER+
Sbjct  662  EKPLSDMVDPMLLQEVHAKKEVLAVFQVALACTEADPEIRPRMKTVSDNLERI  714



>ref|XP_007225190.1| hypothetical protein PRUPE_ppa002123mg [Prunus persica]
 gb|EMJ26389.1| hypothetical protein PRUPE_ppa002123mg [Prunus persica]
Length=713

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    KP+QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    ++
Sbjct  599  YRAPEARVPGNKPTQKWDVYSFGVVLLELLTGKSPELSPTTSTSVEVPDLVRWVRKGFED  658

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A  +IA+AC  + PE RP M+ + E LER+
Sbjct  659  ENPLSDMVDPMLLQEVHAKKEVLAAFHIALACTETDPEVRPRMKTVSENLERV  711



>ref|XP_004239201.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Solanum lycopersicum]
Length=717

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP + V +T       D+V W+    +
Sbjct  602  YRAPEARITGNRPTQKWDVYSFGVVLLELLTGKSPDLSVPTTSTSTEVPDLVRWVRKGFE  661

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD+++P L ++   ++E++A+ +IA+AC  + P+ RP M+ + E +E++
Sbjct  662  EQNPLSDMVEPMLLQEVHAKKEVLAVFHIALACTEADPDIRPRMKTVSENIEKV  715



>ref|XP_008222077.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Prunus mume]
Length=713

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    KP+QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    ++
Sbjct  599  YRAPEARVPGNKPTQKWDVYSFGVVLLELLTGKSPELSPTTSTSVEVPDLVRWVRKGFED  658

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A  ++A+AC  + PE RP M+ + E LER+
Sbjct  659  ENPLSDMVDPLLLQEVHAKKEVLAAFHVALACTETDPEVRPRMKTVSENLERV  711



>ref|XP_004310210.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Fragaria vesca subsp. vesca]
Length=708

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 77/114 (68%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP +   ST       D+V W+    +
Sbjct  593  YRAPEARVSGSRPTQKWDVYSFGVVLLELLTGKSPEMSPTSTSTSMEIPDLVRWVRKGFE  652

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            ++ PLSD++DP L ++   ++E++A  ++A+AC    PE RP M+ + E LER+
Sbjct  653  DENPLSDMVDPILLQEVHAKKEVLAAFHVALACTEPDPEVRPRMKTVSENLERV  706



>ref|XP_008368321.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=213

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    K +QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    ++
Sbjct  99   YRAPEARVTGSKLTQKWDVYSFGVVLLELLTGKSPELSPTTSTSVEVPDLVRWVRKGFED  158

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A  ++A+AC    PE RP M+ + E LER+
Sbjct  159  ENPLSDMVDPVLLQEVHAKKEVLAAFHVALACTEPDPEVRPRMKSVSENLERI  211



>gb|KCW61968.1| hypothetical protein EUGRSUZ_H04654 [Eucalyptus grandis]
Length=636

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWDIYS+GV+LLE++TG+SP +    ST +   DIV W+    ++
Sbjct  522  YRAPEARVPGSRPTQKWDIYSFGVVLLELLTGKSPELSPTTSTSIEVPDIVRWVRKGFED  581

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A  ++A+AC  + PE RP M+ + E LER+
Sbjct  582  EVPLSDMVDPMLLQEVHAKKEVLAAFHVALACTEADPEIRPRMKTVSENLERV  634



>ref|XP_008446051.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=715

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM----DIVNWLHLCIDE  520
            Y APE++    +P+QKWD+YS+GV++LE++TG+SP +   ++      D+V W+    +E
Sbjct  601  YCAPEARAPGGRPTQKWDVYSFGVMVLELLTGKSPELSPNTSTSLEIPDLVRWVRKGFEE  660

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             KPLSD++DP L ++   ++E++A+ ++A+AC  S PE RP M+ + E+ +R+
Sbjct  661  AKPLSDLVDPALLQEVHAKKEVLAVFHVALACTESDPEVRPRMKTVSESFDRI  713



>ref|XP_004135515.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis sativus]
 gb|KGN51683.1| hypothetical protein Csa_5G590000 [Cucumis sativus]
Length=714

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM----DIVNWLHLCIDE  520
            Y APE++    +P+QKWD+YS+GV++LE++TG+SP +   ++      D+V W+    +E
Sbjct  600  YCAPEARAPGGRPTQKWDVYSFGVMVLELLTGKSPELSPNTSTSLEIPDLVRWVRKGFEE  659

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             KPLSD++DP L ++   ++E++A+ ++A+AC  S PE RP M+ + E+ +R+
Sbjct  660  AKPLSDLVDPALLQEVHAKKEVLAVFHVALACTESDPEVRPRMKTVSESFDRI  712



>ref|XP_011071213.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Sesamum indicum]
Length=693

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-----MDIVNWLHLCID  523
            Y+APE++  + +P+QKWD+YS+GV+LLE++TG+SP +   ++      +D+V W+    D
Sbjct  578  YRAPEARVPSGRPTQKWDVYSFGVVLLELLTGKSPELSSPTSSTSTEILDLVRWVRKGFD  637

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD++DP L ++   ++E++A+ +IA+ C    PE RP M+ + E LE++
Sbjct  638  EESPLSDMVDPVLLQEVHAKKEVLAVFHIALTCTEGDPEIRPRMKTVSENLEKV  691



>ref|XP_010025331.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Eucalyptus grandis]
 gb|KCW61969.1| hypothetical protein EUGRSUZ_H04654 [Eucalyptus grandis]
Length=733

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWDIYS+GV+LLE++TG+SP +    ST +   DIV W+    ++
Sbjct  619  YRAPEARVPGSRPTQKWDIYSFGVVLLELLTGKSPELSPTTSTSIEVPDIVRWVRKGFED  678

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A  ++A+AC  + PE RP M+ + E LER+
Sbjct  679  EVPLSDMVDPMLLQEVHAKKEVLAAFHVALACTEADPEIRPRMKTVSENLERV  731



>ref|XP_008441289.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=753

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ KA KPSQKWD+YS GVILLE+ITG+ P++  GS+EM++V W+ L +DE K + 
Sbjct  643  YQAPEALKAGKPSQKWDVYSLGVILLEIITGKYPVIQWGSSEMELVEWVELGMDEGKRVL  702

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             ++DP +     ++EE  A + IA+AC   +PE+RP MR + E LE+L
Sbjct  703  CMMDPSMC-GEVEKEEAAAAIEIAVACTRKNPEKRPCMRIVSECLEKL  749



>gb|EYU42102.1| hypothetical protein MIMGU_mgv1a001951mg [Erythranthe guttata]
Length=734

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 77/116 (66%), Gaps = 8/116 (7%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSP-------IVHVGSTEMDIVNWLHLC  529
            Y+APE++ A  +P+QKWD+YS+GV+LLEM+TG+SP           G    D+V W+   
Sbjct  619  YRAPEARAAGARPTQKWDVYSFGVVLLEMLTGKSPEGSSPASSSFSGEVVQDLVRWVRKG  678

Query  528  IDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             +E++ LSD++DP L ++   ++E++A+ ++A+AC    PE RP M+ + E L+++
Sbjct  679  FEEERALSDMVDPILLQEVHAKKEVLAVFHVALACTEVDPEIRPRMKTVSENLDKV  734



>ref|XP_003516395.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=711

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH-VGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GV+LLE++TGRSP      ST M   D+V W+    D+
Sbjct  597  YKAPEARVPGCRPTQKWDVYSFGVVLLEILTGRSPESSPTTSTSMEVPDLVKWVRKGFDQ  656

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP L ++   ++E++A+ ++A++C    PE RP M+ + E L+++
Sbjct  657  ESPLSEMVDPSLLQEVRVKKEVLAVFHVALSCTEGDPEARPRMKTVSENLDKI  709



>ref|XP_009800742.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana sylvestris]
Length=717

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP + + +T       D+V W+    +
Sbjct  602  YRAPEARIPGNRPTQKWDVYSFGVVLLELLTGKSPDLSIPTTSTSTEAPDLVRWVRKGFE  661

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD+++P L ++   ++E++A+ ++A+AC  + P+ RP M+ + E +E++
Sbjct  662  EQNPLSDMVEPMLLQEIHAKKEVLAVFHVALACTEADPDIRPRMKTVSENIEKI  715



>ref|XP_011029672.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Populus euphratica]
Length=714

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPES-QKALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+ PE+     +P+QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    ++
Sbjct  600  YRPPEALVSGNRPNQKWDVYSFGVVLLELLTGKSPELSPSASTSIEVPDLVTWVRKGFED  659

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E+IA+ ++A+AC  + PE RP M+ + E LER+
Sbjct  660  ENPLSDMVDPLLLQEVHAKKEVIAVFHVALACAEADPEVRPRMKTVSENLERI  712



>emb|CBI27592.3| unnamed protein product [Vitis vinifera]
Length=674

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 78/114 (68%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            + APE++ A  +P+QKWD+YS+GV+LLE++TG+SP +   +T       D+V W+    +
Sbjct  559  FIAPEARVANSRPTQKWDVYSFGVVLLELLTGKSPELSSPTTSTSTEVPDLVKWVRKGFE  618

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD++DP L ++   ++E++A+ ++A+AC    PE RP M+ + E LER+
Sbjct  619  EENPLSDMVDPLLLQEVQAKKEVLAVFHVALACTEGDPELRPRMKTLSENLERI  672



>ref|XP_009591095.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana tomentosiformis]
Length=717

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP + + +T       D+V W+    +
Sbjct  602  YRAPEARIPGNRPTQKWDVYSFGVVLLELLTGKSPDLSIPTTSTSTEVPDLVRWVRKGFE  661

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD+++P L ++   ++E++A+ ++A+AC  + P+ RP M+ + E +E++
Sbjct  662  EQNPLSDMVEPMLLQEIHAKKEVLAVFHVALACTEADPDIRPRMKTVSENIEKI  715



>ref|XP_007134648.1| hypothetical protein PHAVU_010G064900g [Phaseolus vulgaris]
 gb|ESW06642.1| hypothetical protein PHAVU_010G064900g [Phaseolus vulgaris]
Length=713

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH-VGSTEM---DIVNWLHLCIDE  520
            Y+APE+     +P+QKWD+YS+GV+LLE++TGRSP      ST M   D+V W+    D+
Sbjct  599  YKAPEAGVPGCRPTQKWDVYSFGVVLLEILTGRSPESSPTTSTSMEVPDLVRWVRKGFDQ  658

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP L ++   ++E++A+ ++A+AC    PE RP M+ + E L+++
Sbjct  659  ESPLSEMVDPSLLQEVRVKKEVLAVFHVALACTEGDPEVRPRMKTVSENLDKI  711



>gb|KHN03089.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=328

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH-VGSTEM---DIVNWLHLCIDE  520
            Y+APE++    + +QKWD+YS+GV+LLE++TGRSP      ST M   D+V W+    D+
Sbjct  214  YKAPEARVPGCRTTQKWDVYSFGVVLLEILTGRSPESSPTTSTSMEVPDLVRWVRKGFDQ  273

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP L ++   ++E++A+ ++A++C    PE RP M+ + E L+++
Sbjct  274  ESPLSEMVDPSLLQEVRVKKEVLAVFHVALSCTEEDPEARPRMKTVCENLDKI  326



>ref|XP_006844018.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Amborella trichopoda]
 gb|ERN05693.1| hypothetical protein AMTR_s00006p00212720 [Amborella trichopoda]
Length=783

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 47/110 (43%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            YQAPE+ K LKP+QKWD+YSYG++ LE+ITG+ P      +E D  +W    ++EK    
Sbjct  673  YQAPETLKTLKPTQKWDVYSYGIVFLELITGKPP------SEKDFNHWNARVLEEKGRAL  726

Query  504  DVLDPYL-AEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLP  358
              +DP L +E   KEE ++  L I   C  S P++RP+M+ +L++LE++P
Sbjct  727  WAMDPALRSELQGKEEAVMLCLRIGFCCAASVPQKRPAMKEVLQSLEKIP  776



>ref|XP_003623383.1| Receptor protein kinase-like protein [Medicago truncatula]
 gb|AES79601.1| receptor-like kinase [Medicago truncatula]
Length=721

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM----DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP    G++      D+V W+    ++
Sbjct  609  YKAPEAKVPGCRPTQKWDVYSFGVVLLELLTGKSPDSSPGASTSVEVPDLVRWVKKGFEQ  668

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP L ++   ++E++A+ ++A++C    PE RP M+ + + LER+
Sbjct  669  ESPLSEMVDPSLLQEIHAKKEVLAVFHVALSCTEGDPEVRPRMKTVSDNLERI  721



>gb|KHN12556.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=439

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 76/113 (67%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVG-STEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP   +  ST M   D+V W+    ++
Sbjct  326  YKAPEARVPGCRPTQKWDVYSFGVVLLELLTGKSPDSSLAASTSMEVPDLVRWVRKGFEQ  385

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP +  +   ++E++A  ++A+ C    PE RP M+ + E LER+
Sbjct  386  ESPLSEIVDPSMLHEVHAKKEVLAAFHVALQCTEGDPEVRPRMKTVSENLERI  438



>ref|XP_006438068.1| hypothetical protein CICLE_v10030842mg [Citrus clementina]
 gb|ESR51308.1| hypothetical protein CICLE_v10030842mg [Citrus clementina]
Length=707

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    +E
Sbjct  593  YRAPEARVPGNRPMQKWDVYSFGVVLLELLTGKSPELSPTTSTSIEVPDLVRWVKKGFEE  652

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++D  L ++   ++E+IA+ ++A+AC  + PE RP M+ + E LER+
Sbjct  653  ENPLSDMVDAMLLQEVHAKKEVIAVFHLALACTEADPEVRPRMKNVSENLERI  705



>emb|CDP13327.1| unnamed protein product [Coffea canephora]
Length=718

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 78/114 (68%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-----DIVNWLHLCID  523
            YQ+PE++    +P+QKWD+YS+GV+LLE++TG+SP +   +T       D+V W+    +
Sbjct  605  YQSPEARIPGNRPTQKWDVYSFGVVLLELLTGKSPELSSPTTSTSTEIPDLVRWVRKGFE  664

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PLSD++DP L ++   ++E++A  ++A+AC  + PE RP M+ I E LE++
Sbjct  665  EENPLSDMVDPMLLKEVHAKKEVLAAFHVALACTEADPEVRPRMKTISENLEKI  718



>ref|XP_006484071.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Citrus sinensis]
Length=707

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    +E
Sbjct  593  YRAPEARVPGNRPMQKWDVYSFGVVLLELLTGKSPELSPTTSTSIEVPDLVRWVKKGFEE  652

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++D  L ++   ++E+IA+ ++A+AC  + PE RP M+ + E LER+
Sbjct  653  ENPLSDMVDAMLLQEVHAKKEVIAVFHLALACTEADPEVRPRMKNVSENLERI  705



>gb|KDO81950.1| hypothetical protein CISIN_1g005226mg [Citrus sinensis]
Length=707

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    +E
Sbjct  593  YRAPEARVPGNRPMQKWDVYSFGVVLLELLTGKSPELSPTTSTSIEVPDLVRWVKKGFEE  652

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++D  L ++   ++E+IA+ ++A+AC  + PE RP M+ + E LER+
Sbjct  653  ENPLSDMVDAMLLQEVHAKKEVIAVFHLALACTEADPEVRPRMKNVSENLERI  705



>ref|XP_004492498.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Cicer arietinum]
Length=721

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM----DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP    G++      D+V W+    ++
Sbjct  607  YKAPEAKVPGCRPTQKWDVYSFGVVLLELLTGKSPDSSPGASTSVEVPDLVRWVKKGFEQ  666

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP L ++   ++E++A+ ++A++C    PE RP M+ + E LE++
Sbjct  667  ESPLSEMVDPSLLQEIHAKKEVLAVFHVALSCTEGDPEVRPRMKTVSENLEKI  719



>ref|XP_002315617.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF01788.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=217

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+G++LLE++TG+SP +    ST +   D+V W+     +
Sbjct  103  YRAPEARVSGNRPTQKWDVYSFGIVLLELLTGKSPELSPTTSTSIEIPDLVRWVRKGFAD  162

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++D  L ++   ++E++A+ ++A+AC  +  E RP M+ + E LER+
Sbjct  163  ENPLSDMVDSMLLQEVHAKKEVLAVFHVALACTEADSEVRPRMKIVSENLERI  215



>ref|XP_011041520.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Populus euphratica]
Length=715

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+G++LLE++TG+SP +    ST +   D+V W+     +
Sbjct  601  YRAPEARVSGNRPTQKWDVYSFGIVLLELLTGKSPELSPTTSTSIEIPDLVRWVRKGFAD  660

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E+IA+ ++A+AC  +  E RP M+ + E LER+
Sbjct  661  ENPLSDMVDPMLLQEVHAKKEVIAVFHVALACTEADSEVRPRMKIVSENLERI  713



>ref|XP_010930148.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=719

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 77/116 (66%), Gaps = 8/116 (7%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-------DIVNWLHLC  529
            Y+APE++    +P+QKWD++S+GV+LLE++TG+ P     S+         ++V W+   
Sbjct  602  YRAPEARVSGSRPTQKWDVFSFGVVLLELLTGKPPEFSSPSSSSTSLEVAPELVRWVRKG  661

Query  528  IDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             D+ KP SD++DP L  + + ++EMI++ +IA+AC  + PE+RP M+ + E L+R+
Sbjct  662  FDDAKPFSDLVDPVLFREVNAKKEMISMFHIALACTEADPEQRPRMKIVSENLDRI  717



>ref|XP_001759884.1| predicted protein [Physcomitrella patens]
 gb|EDQ75388.1| predicted protein [Physcomitrella patens]
Length=699

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
             Y APE+      +QK D+YS+GV+LLE++TGRSP   +   E+D+V+W+   + E + L
Sbjct  586  VYLAPEATSGKGFTQKSDVYSFGVVLLELLTGRSPFKQLAGGELDLVSWIRQALQENRNL  645

Query  507  SDVLDPYLAEDADKEE-EMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            S++ DP L +  D E  +MI  L +A+AC+   P+ RP M+ I    E+L
Sbjct  646  SEIFDPRLQKADDNEHSQMIETLQVALACIAVDPDDRPRMKQIAVLFEKL  695



>ref|XP_003529180.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=706

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 76/113 (67%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVG-STEM---DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP   +  ST M   D+V W+    ++
Sbjct  593  YKAPEARVPGCRPTQKWDVYSFGVVLLELLTGKSPDSSLAASTSMEVPDLVRWVRKGFEQ  652

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP +  +   ++E++A  ++A+ C    PE RP M+ + E LER+
Sbjct  653  ESPLSEIVDPSMLHEVHAKKEVLAAFHVALQCTEGDPEVRPRMKTVSENLERI  705



>ref|XP_009372312.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=717

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    K +QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    ++
Sbjct  603  YRAPEARVTGSKVTQKWDVYSFGVVLLELLTGKSPELSPTTSTSVEVPDLVRWVRKGFED  662

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A  ++A+AC    PE RP M+ + E LER+
Sbjct  663  ENPLSDMVDPVLLQEVHAKKEVLAAFHVALACTEPDPEVRPRMKSVSENLERI  715



>ref|XP_008340196.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Malus domestica]
Length=717

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-IVHVGSTEM---DIVNWLHLCIDE  520
            Y+APE++    K +QKWD+YS+GV+LLE++TG+SP +    ST +   D+V W+    ++
Sbjct  603  YRAPEARVTGSKLTQKWDVYSFGVVLLELLTGKSPELSPTTSTSVEVPDLVRWVRKGFED  662

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++DP L ++   ++E++A  ++A+AC    PE RP M+ + E LER+
Sbjct  663  ENPLSDMVDPVLLQEVHAKKEVLAAFHVALACTEPDPEVRPRMKSVSENLERI  715



>ref|XP_006576501.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=711

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH-VGSTEM---DIVNWLHLCIDE  520
            Y+APE++    + +QKWD+YS+GV+LLE++TGRSP      ST M   D+V W+    D+
Sbjct  597  YKAPEARVPGCRTTQKWDVYSFGVVLLEILTGRSPESSPTTSTSMEVPDLVRWVRKGFDQ  656

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP L ++   ++E++A+ ++A++C    PE RP M+ + E L+++
Sbjct  657  ESPLSEMVDPSLLQEVRVKKEVLAVFHVALSCTEEDPEARPRMKTVCENLDKI  709



>ref|XP_010250769.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nelumbo nucifera]
Length=716

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 74/114 (65%), Gaps = 6/114 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-----IVHVGSTEMDIVNWLHLCID  523
            Y+APE++    +P QKWD+YS+GV+LLEM+TG+SP         G    D+V W+    +
Sbjct  601  YRAPEARVPGSRPGQKWDVYSFGVVLLEMLTGKSPEFPSSTTLTGPDVPDLVRWVRKGFE  660

Query  522  EKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            E+ PL+ + DP L ++   ++E++A+ ++A+AC  + PE RP M+ + E L+R+
Sbjct  661  EESPLAQMADPMLLKEVLAKKEVLAVFHVALACTEADPEVRPRMKTVSENLDRI  714



>gb|KHN40703.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=494

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 75/113 (66%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVH-VGSTEMDI---VNWLHLCIDE  520
            Y+APE++     P+QKWD+YS+GV+LLE++TG++P      ST MD+   V W+    ++
Sbjct  381  YKAPEARVLGCIPTQKWDVYSFGVVLLELLTGKAPDSSPAASTSMDVPDLVRWVRKGFEQ  440

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP +  +   ++E++A+ ++A+ C    PE RP M+ + E LER+
Sbjct  441  ESPLSEIVDPSMLHEVHAKKEVLAVFHVALQCTEGDPEVRPRMKTVSENLERI  493



>ref|XP_003552276.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=706

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 75/113 (66%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVH-VGSTEMDI---VNWLHLCIDE  520
            Y+APE++     P+QKWD+YS+GV+LLE++TG++P      ST MD+   V W+    ++
Sbjct  593  YKAPEARVLGCIPTQKWDVYSFGVVLLELLTGKAPDSSPAASTSMDVPDLVRWVRKGFEQ  652

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLS+++DP +  +   ++E++A+ ++A+ C    PE RP M+ + E LER+
Sbjct  653  ESPLSEIVDPSMLHEVHAKKEVLAVFHVALQCTEGDPEVRPRMKTVSENLERI  705



>gb|EPS65472.1| hypothetical protein M569_09303 [Genlisea aurea]
Length=749

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 83/145 (57%), Gaps = 6/145 (4%)
 Frame = -1

Query  777  IAGGTPPLXSNRMastetstiastaatleSCYQAPESQK-ALKPSQKWDIYSYGVILLEM  601
            I G  PP     M       + +      + Y+APE++    +P+QKWD+YS+GV+LLE+
Sbjct  603  ITGNNPPSSGGFMGGAPLPYVKTPQPEKTNEYRAPEARVIGARPTQKWDVYSFGVVLLEL  662

Query  600  ITGRSPIVHVGSTE-----MDIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNI  436
            +TG+SP     ST      +D+V+W+    DE     +++DP L ++   ++E++A+ ++
Sbjct  663  LTGKSPEFSPPSTSTSTEILDLVSWVRKGFDEDNTSPEMVDPVLIQEVSAKKEVVAVFHL  722

Query  435  AMACVHSSPERRPSMRYILEALERL  361
            A+AC    PE RP M+ + E L+++
Sbjct  723  AIACTEGDPEIRPRMKTVSENLDKI  747



>ref|XP_006355906.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like 
[Solanum tuberosum]
Length=1028

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+L+E++TG+ P+       +DIV W  + I + K L 
Sbjct  887  YIAPEYGYTLKVDEKSDIYSYGVVLMELLTGKRPLDPEFGESVDIVEWFRMKIRDNKSLE  946

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALE  367
            + LDP++      +EEM+ +L IA+ C+   P+ RPSMR +L  LE
Sbjct  947  EALDPHVGATQHVQEEMLLVLRIAILCIAKLPKDRPSMRDVLTMLE  992



>ref|XP_009105290.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=716

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 79/118 (67%), Gaps = 10/118 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH--------VGSTEM-DIVNWLH  535
            Y+APE++    KP+QKWD+YS+GV+L+E++TG+SP            G  E+ D+V W+ 
Sbjct  599  YKAPEARLPGSKPAQKWDVYSFGVVLMELLTGKSPDSSPLSSSSSSTGVAEVTDLVKWVR  658

Query  534  LCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
               +E+ PLSD++DP L ++   +++++++ ++A+AC  S PE RP M+ + E ++R+
Sbjct  659  KGFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTESDPEVRPRMKNVSENIDRI  716



>gb|EYU17948.1| hypothetical protein MIMGU_mgv1a022168mg [Erythranthe guttata]
Length=1019

 Score = 93.6 bits (231),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K DIYSYGV+L+E++TG+ P+       +DIV W+   + E KPL 
Sbjct  878  YIAPEYGYALKVDEKSDIYSYGVVLMELVTGKRPLEREFGECVDIVEWIRRKMRENKPLE  937

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LD  L      +EEM+ +L IA+ C   SP+ RPSMR +L  L
Sbjct  938  EALDKNLGNIKHVQEEMLLVLRIAVLCTAKSPKDRPSMRDVLTML  982



>emb|CDX96089.1| BnaA07g26420D [Brassica napus]
Length=716

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 79/118 (67%), Gaps = 10/118 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH--------VGSTEM-DIVNWLH  535
            Y+APE++    KP+QKWD+YS+GV+L+E++TG+SP            G  E+ D+V W+ 
Sbjct  599  YKAPEARLPGSKPAQKWDVYSFGVVLMEILTGKSPDSSPLSSSSSSTGVAEVTDLVKWVR  658

Query  534  LCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
               +E+ PLSD++DP L ++   +++++++ ++A+AC  S PE RP M+ + E ++R+
Sbjct  659  KGFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTESDPEVRPRMKNVSENIDRI  716



>ref|XP_004496523.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Cicer arietinum]
Length=727

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 73/119 (61%), Gaps = 11/119 (9%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP----------IVHVGSTEMDIVNWL  538
            Y+APE+     +P+QKWD+YS GV++LE++TG+SP                   ++V W+
Sbjct  607  YKAPEAHVPGCRPTQKWDVYSLGVVMLELLTGKSPESSPMSLSLSSSVSVVEGYELVRWV  666

Query  537  HLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
                D++ PLS+++DP L ++   ++E++A+ ++A+AC    PE RP M+ + E LE++
Sbjct  667  RNGFDQQSPLSEMVDPSLLQEVRAKKEVLAVFHVALACTEGDPEVRPRMKIVFENLEKI  725



>ref|XP_010667968.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Beta vulgaris subsp. vulgaris]
Length=1023

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +LK  +K DIYSYGV+LLE+ITG+ PI       +D+V W+       +PL 
Sbjct  883  YIAPEYGYSLKVDEKSDIYSYGVVLLELITGKRPIDKEFGDSIDVVGWIRNKGRNNRPLE  942

Query  504  DVLDPYLAEDADK-EEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP LA D+   +EEM+ +L IA+ C   +P+ RPSMR ++  L
Sbjct  943  EALDPSLAGDSKHVQEEMLLVLRIALLCTAKAPKDRPSMRDVISML  988



>ref|XP_004152065.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Cucumis sativus]
 gb|KGN58305.1| hypothetical protein Csa_3G610810 [Cucumis sativus]
Length=1024

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+LLE++TG+ P+       +DIV W+   + + +PL 
Sbjct  886  YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGKKPLDPEFGESVDIVEWIKRKVKDNRPLE  945

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP L      +EEM+ +L IA+ C    P+ RPSMR I+  L
Sbjct  946  EALDPNLGNFKHVQEEMLFVLRIALLCTAKHPKDRPSMRDIITML  990



>ref|XP_009406412.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
 ref|XP_009406413.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=715

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM--DIVNWLHLCIDEKKP  511
            Y+APES+    P+ K D+YS+GV+LLE++TG+ P +   S E    +V W+    +E +P
Sbjct  601  YRAPESRATGHPTHKSDVYSFGVVLLEILTGKQPEMPSSSAEQVAGLVKWVRKGFEEARP  660

Query  510  LSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             S+++DP L +D    EE++A  ++A+AC  + P+ RP M+   E L+R+
Sbjct  661  PSELVDPALLQDVRAREEVVAAFHVALACTETDPDVRPRMKAASEDLDRI  710



>ref|XP_008350956.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=715

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP----IVHVGSTEMDIVNWLHLCIDE  520
            Y+APE++    KP+QKWD+YS+GV+LLE++TG+SP         +   D+V+ +    ++
Sbjct  601  YRAPEARVTGSKPTQKWDVYSFGVVLLELLTGKSPELSPTTSTSAEVSDLVSSVRKGFED  660

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + PLSD++D  L ++   ++E++A  ++A+AC    PE RP M+ + E LER+
Sbjct  661  ENPLSDMVDHVLMQEVHAKKEVLAAFHVALACTELDPEVRPRMKTVSENLERV  713



>ref|XP_010248952.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nelumbo nucifera]
Length=719

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 74/115 (64%), Gaps = 7/115 (6%)
 Frame = -1

Query  684  YQAPESQKA-LKPSQKWDIYSYGVILLEMITGRSP------IVHVGSTEMDIVNWLHLCI  526
            Y+APE++ A  +P+QKWD+YS+GV+LLEM+TG++P               D+V W+    
Sbjct  603  YKAPEARLAGSRPTQKWDVYSFGVVLLEMLTGKAPEFSSPTTSTATGATSDLVRWVRKGF  662

Query  525  DEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +E+  LS+++DP L ++   ++E++A+ + A+AC    PE RP M+ + E L+R+
Sbjct  663  EEENLLSEMVDPMLLKEVHAKKEVLAVFHAALACTEPDPEVRPRMKTVSENLDRI  717



>ref|XP_010239181.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brachypodium distachyon]
Length=228

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 73/122 (60%), Gaps = 13/122 (11%)
 Frame = -1

Query  687  CYQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGST------------EMDIV  547
             Y+APE++    +PSQK D+YS+GV+LLE++TGRSP     S             E +IV
Sbjct  105  AYRAPEARVPGARPSQKSDVYSFGVLLLELLTGRSPDHQAASASFSGDGGQQQQQEPEIV  164

Query  546  NWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALE  367
             W+    ++ +PLS++ D  +  DA   +E++A  ++A+ CV    ERRP M+ + ++L+
Sbjct  165  RWVRQGFEDARPLSELADEAVLRDAGARKEVVAAFHVALGCVEPDLERRPRMKAVADSLD  224

Query  366  RL  361
            ++
Sbjct  225  KI  226



>ref|XP_008447373.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Cucumis melo]
Length=1024

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+LLE++TG+ P+       +DIV W+   + + +PL 
Sbjct  886  YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGKKPLDPEFGESVDIVEWIKRKVRDNRPLE  945

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP L      +EEM+ +L IA+ C    P+ RPSMR I+  L
Sbjct  946  EALDPNLGNFKHVQEEMLFVLRIALLCTAKHPKDRPSMRDIITML  990



>ref|XP_008783789.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Phoenix dactylifera]
Length=719

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 76/116 (66%), Gaps = 8/116 (7%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-------DIVNWLHLC  529
            Y+APE++    +P+QKWD++S+GV+LLE++TG+ P     S+         ++V W+   
Sbjct  602  YRAPEARASGSRPNQKWDVFSFGVVLLELVTGKPPEFSSPSSSSMPLEHVPELVRWVRKG  661

Query  528  IDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             D+ KPL D++DP L  +   ++E+I++ +IA+AC  + PE+RP M+ + E L+++
Sbjct  662  FDDAKPLQDLVDPVLLREVHAKKEVISMFHIALACTEADPEQRPRMKVVSENLDKI  717



>gb|KJB61249.1| hypothetical protein B456_009G348000 [Gossypium raimondii]
Length=656

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 70/100 (70%), Gaps = 11/100 (11%)
 Frame = -1

Query  780  NIAGGTPPLXSNRM-----------astetstiastaatleSCYQAPESQKALKPSQKWD  634
            +IAG +P + S+RM           +++  +T   ++  L S YQAPE+ K +K SQKWD
Sbjct  552  DIAGNSPIMQSDRMPSDEPQERLQKSASSEATAIYSSTNLRSFYQAPEALKVVKQSQKWD  611

Query  633  IYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKK  514
            +YSYGVILLEM+TG+ P+V VG++EMD+V+W+ LCI+EK 
Sbjct  612  VYSYGVILLEMLTGKYPVVCVGNSEMDLVHWIQLCIEEKN  651



>ref|XP_004247132.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Solanum lycopersicum]
Length=1020

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 0/106 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYS+GV+L+E++TG+ P+  +    +DIV W  + I + K L 
Sbjct  879  YIAPEYGYTLKVDEKSDIYSFGVVLMELLTGKRPLDPLFGESVDIVEWFRMKIRDNKSLE  938

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALE  367
            + LDP +      +EEM+ +L IA+ C    P+ RPSMR +L  LE
Sbjct  939  EALDPNVGATQHVQEEMLLVLRIAILCTAKLPKDRPSMRDVLTMLE  984



>ref|XP_002975437.1| hypothetical protein SELMODRAFT_30410, partial [Selaginella moellendorffii]
 gb|EFJ23638.1| hypothetical protein SELMODRAFT_30410, partial [Selaginella moellendorffii]
Length=936

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 72/109 (66%), Gaps = 7/109 (6%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APES K    SQK D+YS+GV+LLE++TG+ P++  G++   +V+W+   I + +PLS
Sbjct  833  YTAPESAKV---SQKADVYSFGVVLLELLTGKRPMMEDGTS---LVSWVRNSIADDQPLS  886

Query  504  DVLDPYLAE-DADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            D++DP L   +   +EE+ ++  IA+     SP RRPSM+ I+E L R+
Sbjct  887  DIVDPILRNVNGPFQEEISSVFKIALISTDPSPARRPSMKDIVEVLSRI  935



>ref|XP_009621771.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Nicotiana tomentosiformis]
Length=1025

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 0/106 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+L+E++TG+ P+       +DIV W  + I + K L 
Sbjct  885  YIAPEYGYTLKVDEKIDIYSYGVVLMELLTGKRPLDPEFGESVDIVEWFRMKIRDNKSLE  944

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALE  367
            + LDP +      +EEM+ +L IA+ C+   P+ RPSMR +L  LE
Sbjct  945  EALDPNVGTIQHVQEEMLLVLRIAILCIAKLPKDRPSMRDVLTMLE  990



>ref|XP_003520615.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like 
[Glycine max]
Length=1026

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K D+YSYGV+LLE++TG+ P+       +DIV WL + I + K L 
Sbjct  885  YIAPEYGYALKVDEKIDVYSYGVVLLELLTGKRPLDSDFGESIDIVEWLRMKIRDNKSLE  944

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            +VLDP +       EEM+ +L IA+ C    P+ RP+MR ++  L
Sbjct  945  EVLDPSVGNSRHVVEEMLLVLRIAILCTAKLPKERPTMRDVIMML  989



>ref|XP_009769366.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Nicotiana sylvestris]
Length=1025

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 0/106 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+L+E++TG+ P+       +DIV W  + I + K L 
Sbjct  885  YIAPEYGYTLKVDEKIDIYSYGVVLMELLTGKRPLDPEFGESVDIVEWFRMKIRDNKSLE  944

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALE  367
            + LDP +      +EEM+ +L IA+ C+   P+ RPSMR +L  LE
Sbjct  945  EALDPNVGTIQHVQEEMLLVLRIAILCIAKLPKDRPSMRDVLTMLE  990



>gb|AGT16770.1| hypothetical protein SHCRBa_022_K23_R_30 [Saccharum hybrid cultivar 
R570]
Length=962

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 67/105 (64%), Gaps = 3/105 (3%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +LK ++K D+YS+GV+LLE++TGRSP       E DIV+W+   + E+ P +
Sbjct  843  YMAPELAYSLKATEKSDVYSFGVVLLELLTGRSPTDQQFDGERDIVSWVSFHLAEQNPAA  902

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
             VLDP ++ DA   + MI  LNIA+ C    P  RP+MR +++ L
Sbjct  903  -VLDPKVSNDA--SDYMIKALNIAILCTSQLPSERPTMREVVKML  944



>ref|XP_003604546.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES86743.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=723

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 74/116 (64%), Gaps = 8/116 (7%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-------DIVNWLHLC  529
            Y+APE++    +P+QKWD+YS GV+LLE++TG+S      S          D+V W+   
Sbjct  606  YKAPEARVPGCRPTQKWDVYSLGVVLLELLTGKSTESSPTSASSSASVEVSDLVRWVRNG  665

Query  528  IDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             D++ PLS+++DP L ++   ++E++A+ ++A++C    PE RP M+ + E LE++
Sbjct  666  FDQESPLSEMVDPSLLQEVRAKKEVLAVFHVALSCTEGDPEVRPRMKTVFENLEKI  721



>ref|XP_010928472.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=642

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = -1

Query  687  CYQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKP  511
             Y APE++      +QK D+Y++GV+++E++TGR P    G  E ++  W+     E++P
Sbjct  530  AYLAPEARAPGAAATQKGDVYAFGVVVMEVVTGR-PAAGCGDGEGELEGWVRRAFGEERP  588

Query  510  LSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            LS+V+DP L  +   +++++A+ ++A+ C    PE RP MR ++E+L+R+
Sbjct  589  LSEVVDPALLHEVHAKKQVLAVFHVALGCTEPDPEMRPRMRAVVESLDRV  638



>gb|KHN10782.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Glycine 
soja]
Length=798

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K D+YSYGV+LLE++TG+ P+       +DIV WL + I + K L 
Sbjct  657  YIAPEYGYALKVDEKIDVYSYGVVLLELLTGKRPLDSDFGESIDIVEWLRMKIRDNKSLE  716

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            +VLDP +       EEM+ +L IA+ C    P+ RP+MR ++  L
Sbjct  717  EVLDPSVGNSRHVVEEMLLVLRIAILCTAKLPKERPTMRDVIMML  761



>ref|XP_004292244.2| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Fragaria vesca subsp. vesca]
Length=1518

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = -1

Query  684   YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
             Y APE    LK  +K DIYSYGV+LLE++TG+ P+       +DIV W+   I + K L 
Sbjct  1379  YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGKRPLDPEFGESVDIVEWIRRKIRDNKCLE  1438

Query  504   DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
             +VLDP +      +EEM+ +L IA+ C    P+ RPSMR ++  L
Sbjct  1439  EVLDPSVGNSKHVQEEMLLVLRIALVCTTKLPKDRPSMRDVITML  1483



>emb|CDY01814.1| BnaC06g28540D [Brassica napus]
Length=720

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 78/118 (66%), Gaps = 10/118 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVH--------VGSTEM-DIVNWLH  535
            Y+APE++    KP+QKWD+YS+GV+L+E++TG+SP            G  E+ D+V W+ 
Sbjct  603  YKAPEARLPGSKPAQKWDVYSFGVVLMELLTGKSPDSSPLSSSSSSTGVAEVTDLVKWVR  662

Query  534  LCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
               +E+ PLSD++DP L ++   +++++++ ++A+AC    PE RP M+ + E ++++
Sbjct  663  KGFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTEGDPEVRPRMKNVSENIDKI  720



>ref|XP_002988292.1| hypothetical protein SELMODRAFT_127443 [Selaginella moellendorffii]
 gb|EFJ10711.1| hypothetical protein SELMODRAFT_127443 [Selaginella moellendorffii]
Length=686

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 76/116 (66%), Gaps = 7/116 (6%)
 Frame = -1

Query  687  CYQAPESQKAL-KPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-----MDIVNWLHLCI  526
             Y+ PE++ A  KP+QKWD+YS+G+++LE+ITG+S   H+   E     M +V W H   
Sbjct  568  AYRPPEARLASSKPTQKWDVYSFGLVMLELITGKSATQHLKQQELQHETMPLVEWAHKMW  627

Query  525  DEKKPLSDVLDPYLAED-ADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + K+P+ ++LDP L    A ++ ++   L IA++CV  + E+RP MR++ EAL+++
Sbjct  628  EGKRPVFELLDPTLMHGIAPQQRDVSEFLRIALSCVALASEQRPKMRHVCEALKKI  683



>ref|XP_002963890.1| hypothetical protein SELMODRAFT_80116 [Selaginella moellendorffii]
 gb|EFJ35761.1| hypothetical protein SELMODRAFT_80116 [Selaginella moellendorffii]
Length=675

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 76/116 (66%), Gaps = 7/116 (6%)
 Frame = -1

Query  687  CYQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-----MDIVNWLHLCI  526
             Y+ PE++  + KP+QKWD+YS+G+++LE+ITG+S   H+   E     M +V W H   
Sbjct  557  AYRPPEARLSSSKPTQKWDVYSFGLVMLELITGKSATQHLKQQELQHETMPLVEWAHKMW  616

Query  525  DEKKPLSDVLDPYLAED-ADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            + K+P+ ++LDP L    A ++ ++   L IA++CV  + E+RP MR++ EAL+++
Sbjct  617  EGKRPVFELLDPTLMHGIAPQQRDVSEFLRIALSCVALASEQRPKMRHVCEALKKI  672



>ref|XP_011080119.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Sesamum indicum]
Length=1022

 Score = 90.9 bits (224),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+L+E++TG+ P+       +DIV W+   I E +PL 
Sbjct  882  YIAPEYGYTLKVDEKSDIYSYGVVLMELLTGKRPLDPDFGDSVDIVEWIRRKIRENRPLE  941

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +      +EEM+ +L  A+ C    P+ RPSMR +L  L
Sbjct  942  EALDPSVGNTKHVQEEMLLVLRFAILCTAKLPKDRPSMRDVLSML  986



>ref|XP_010682822.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Beta vulgaris subsp. vulgaris]
Length=736

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 77/121 (64%), Gaps = 13/121 (11%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSP-----------IVHVGSTEM-DIVN  544
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+ P            +     EM D+V 
Sbjct  615  YRAPEAKIPGSRPTQKWDVYSFGVVLLELLTGKCPENSTTTTTSSSSMSSNMNEMHDLVK  674

Query  543  WLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALER  364
            W+    +E+ PL++++DP L ++ + ++E++ + ++A++C    PE RP M+ + E LE+
Sbjct  675  WVRKGFEEECPLAEMVDPMLLQEVNAKKEVLGVFHVALSCTEGDPEVRPRMKIVSENLEK  734

Query  363  L  361
            +
Sbjct  735  I  735



>ref|XP_002964083.1| hypothetical protein SELMODRAFT_81328 [Selaginella moellendorffii]
 gb|EFJ34416.1| hypothetical protein SELMODRAFT_81328 [Selaginella moellendorffii]
Length=1002

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 72/109 (66%), Gaps = 7/109 (6%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE+ K    SQK D+YS+GV+LLE++TG+ P++  G++   +V+W+   I + +PLS
Sbjct  869  YTAPEAAKV---SQKADVYSFGVVLLELLTGKRPMMEDGTS---LVSWVRNSIADDQPLS  922

Query  504  DVLDPYLAE-DADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            D++DP L   +   +EE+ ++  IA+     SP RRPSM+ I+E L R+
Sbjct  923  DIVDPILRNVNGPFQEEISSVFKIALISTDPSPARRPSMKDIVEVLSRI  971



>ref|XP_009343787.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Pyrus x bretschneideri]
Length=1014

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K DIYSYGV+LLE+ITG+ P+       +DIV W+   +  K+ L 
Sbjct  875  YIAPEYGYALKVDEKTDIYSYGVVLLELITGKMPVDPAFGESVDIVEWVRRKMRSKRALE  934

Query  504  DVLDPYLAEDADK-EEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +A +    +EEM+ +L IA+ C    P+ RPSMR I+  L
Sbjct  935  ETLDPSIAGECKHVQEEMLIVLRIALLCTAKLPKDRPSMRDIITML  980



>ref|XP_010540915.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Tarenaya hassleriana]
Length=1012

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 0/99 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+LLE++TG+ P+       +DIV W+   I + +PL 
Sbjct  872  YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGKKPLESEFGESVDIVEWVRRKIRDNRPLE  931

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMR  388
            + LDP +      +EEMI +L IA+ C    P+ RPSMR
Sbjct  932  ETLDPNVGNCRHVQEEMILVLKIALLCTAKLPKDRPSMR  970



>ref|XP_002514942.1| protein with unknown function [Ricinus communis]
 gb|EEF47496.1| protein with unknown function [Ricinus communis]
Length=810

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM----DIVNWLHLCIDE  520
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP +   ++      DIV W+    +E
Sbjct  609  YRAPEARVPGNRPTQKWDVYSFGVVLLELLTGKSPELSPTTSNSIEIPDIVRWVRKGFEE  668

Query  519  KKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERR  400
            +  LS+++DP L ++   ++E++A+ ++A+AC  + PERR
Sbjct  669  ENTLSEMVDPALLQEVHAKKEVLALFHVALACTEADPERR  708



>gb|EYU46395.1| hypothetical protein MIMGU_mgv1a000683mg [Erythranthe guttata]
Length=1019

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    +K  +K DIYSYGV+L+E+ITG+ P+       +DIV W+   + + +PL 
Sbjct  878  YIAPEYGYTMKVDEKSDIYSYGVVLMELITGKRPLDPAFGESVDIVEWIRTKMRKNEPLE  937

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP L +    +EEM+ +L  A+ C    P+ RPSMR +L  L
Sbjct  938  EALDPSLGKTKHVQEEMLLVLRFAVLCTAKLPKDRPSMRDVLTML  982



>ref|XP_003625388.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES81606.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1024

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K D+YSYGV+LLE++TG+ P+       +DIV W+   I E K L 
Sbjct  882  YIAPEYGYALKVDEKIDVYSYGVVLLELVTGKRPLDSEFGESVDIVEWIRRKIRENKSLE  941

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +       EEM+ +L IA+ C    P+ RPSMR ++  L
Sbjct  942  EALDPSVGNCRHVIEEMLLVLRIAVVCTAKLPKERPSMRDVIMML  986



>ref|NP_001060650.1| Os07g0681100 [Oryza sativa Japonica Group]
 dbj|BAC80010.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF22564.1| Os07g0681100 [Oryza sativa Japonica Group]
 gb|EAZ41109.1| hypothetical protein OsJ_25602 [Oryza sativa Japonica Group]
Length=640

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-MDIVNWLHLCIDEKKPL  508
            Y+APE+ +  K +QK D+YS+GV+L+EM+TG++P+   G+ + +D+  W+H  + E+   
Sbjct  510  YRAPETIENRKITQKSDVYSFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWT-  568

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            ++V D  L +  + EEE++ +L IAMAC   SP+RRPSM  ++  +E L
Sbjct  569  AEVFDVELIKQQNIEEELVQMLQIAMACTSRSPDRRPSMEDVIRMIEGL  617



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-MDIVNWLHLCIDEKKPL  508
            Y+APE  +  KP+QK D+YS+GV+LLEM+TG++P+   G  + +D+  W+   + E+   
Sbjct  504  YRAPEVIETRKPTQKSDVYSFGVLLLEMLTGKAPVQSTGQDDVVDLPRWVQSVVREEW-T  562

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVP  352
            ++V D  L +  + EEEM+ +L IAMACV   P+ RP+M  ++  +E + VP
Sbjct  563  AEVFDLELLKYQNIEEEMVQMLQIAMACVARVPDMRPTMDEVVRMIEEIRVP  614



>gb|EAZ05160.1| hypothetical protein OsI_27356 [Oryza sativa Indica Group]
Length=640

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-MDIVNWLHLCIDEKKPL  508
            Y+APE+ +  K +QK D+YS+GV+L+EM+TG++P+   G+ + +D+  W+H  + E+   
Sbjct  510  YRAPETIENRKITQKSDVYSFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWT-  568

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            ++V D  L +  + EEE++ +L IAMAC   SP+RRPSM  ++  +E L
Sbjct  569  AEVFDVELIKQQNIEEELVQMLQIAMACTSRSPDRRPSMEDVIRMIEGL  617



>ref|XP_008364044.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Malus domestica]
Length=1014

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K DIYSYGV+LLE++TG+ P+       +DIV W+   +  K+ L 
Sbjct  875  YIAPEYGYALKVDEKTDIYSYGVVLLELLTGKMPVDPAFGESVDIVEWVRRKMRTKRALE  934

Query  504  DVLDPYLA-EDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +A E    +EEM+ +L IA+ C    P+ RPSMR I+  L
Sbjct  935  ETLDPSIAGECMHVQEEMLLVLRIALVCTAKLPKDRPSMRDIITML  980



>ref|XP_002456732.1| hypothetical protein SORBIDRAFT_03g041570 [Sorghum bicolor]
 gb|EES01852.1| hypothetical protein SORBIDRAFT_03g041570 [Sorghum bicolor]
Length=962

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +LK ++K D+YS+GV+LLE++TGRSP       E DIV+W+   + ++ P +
Sbjct  843  YMAPELAYSLKATEKSDVYSFGVVLLELLTGRSPTDQQFDGETDIVSWVSFHLAKQNPAA  902

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
             VLDP +  DA   + MI  LNIA+ C    P  RP+MR +++ L
Sbjct  903  -VLDPKVNNDA--SDYMIKALNIAIVCTTQLPSERPTMREVVKML  944



>gb|EAZ18160.1| hypothetical protein OsJ_33710 [Oryza sativa Japonica Group]
Length=164

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 73/138 (53%), Gaps = 29/138 (21%)
 Frame = -1

Query  687  CYQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM---------------  556
             Y+APE++    +PSQK D+YS+GV+LLE++TGR P  H   +                 
Sbjct  25   AYRAPEARAVGARPSQKSDVYSFGVVLLELLTGRPPEHHASPSASTSSSASFSGTTTTVC  84

Query  555  -------------DIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHS  415
                         ++V W+    ++ +PLS++ D  +  D    +E++A  ++A+ CV +
Sbjct  85   GGGGGGDQAQAVPEVVRWVRQGFEDARPLSELADAGVLRDGGARKEVVAAFHVALGCVEA  144

Query  414  SPERRPSMRYILEALERL  361
             PERRP M+ + E+L+++
Sbjct  145  DPERRPRMKAVAESLDKI  162



>ref|XP_004309604.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g06940 [Fragaria vesca subsp. vesca]
Length=886

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = -1

Query  687  CYQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPL  508
            CY APE+Q + K +++ D+YS+GV+LLE++TGR     + S  +DIV W+   ++     
Sbjct  760  CYNAPENQYSKKATEQMDVYSFGVVLLELVTGRQAEQALPSEPLDIVKWVRRKVNITNGA  819

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
              VLDP +   +  ++EM+  L IA+ C +  PE+RPSM  ++++L+ L + T
Sbjct  820  VQVLDPKVTSSS--QQEMLVALEIALHCTYVMPEKRPSMSEVVKSLQSLVLMT  870



>ref|XP_010447946.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Camelina sativa]
Length=159

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+LLE++TGR P+       +DIV W+   I +   L 
Sbjct  18   YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGRRPLEPEFGESVDIVEWVRRKIRDNISLE  77

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +      +EEM+ +L IA+ C    P+ RPSMR ++  L
Sbjct  78   EALDPNVGNCRFVQEEMLLVLQIALLCTTKLPKDRPSMRDVISML  122



>ref|XP_004958707.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Setaria italica]
 ref|XP_004958708.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Setaria italica]
 ref|XP_004958709.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Setaria italica]
Length=639

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-MDIVNWLHLCIDEKKPL  508
            Y+APE+ +  K +QK D+YS+GV+L+EM+TG++P+   G+ + +D+  W+H  + E+   
Sbjct  509  YRAPETVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWT-  567

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            ++V D  L ++ + EEE++ +L IAMAC   SP+RRP+M  ++  +E L
Sbjct  568  AEVFDVELMKEQNIEEELVQMLQIAMACTARSPDRRPTMEELIRMIEGL  616



>ref|XP_002865012.1| hypothetical protein ARALYDRAFT_496872 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41271.1| hypothetical protein ARALYDRAFT_496872 [Arabidopsis lyrata subsp. 
lyrata]
Length=750

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APES +++KP+QKWD+YS+GVILLE++TG+  +V     E+  VN   L ID+ +   
Sbjct  641  YNAPESLRSIKPNQKWDVYSFGVILLELLTGKIVVVD----ELGQVN--GLVIDDGERAI  694

Query  504  DVLDPYL-AEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPV  355
             + D  + AE   KEE ++A L + +AC    P+RRP+++  L+ LER PV
Sbjct  695  RMADSAIRAELEGKEEAVLACLKMGLACASPIPQRRPNIKEALQVLERFPV  745



>ref|XP_012085218.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Jatropha curcas]
Length=1018

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+LLE++TG+ P+       +DIV W+   I + KPL 
Sbjct  880  YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGKRPLDPEFGESIDIVEWIRRMIRDNKPLE  939

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LD  +      +EEM+ +L IA+ C    P+ RPSMR ++  L
Sbjct  940  ESLDDSVGNCKHVQEEMLLVLRIALLCTAKLPKDRPSMRDVITML  984



>ref|XP_010531616.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Tarenaya hassleriana]
Length=709

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 76/117 (65%), Gaps = 9/117 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM--------DIVNWLHL  532
            Y+APE++    +P+QKWD+YS+GV+LLE++TG+SP                 D+V W+  
Sbjct  591  YKAPEARIPGNRPTQKWDVYSFGVVLLELLTGKSPESSPPPPATSTSAVEVKDLVKWVRK  650

Query  531  CIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
             ++E+KPLS+++DP L ++ + +++ +A+ ++A+AC    PE RP M+ + + L ++
Sbjct  651  GLEEEKPLSEMVDPMLIQEVNNKKQAMAVFHVALACSEGDPEIRPRMKNVSDNLVKI  707



>ref|XP_010921194.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=349

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 72/109 (66%), Gaps = 2/109 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM-DIVNWLHLCIDEKKPL  508
            Y+APE+ +  K +QK D+YS+GV+LLEM+TG++P+   G  ++ D+  W+   + E+   
Sbjct  223  YRAPETMETRKITQKSDVYSFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEW-T  281

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            ++V D  L  D + EEE++ +L IAM+CV  +PE+RP M  ++  +E +
Sbjct  282  AEVFDVELMMDHNNEEELVRMLQIAMSCVARTPEQRPRMEDVVRMIEEI  330



>gb|KDP26461.1| hypothetical protein JCGZ_17619 [Jatropha curcas]
Length=1013

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+LLE++TG+ P+       +DIV W+   I + KPL 
Sbjct  875  YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGKRPLDPEFGESIDIVEWIRRMIRDNKPLE  934

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LD  +      +EEM+ +L IA+ C    P+ RPSMR ++  L
Sbjct  935  ESLDDSVGNCKHVQEEMLLVLRIALLCTAKLPKDRPSMRDVITML  979



>ref|XP_008674748.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 ref|XP_008674749.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 ref|XP_008674750.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 tpg|DAA56552.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=958

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +L  ++K D+Y++GV+LLE++TG SP       E DIV+W+   + EK P +
Sbjct  837  YMAPELAYSLNATEKSDVYNFGVVLLELLTGHSPTDQQFGGEKDIVSWVSFHLAEKDPAA  896

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
             VLDP ++ DA     M+  L+IA+ C    P  RP+MR I++ L
Sbjct  897  -VLDPKVSNDASDHNHMMKALHIAILCTTQLPSERPTMREIVKML  940



>ref|XP_003553510.2| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like 
[Glycine max]
 gb|KHN02463.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Glycine 
soja]
Length=1022

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K D+YSYGV+LLE++TG+ P+       +DIV W+ + I + K L 
Sbjct  882  YIAPEYGYALKVDEKIDVYSYGVVLLELLTGKRPLDSDFGESIDIVEWIRMKIRDNKSLE  941

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +  +    EEM+ +L IA+ C    P+ RP+MR ++  L
Sbjct  942  EALDPSVGNNRHVLEEMLLVLRIAILCTAKLPKDRPTMRDVVMML  986



>ref|XP_008795724.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Phoenix dactylifera]
Length=651

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = -1

Query  687  CYQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKP  511
             Y APE++      +QK D+Y++GV+++E++TGR P    G  E ++  W+     E++P
Sbjct  539  AYLAPEARAPGAAATQKGDVYAFGVVVMEVVTGR-PAAGCGDGEGELEGWVRRAFGEERP  597

Query  510  LSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            LS+V+DP L  +   +++++A+ + A+ C    PE RP MR + E+L+R+
Sbjct  598  LSEVVDPALLHEVHAKKQVLAVFHAALGCTEPDPELRPRMRVVAESLDRV  647



>ref|XP_004970775.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Setaria italica]
Length=961

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +LK ++K D+YS+G++LLE++TGRSP       EMDIV+W+   + E+ P +
Sbjct  842  YMAPELAYSLKATEKSDVYSFGIVLLELLTGRSPTDQQFDGEMDIVSWVSSHLTEQNPAA  901

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
             V+DP ++  A   + MI  LNIA+ C    P  RP+MR ++  L
Sbjct  902  -VVDPKVSNGA--SDYMIKALNIAILCTAQLPSERPTMREVVNML  943



>gb|KFK41150.1| hypothetical protein AALP_AA2G092300 [Arabis alpina]
Length=710

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 77/117 (66%), Gaps = 9/117 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM--------DIVNWLHL  532
            Y+APE++    +P+QKWD+YS+GV+L+E++TG+SP     S+          D+V W+  
Sbjct  594  YKAPEARLPGSRPTQKWDVYSFGVVLMELLTGKSPDSSPPSSSSSSTVVEVPDLVKWVRK  653

Query  531  CIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
              +E+ PLSD++DP L ++   +++++++ ++A+AC    PE RP M+ + E ++++
Sbjct  654  GFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTEGDPEVRPRMKNVSENIDKI  710



>ref|XP_004970774.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Setaria italica]
Length=956

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +LK ++K D+YS+G++LLE++TGRSP       EMDIV+W+   + E+ P +
Sbjct  837  YMAPELAYSLKATEKSDVYSFGIVLLELLTGRSPTDQQFDGEMDIVSWVSSHLTEQNPAA  896

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
             V+DP ++  A   + MI  LNIA+ C    P  RP+MR ++  L
Sbjct  897  -VVDPKVSNGA--SDYMIKALNIAILCTAQLPSERPTMREVVNML  938



>ref|XP_010264856.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Nelumbo nucifera]
Length=1018

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    LK  +K DIYSYGV+++E+ITGR+P+       ++IV W+   I + KPL 
Sbjct  883  YIAPEYGYTLKVDEKSDIYSYGVVIMELITGRNPLDPEFGESVNIVEWVRGKIRDNKPLE  942

Query  504  DVLDPYLAEDADK-EEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +A      +EEM+ +L IA+ C    P+ RPSMR ++  L
Sbjct  943  ETLDPSIAGQCKHVQEEMLLVLRIALLCTAKFPKDRPSMRDVITML  988



>ref|XP_010558914.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Tarenaya hassleriana]
Length=751

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APES + LKP+ KWD+YS+GVILLE++TG+  IV V   +M  VN   L ID+K+   
Sbjct  648  YNAPESLRNLKPNPKWDVYSFGVILLELLTGK--IVQV--DDMGQVNG--LVIDDKERAM  701

Query  504  DVLD-PYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLP  358
             ++D P   E   KEE ++  L + +AC    P+RRP+M+  L+ LER P
Sbjct  702  RMVDGPIRGELDGKEEALLGCLKMGLACSSPIPQRRPTMKEALQLLERFP  751



>ref|NP_176918.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AAG52300.1|AC011020_7 putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAC18784.1| Similar to ERECTA receptor protein kinase gb|U47029 from A. thaliana 
[Arabidopsis thaliana]
 gb|ACN59266.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE34657.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=719

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 77/118 (65%), Gaps = 10/118 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM---------DIVNWLH  535
            Y+APE++    +P+QKWD+YS+GV+L+E++TG+SP     S+           D+V W+ 
Sbjct  602  YKAPEARLPGGRPTQKWDVYSFGVVLMELLTGKSPDSSPLSSSSTSTVVVEVPDLVKWVR  661

Query  534  LCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
               +E+ PLSD++DP L ++   +++++++ ++A+AC    PE RP M+ + E ++++
Sbjct  662  KGFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTEGDPEVRPRMKNVSENIDKI  719



>ref|XP_007162602.1| hypothetical protein PHAVU_001G165100g [Phaseolus vulgaris]
 gb|ESW34596.1| hypothetical protein PHAVU_001G165100g [Phaseolus vulgaris]
Length=1020

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   ALK  +K D+YSYGV+LLE++TG+ P+       +DIV W+ + I + K L 
Sbjct  884  YIAPEYGYALKVDEKIDVYSYGVVLLELLTGKRPLDPDFGESIDIVEWIRMKIRDNKSLE  943

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +       EEM+ +L IA+ C    P+ RP+MR ++  L
Sbjct  944  EALDPSVGNSRHVVEEMLLVLRIAIICTAKLPKDRPTMRDVIMML  988



>ref|XP_007144405.1| hypothetical protein PHAVU_007G153400g [Phaseolus vulgaris]
 gb|ESW16399.1| hypothetical protein PHAVU_007G153400g [Phaseolus vulgaris]
Length=1019

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +LK  +K DIYSYGV+LLE++TG+ P+       MDIV W+   ID+K P  
Sbjct  881  YIAPEYGYSLKVDEKIDIYSYGVVLLELVTGKRPLDPEFGECMDIVGWIRRKIDKKSP-H  939

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDP +      +EEM+ +L IA+ C    P+ RPSMR ++  L
Sbjct  940  EALDPSVGNCKYVQEEMLLVLKIALLCTAKFPKERPSMRDVIMML  984



>ref|NP_001067731.1| Os11g0300700 [Oryza sativa Japonica Group]
 dbj|BAF28094.1| Os11g0300700, partial [Oryza sativa Japonica Group]
Length=218

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 73/137 (53%), Gaps = 29/137 (21%)
 Frame = -1

Query  684  YQAPESQK-ALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM----------------  556
            Y+APE++    +PSQK D+YS+GV+LLE++TGR P  H   +                  
Sbjct  80   YRAPEARAVGARPSQKSDVYSFGVVLLELLTGRPPEHHASPSASTSSSASFSGTTTTVCG  139

Query  555  ------------DIVNWLHLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSS  412
                        ++V W+    ++ +PLS++ D  +  D    +E++A  ++A+ CV + 
Sbjct  140  GGGGGDQAQAVPEVVRWVRQGFEDARPLSELADAGVLRDGGARKEVVAAFHVALGCVEAD  199

Query  411  PERRPSMRYILEALERL  361
            PERRP M+ + E+L+++
Sbjct  200  PERRPRMKAVAESLDKI  216



>ref|XP_006300793.1| hypothetical protein CARUB_v10019872mg [Capsella rubella]
 gb|EOA33691.1| hypothetical protein CARUB_v10019872mg [Capsella rubella]
Length=720

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 77/118 (65%), Gaps = 10/118 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM---------DIVNWLH  535
            Y+APE++    +P+QKWD+YS+GV+L+E++TG+SP     S+           D+V W+ 
Sbjct  603  YKAPEARLPGGRPTQKWDVYSFGVVLMELLTGKSPDSSPPSSSSSSTLVVEVPDLVKWVR  662

Query  534  LCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
               +E+ PLSD++DP L ++   +++++++ ++A+AC    PE RP M+ + E ++++
Sbjct  663  KGFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTEGDPEVRPRMKNVSENIDKI  720



>ref|XP_002888603.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64862.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=718

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 77/118 (65%), Gaps = 10/118 (8%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM---------DIVNWLH  535
            Y+APE++    +P+QKWD+YS+GV+L+E++TG+SP     S+           D+V W+ 
Sbjct  601  YKAPEARLPGGRPTQKWDVYSFGVVLMELLTGKSPESSPLSSSSSSTVVVEVPDLVKWVR  660

Query  534  LCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
               +E+ PLSD++DP L ++   +++++++ ++A+AC    PE RP M+ + E ++++
Sbjct  661  KGFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTEGDPEVRPRMKNVSENIDKI  718



>gb|EMT29311.1| Phytosulfokine receptor 1 [Aegilops tauschii]
Length=365

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = -1

Query  645  QKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLSDVLDPYLAEDADK  466
            QK D++++GV+LLE +TGR P    G  E++   W+     E++PLS+V+DP L  +   
Sbjct  152  QKGDVFAFGVVLLEAVTGRQPTEGEGGLELEA--WVRRAFKEERPLSEVVDPSLLGEVHA  209

Query  465  EEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            +++++A+ ++A+ C    PE RP MR + E+L+RL
Sbjct  210  KKQVLAVFHVALGCTEPDPELRPRMRAVAESLDRL  244



>ref|XP_002463400.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
 gb|EER99921.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
Length=639

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-MDIVNWLHLCIDEKKPL  508
            Y+APE+ ++ K +QK D+YS+GV+L+EM+TG++P+   G+ + +D+  W+H  + E+   
Sbjct  509  YRAPETVESRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWT-  567

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERLPVPT  349
            ++V D  L +  + EEE++ +L IAM C   SP+RRP+M  ++  +E L   T
Sbjct  568  AEVFDVELMKHQNIEEELVQMLQIAMVCTAKSPDRRPAMEEVIRMIEGLRQST  620



>ref|XP_006658137.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=642

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTE-MDIVNWLHLCIDEKKPL  508
            Y+APE+ +  K +QK DIYS+GV+L+EM+TG++P+   G+ + +D+  W+H  + E+   
Sbjct  512  YRAPETIENRKITQKSDIYSFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWT-  570

Query  507  SDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
            ++V D  L +  + EEE++ +L IAM+C   SP+RRP+M  ++  +E L
Sbjct  571  AEVFDVELIKQQNIEEELVQMLQIAMSCTSRSPDRRPTMEDVIRMIEGL  619



>ref|XP_006391267.1| hypothetical protein EUTSA_v10018190mg [Eutrema salsugineum]
 gb|ESQ28553.1| hypothetical protein EUTSA_v10018190mg [Eutrema salsugineum]
Length=723

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 77/119 (65%), Gaps = 11/119 (9%)
 Frame = -1

Query  684  YQAPESQ-KALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEM----------DIVNWL  538
            Y+APE++    +P+QKWD+YS+GV+L+E++TG+SP     S+            D+V W+
Sbjct  605  YKAPEARLPGSRPTQKWDVYSFGVVLMELLTGKSPDSSPISSSSSSSTVVVEVPDLVKWV  664

Query  537  HLCIDEKKPLSDVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEALERL  361
                +E+ PLSD++DP L ++   +++++++ ++A+AC    PE RP M+ + E ++++
Sbjct  665  RKGFEEETPLSDMVDPMLLQEVHAKQQVLSVFHLALACTEGDPEVRPRMKNVSENIDKI  723



>emb|CDP03798.1| unnamed protein product [Coffea canephora]
Length=1017

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE   +LK  +K DIYSYGV+L+E++TG+ P+       +DIV W+ + I + K L 
Sbjct  882  YIAPEYGYSLKVDEKSDIYSYGVVLMELLTGKRPLDPEFGESVDIVEWIRIKIRDHKSLE  941

Query  504  DVLDPYLAEDADKEEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
              LDP +      +EEM+ +L IA+ C    P+ RPSMR +L  L
Sbjct  942  TALDPSVGITKHVQEEMLLVLRIAILCTAKLPKDRPSMRDVLTML  986



>ref|XP_010102197.1| Leucine-rich repeat receptor-like protein kinase PXL1 [Morus 
notabilis]
 gb|EXB93140.1| Leucine-rich repeat receptor-like protein kinase PXL1 [Morus 
notabilis]
Length=1031

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = -1

Query  684  YQAPESQKALKPSQKWDIYSYGVILLEMITGRSPIVHVGSTEMDIVNWLHLCIDEKKPLS  505
            Y APE    +K  +K DIYSYGV+LLE++TG++ +       +DIV W+   I  KK + 
Sbjct  876  YIAPEYGYTMKVDEKTDIYSYGVVLLELLTGKTALDPAFGESVDIVEWVRRKIRNKKAIE  935

Query  504  DVLDPYLAEDADK-EEEMIAILNIAMACVHSSPERRPSMRYILEAL  370
            + LDPY+A      +EEM+ +L IA+ C    P+ RPSMR I+  L
Sbjct  936  EALDPYIAGQCKHIQEEMLLVLRIALLCTAKLPKDRPSMRDIITML  981



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1559042875252