BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1294

Length=856
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603383.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          401   1e-133   Nicotiana tomentosiformis
ref|XP_007150153.1|  hypothetical protein PHAVU_005G131400g             401   1e-133   Phaseolus vulgaris [French bean]
gb|AGW47869.1|  4-coumarate:coenzyme A ligase 4                         400   2e-133   Phaseolus vulgaris [French bean]
emb|CDP07051.1|  unnamed protein product                                389   2e-133   Coffea canephora [robusta coffee]
ref|XP_009786809.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          394   5e-131   Nicotiana sylvestris
gb|KEH39397.1|  4-coumarate:CoA ligase-like protein                     393   2e-130   Medicago truncatula
ref|XP_006340129.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     393   2e-130   Solanum tuberosum [potatoes]
ref|XP_004251107.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          392   3e-130   Solanum lycopersicum
gb|AHL44983.1|  4-coumarate:coenzyme A ligase 4                         390   4e-129   Fraxinus mandshurica [Manchurian ash]
gb|AGW27195.1|  4-coumarate:coenzyme A ligase 5                         390   4e-129   Salvia miltiorrhiza [Chinese salvia]
gb|AIR95612.1|  4-coumarate:CoA ligase-like protein                     387   5e-128   Betula pendula [white birch]
ref|XP_010045319.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          387   6e-128   Eucalyptus grandis [rose gum]
ref|XP_011089239.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    387   6e-128   
gb|EYU18792.1|  hypothetical protein MIMGU_mgv1a004091mg                386   1e-127   Erythranthe guttata [common monkey flower]
gb|KJB83874.1|  hypothetical protein B456_013G269100                    386   4e-127   Gossypium raimondii
gb|KHN21493.1|  4-coumarate--CoA ligase-like 7                          384   7e-127   Glycine soja [wild soybean]
ref|NP_001243292.1|  4-coumarate--CoA ligase-like 7-like                384   9e-127   Glycine max [soybeans]
gb|KCW87479.1|  hypothetical protein EUGRSUZ_B03943                     387   2e-126   Eucalyptus grandis [rose gum]
ref|XP_004291645.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          382   3e-126   Fragaria vesca subsp. vesca
gb|AGA17924.1|  CCL7                                                    382   3e-126   Humulus lupulus [common hop]
ref|XP_010267197.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          382   5e-126   Nelumbo nucifera [Indian lotus]
ref|XP_004487067.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     381   7e-126   Cicer arietinum [garbanzo]
ref|XP_003638044.1|  4-coumarate-coa ligase                             369   2e-125   
ref|XP_007016849.1|  AMP-dependent synthetase and ligase family p...    379   5e-125   
ref|XP_006373451.1|  4-coumarate--CoA ligase family protein             379   1e-124   
gb|AFD33347.1|  acyl-activating enzyme 3                                377   3e-124   Cannabis sativa
emb|CBI17160.3|  unnamed protein product                                365   6e-124   Vitis vinifera
ref|XP_007208457.1|  hypothetical protein PRUPE_ppa003893mg             376   7e-124   Prunus persica
ref|XP_012064724.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    374   7e-124   
ref|XP_002523698.1|  AMP dependent CoA ligase, putative                 375   2e-123   Ricinus communis
ref|XP_011021220.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    374   4e-123   Populus euphratica
ref|XP_011021221.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    374   9e-123   Populus euphratica
ref|XP_012064722.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    372   2e-122   Jatropha curcas
ref|XP_002305282.1|  4-coumarate--CoA ligase family protein             372   3e-122   Populus trichocarpa [western balsam poplar]
ref|XP_011004441.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          372   6e-122   Populus euphratica
ref|XP_010111818.1|  4-coumarate--CoA ligase-like 7                     375   8e-122   
ref|XP_006424490.1|  hypothetical protein CICLE_v10028138mg             370   3e-121   Citrus clementina [clementine]
gb|KHN38721.1|  4-coumarate--CoA ligase-like 7                          365   4e-121   Glycine soja [wild soybean]
ref|XP_009356915.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          369   6e-121   Pyrus x bretschneideri [bai li]
gb|KJB20364.1|  hypothetical protein B456_003G144900                    368   8e-121   Gossypium raimondii
ref|XP_006488032.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     367   3e-120   Citrus sinensis [apfelsine]
ref|XP_002276353.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          367   3e-120   Vitis vinifera
ref|XP_008226338.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          365   8e-120   
ref|XP_006591122.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...    366   1e-119   Glycine max [soybeans]
ref|XP_006591121.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...    366   2e-119   Glycine max [soybeans]
ref|XP_008384715.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          365   3e-119   
gb|KJB20366.1|  hypothetical protein B456_003G144900                    363   5e-119   Gossypium raimondii
gb|AGO89328.1|  Ca4CL11                                                 360   2e-117   Salix arbutifolia
ref|XP_010455853.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          360   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_007132314.1|  hypothetical protein PHAVU_011G084300g             359   4e-117   Phaseolus vulgaris [French bean]
gb|AGW47873.1|  4-coumarate:coenzyme A ligase 8                         359   5e-117   Phaseolus vulgaris [French bean]
ref|XP_008463063.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          358   8e-117   Cucumis melo [Oriental melon]
gb|AGO89327.1|  Ca4CL10                                                 358   8e-117   Salix arbutifolia
ref|XP_010422413.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          358   9e-117   Camelina sativa [gold-of-pleasure]
ref|XP_006488029.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     358   2e-116   Citrus sinensis [apfelsine]
ref|XP_004147290.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          357   2e-116   Cucumis sativus [cucumbers]
ref|XP_002872738.1|  hypothetical protein ARALYDRAFT_490166             357   4e-116   Arabidopsis lyrata subsp. lyrata
ref|XP_006396625.1|  hypothetical protein EUTSA_v10028563mg             356   6e-116   Eutrema salsugineum [saltwater cress]
gb|KEH29989.1|  4-coumarate:CoA ligase-like protein                     356   6e-116   Medicago truncatula
emb|CDY46375.1|  BnaA09g19890D                                          355   2e-115   Brassica napus [oilseed rape]
emb|CDY39155.1|  BnaC09g21890D                                          354   3e-115   Brassica napus [oilseed rape]
ref|XP_006396627.1|  hypothetical protein EUTSA_v10028562mg             354   4e-115   Eutrema salsugineum [saltwater cress]
ref|XP_010431672.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          353   6e-115   Camelina sativa [gold-of-pleasure]
gb|ADG46006.1|  4-coumarate coenzyme A ligase                           353   1e-114   Isatis tinctoria [woad]
gb|AIA24410.1|  4-coumarate-CoA ligase                                  352   1e-114   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_007203616.1|  hypothetical protein PRUPE_ppa003871mg             353   1e-114   Prunus persica
ref|XP_006287440.1|  hypothetical protein CARUB_v10000646mg             353   1e-114   Capsella rubella
ref|XP_009114499.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          352   1e-114   Brassica rapa
ref|XP_009335967.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          351   8e-114   Pyrus x bretschneideri [bai li]
ref|NP_192425.1|  4-coumarate--CoA ligase-like 7                        350   9e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241410.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          352   9e-114   Prunus mume [ume]
ref|XP_010538202.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          350   1e-113   Tarenaya hassleriana [spider flower]
gb|KFK32221.1|  hypothetical protein AALP_AA6G213500                    350   1e-113   Arabis alpina [alpine rockcress]
ref|XP_006424485.1|  hypothetical protein CICLE_v100281391mg            337   2e-113   
ref|XP_010689117.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          348   6e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008359628.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          348   7e-113   
ref|XP_002519487.1|  AMP dependent CoA ligase, putative                 348   9e-113   
ref|XP_010918637.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...    346   5e-112   Elaeis guineensis
gb|EPS70306.1|  hypothetical protein M569_04447                         346   5e-112   Genlisea aurea
ref|XP_010529378.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    344   4e-111   Tarenaya hassleriana [spider flower]
ref|XP_004304462.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          340   1e-109   Fragaria vesca subsp. vesca
ref|XP_006488030.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     336   4e-108   
ref|XP_010037648.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          335   2e-107   Eucalyptus grandis [rose gum]
ref|XP_006843037.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          334   2e-107   Amborella trichopoda
ref|XP_008808867.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          333   5e-107   Phoenix dactylifera
emb|CDY46376.1|  BnaA09g19900D                                          332   1e-106   Brassica napus [oilseed rape]
ref|XP_010037647.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          332   2e-106   Eucalyptus grandis [rose gum]
gb|KCW87478.1|  hypothetical protein EUGRSUZ_B03942                     334   2e-106   Eucalyptus grandis [rose gum]
ref|XP_010101621.1|  4-coumarate--CoA ligase-like 7                     330   7e-106   Morus notabilis
gb|KDO37039.1|  hypothetical protein CISIN_1g043808mg                   318   2e-105   Citrus sinensis [apfelsine]
ref|XP_011651966.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          329   2e-105   Cucumis sativus [cucumbers]
ref|XP_008442710.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          328   6e-105   Cucumis melo [Oriental melon]
emb|CDY39153.1|  BnaC09g21910D                                          327   1e-104   Brassica napus [oilseed rape]
ref|XP_009114500.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          327   2e-104   Brassica rapa
ref|XP_007027423.1|  AMP-dependent synthetase and ligase family p...    327   5e-104   
ref|XP_009413145.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          324   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN70560.1|  hypothetical protein VITISV_031619                     327   4e-103   Vitis vinifera
ref|NP_001130746.1|  uncharacterized protein LOC100191850               315   2e-102   
gb|ACF80143.2|  unknown                                                 315   1e-101   Zea mays [maize]
ref|XP_003558787.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          318   3e-101   Brachypodium distachyon [annual false brome]
gb|ACG28731.1|  4-coumarate--CoA ligase 2                               316   9e-101   Zea mays [maize]
gb|AGA17927.1|  CCL10                                                   317   1e-100   Humulus lupulus [common hop]
gb|EMS62523.1|  4-coumarate--CoA ligase-like 1                          309   1e-100   Triticum urartu
ref|XP_004985664.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     317   2e-100   
ref|XP_008672616.1|  PREDICTED: uncharacterized protein LOC100191...    316   3e-100   Zea mays [maize]
ref|XP_009401821.1|  PREDICTED: 4-coumarate--CoA ligase-like 1          315   6e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007027424.1|  AMP-dependent synthetase and ligase family p...    303   8e-100   
ref|XP_011021222.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    313   1e-99    Populus euphratica
emb|CBI30139.3|  unnamed protein product                                317   2e-99    Vitis vinifera
sp|Q0DV32.2|4CLL1_ORYSJ  RecName: Full=4-coumarate--CoA ligase-li...    312   8e-99    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146510.1|  uncharacterized protein LOC100280100               304   2e-98    
ref|XP_006651051.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     309   4e-98    
gb|KHM98913.1|  4-coumarate--CoA ligase-like 7                          297   6e-98    Glycine soja [wild soybean]
gb|KJB36451.1|  hypothetical protein B456_006G162900                    310   7e-98    Gossypium raimondii
emb|CDP06777.1|  unnamed protein product                                308   9e-98    Coffea canephora [robusta coffee]
gb|EMT32750.1|  4-coumarate--CoA ligase-like protein 1                  304   2e-97    
dbj|BAJ88705.1|  predicted protein                                      308   6e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004982544.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     307   9e-97    Setaria italica
ref|XP_004985665.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-li...    306   2e-96    Setaria italica
gb|ABR17274.1|  unknown                                                 305   3e-96    Picea sitchensis
tpg|DAA50089.1|  TPA: putative AMP-dependent synthetase and ligas...    305   5e-96    
ref|XP_004982543.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like     304   1e-95    Setaria italica
gb|AGO89329.1|  Ca4CL12                                                 300   3e-94    Salix arbutifolia
gb|EEC74534.1|  hypothetical protein OsI_10054                          301   4e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_002466906.1|  hypothetical protein SORBIDRAFT_01g016420          300   6e-94    
ref|XP_004497538.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     299   9e-94    Cicer arietinum [garbanzo]
gb|EEE58336.1|  hypothetical protein OsJ_09444                          299   3e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087155.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          298   3e-93    Sesamum indicum [beniseed]
gb|KEH42182.1|  4-coumarate:CoA ligase-like protein                     298   4e-93    Medicago truncatula
gb|KEH42183.1|  4-coumarate:CoA ligase-like protein                     296   1e-92    Medicago truncatula
gb|ABR18186.1|  unknown                                                 295   3e-92    Picea sitchensis
gb|AIY34663.1|  4-coumarate:CoA ligase-like protein                     285   2e-88    Ornithogalum longebracteatum [sea-onion]
ref|XP_011087272.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          281   1e-86    
ref|XP_010918638.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...    278   7e-86    
ref|XP_006424487.1|  hypothetical protein CICLE_v10029864mg             267   6e-82    
gb|AHI15919.1|  4-coumarate:CoA ligase 3                                267   2e-81    Dryopteris fragrans
gb|ABR17473.1|  unknown                                                 265   9e-81    Picea sitchensis
gb|KDP29158.1|  hypothetical protein JCGZ_16547                         262   3e-80    Jatropha curcas
gb|ADE77047.1|  unknown                                                 256   5e-79    Picea sitchensis
ref|XP_004514911.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     260   7e-79    Cicer arietinum [garbanzo]
ref|XP_002985866.1|  hypothetical protein SELMODRAFT_446445             259   1e-78    Selaginella moellendorffii
ref|XP_004514323.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     256   3e-77    Cicer arietinum [garbanzo]
ref|XP_003545004.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     256   4e-77    Glycine max [soybeans]
ref|XP_002985111.1|  hypothetical protein SELMODRAFT_157069             255   4e-77    
ref|NP_001140329.1|  uncharacterized protein LOC100272376               253   4e-77    Zea mays [maize]
gb|ADE77598.1|  unknown                                                 248   7e-77    Picea sitchensis
ref|XP_007160602.1|  hypothetical protein PHAVU_001G001300g             255   8e-77    Phaseolus vulgaris [French bean]
ref|XP_002984802.1|  hypothetical protein SELMODRAFT_181279             254   2e-76    Selaginella moellendorffii
ref|XP_011021223.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...    251   4e-76    Populus euphratica
ref|XP_011628970.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          253   5e-76    Amborella trichopoda
gb|AHI15920.1|  4-coumarate:CoA ligase 4                                253   5e-76    Dryopteris fragrans
ref|XP_002970786.1|  hypothetical protein SELMODRAFT_231716             252   5e-76    
gb|AGA17922.1|  CCL5                                                    253   5e-76    Humulus lupulus [common hop]
ref|XP_006646571.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     247   1e-75    
ref|XP_006372917.1|  hypothetical protein POPTR_0017s06220g             252   1e-75    
ref|XP_008777804.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    251   2e-75    
gb|AKA59704.1|  phenylalanoyl CoA ligase                                251   2e-75    Taxus baccata
gb|KCW83189.1|  hypothetical protein EUGRSUZ_B00139                     246   2e-75    Eucalyptus grandis [rose gum]
ref|XP_009413046.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          251   3e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW65282.1|  hypothetical protein EUGRSUZ_G02739                     246   3e-75    Eucalyptus grandis [rose gum]
ref|XP_004985666.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-li...    251   3e-75    Setaria italica
ref|XP_006852174.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          250   4e-75    Amborella trichopoda
ref|XP_011034909.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          250   5e-75    Populus euphratica
ref|XP_011037054.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          250   5e-75    Populus euphratica
emb|CBI15627.3|  unnamed protein product                                249   6e-75    Vitis vinifera
ref|XP_009595630.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          250   6e-75    Nicotiana tomentosiformis
ref|XP_002893114.1|  opc-8:0 CoA ligase1                                250   6e-75    
ref|XP_003590732.1|  4-coumarate-coa ligase                             249   1e-74    
ref|XP_002510640.1|  AMP dependent CoA ligase, putative                 249   1e-74    Ricinus communis
ref|XP_008787716.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    249   1e-74    Phoenix dactylifera
ref|XP_010663724.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          249   1e-74    Vitis vinifera
emb|CAN74074.1|  hypothetical protein VITISV_000975                     249   1e-74    Vitis vinifera
ref|XP_009790448.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          249   2e-74    Nicotiana sylvestris
ref|NP_564115.1|  OPC-8:0 CoA ligase1                                   249   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010045504.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          247   2e-74    Eucalyptus grandis [rose gum]
gb|AAP03021.1|  4-coumarate-CoA ligase-like protein                     249   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012073683.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          248   2e-74    Jatropha curcas
gb|AGW27194.1|  4-coumarate:coenzyme A ligase 4                         248   3e-74    Salvia miltiorrhiza [Chinese salvia]
gb|KHG05050.1|  4-coumarate--CoA ligase-like 5                          248   3e-74    Gossypium arboreum [tree cotton]
gb|AIS92507.1|  4-coumarate:CoA ligase 3                                248   4e-74    Epimedium sagittatum
ref|XP_010905239.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    248   5e-74    
ref|XP_007017972.1|  OPC-8:0 CoA ligase1 isoform 1                      248   5e-74    
ref|XP_010068871.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          248   5e-74    Eucalyptus grandis [rose gum]
ref|XP_010068841.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          247   5e-74    Eucalyptus grandis [rose gum]
ref|XP_006473755.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     248   6e-74    Citrus sinensis [apfelsine]
ref|XP_004297550.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          248   6e-74    Fragaria vesca subsp. vesca
gb|KEH40252.1|  acyl:CoA ligase                                         248   6e-74    Medicago truncatula
ref|XP_006303947.1|  hypothetical protein CARUB_v10008763mg             248   7e-74    Capsella rubella
ref|XP_002456793.1|  hypothetical protein SORBIDRAFT_03g042910          248   7e-74    Sorghum bicolor [broomcorn]
ref|XP_008356586.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          239   8e-74    
gb|EMT09525.1|  4-coumarate--CoA ligase-like protein 5                  239   8e-74    
ref|XP_002285920.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          247   8e-74    Vitis vinifera
gb|ERM96395.1|  hypothetical protein AMTR_s00001p00239750               247   9e-74    Amborella trichopoda
gb|KJB20367.1|  hypothetical protein B456_003G144900                    244   9e-74    Gossypium raimondii
ref|XP_008452936.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          247   1e-73    Cucumis melo [Oriental melon]
ref|XP_006435318.1|  hypothetical protein CICLE_v10000764mg             247   1e-73    Citrus clementina [clementine]
ref|XP_009334310.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          248   1e-73    Pyrus x bretschneideri [bai li]
gb|EMT20288.1|  4-coumarate--CoA ligase-like protein 6                  237   1e-73    
ref|XP_003564855.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          247   1e-73    Brachypodium distachyon [annual false brome]
ref|XP_010536451.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          246   2e-73    Tarenaya hassleriana [spider flower]
gb|KFK44163.1|  hypothetical protein AALP_AA1G223000                    246   2e-73    Arabis alpina [alpine rockcress]
ref|XP_001754050.1|  predicted protein                                  246   2e-73    
ref|XP_009402705.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          246   2e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010242836.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          246   2e-73    Nelumbo nucifera [Indian lotus]
gb|KCW83188.1|  hypothetical protein EUGRSUZ_B00137                     245   2e-73    Eucalyptus grandis [rose gum]
ref|XP_011041268.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          246   2e-73    Populus euphratica
gb|EMT05035.1|  4-coumarate--CoA ligase-like protein 4                  239   2e-73    
ref|XP_010677916.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          246   2e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010094597.1|  4-coumarate--CoA ligase-like 5                     246   3e-73    Morus notabilis
ref|XP_002307770.1|  4-coumarate--CoA ligase family protein             246   3e-73    
ref|XP_004499325.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     246   3e-73    Cicer arietinum [garbanzo]
gb|KJB08040.1|  hypothetical protein B456_001G060700                    246   3e-73    Gossypium raimondii
ref|XP_010539806.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    246   3e-73    Tarenaya hassleriana [spider flower]
gb|AGO89324.1|  Ca4CL7                                                  246   3e-73    Salix arbutifolia
gb|AGO89325.1|  Ca4CL8                                                  246   3e-73    Salix arbutifolia
gb|ERM96392.1|  hypothetical protein AMTR_s00001p00238960               253   3e-73    Amborella trichopoda
gb|KJB29668.1|  hypothetical protein B456_005G113000                    245   4e-73    Gossypium raimondii
ref|XP_008387876.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          246   4e-73    Malus domestica [apple tree]
ref|XP_010926601.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    246   4e-73    Elaeis guineensis
ref|XP_007132313.1|  hypothetical protein PHAVU_011G084300g             243   4e-73    Phaseolus vulgaris [French bean]
ref|XP_004253129.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          245   5e-73    Solanum lycopersicum
ref|XP_004985831.1|  PREDICTED: 4-coumarate--CoA ligase-like 4-like     245   5e-73    Setaria italica
ref|XP_010229245.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          245   6e-73    Brachypodium distachyon [annual false brome]
ref|XP_008239369.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          245   6e-73    Prunus mume [ume]
gb|KJB40015.1|  hypothetical protein B456_007G042200                    243   6e-73    Gossypium raimondii
ref|XP_011099557.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          245   8e-73    Sesamum indicum [beniseed]
ref|XP_006351482.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     244   8e-73    Solanum tuberosum [potatoes]
ref|XP_008377088.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          245   8e-73    
ref|XP_004236342.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          244   9e-73    Solanum lycopersicum
gb|AHM88424.1|  4CL6                                                    244   1e-72    Fraxinus mandshurica [Manchurian ash]
ref|NP_001048867.1|  Os03g0132000                                       244   1e-72    
gb|KJB08041.1|  hypothetical protein B456_001G060700                    244   1e-72    Gossypium raimondii
ref|XP_002511221.1|  AMP dependent CoA ligase, putative                 244   1e-72    Ricinus communis
gb|KJB40011.1|  hypothetical protein B456_007G042200                    243   1e-72    Gossypium raimondii
ref|XP_001752801.1|  predicted protein                                  244   2e-72    
ref|XP_010041733.1|  PREDICTED: 4-coumarate--CoA ligase 1-like          243   2e-72    
ref|XP_004145532.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          244   2e-72    Cucumis sativus [cucumbers]
ref|NP_173474.5|  4-coumarate--CoA ligase-like 4                        244   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44167.1|  hypothetical protein AALP_AA1G223400                    244   2e-72    Arabis alpina [alpine rockcress]
ref|XP_008392841.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          244   2e-72    Malus domestica [apple tree]
gb|KFK44162.1|  hypothetical protein AALP_AA1G222900                    243   2e-72    Arabis alpina [alpine rockcress]
ref|XP_002991507.1|  hypothetical protein SELMODRAFT_133629             243   3e-72    
gb|KJB40012.1|  hypothetical protein B456_007G042200                    243   3e-72    Gossypium raimondii
ref|XP_007017973.1|  OPC-8:0 CoA ligase1 isoform 2                      243   3e-72    
ref|XP_004970939.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     243   3e-72    Setaria italica
ref|XP_008221158.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          243   3e-72    Prunus mume [ume]
emb|CDP07314.1|  unnamed protein product                                243   3e-72    Coffea canephora [robusta coffee]
gb|KHG15506.1|  4-coumarate--CoA ligase-like 9                          243   3e-72    Gossypium arboreum [tree cotton]
ref|XP_009613176.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          243   4e-72    Nicotiana tomentosiformis
ref|XP_009774473.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          243   4e-72    Nicotiana sylvestris
ref|XP_012090496.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          243   5e-72    Jatropha curcas
gb|EYU17530.1|  hypothetical protein MIMGU_mgv1a003887mg                243   5e-72    Erythranthe guttata [common monkey flower]
ref|XP_010063109.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          243   5e-72    Eucalyptus grandis [rose gum]
ref|XP_002509558.1|  AMP dependent CoA ligase, putative                 242   5e-72    Ricinus communis
emb|CDY31472.1|  BnaC05g15810D                                          241   5e-72    Brassica napus [oilseed rape]
dbj|BAD82768.1|  putative 4-coumarate:coenzyme A ligase                 243   6e-72    Oryza sativa Japonica Group [Japonica rice]
gb|KDO52583.1|  hypothetical protein CISIN_1g011116mg                   241   7e-72    Citrus sinensis [apfelsine]
ref|XP_010498483.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          242   9e-72    Camelina sativa [gold-of-pleasure]
ref|XP_006649341.1|  PREDICTED: 4-coumarate--CoA ligase-like 4-like     242   9e-72    Oryza brachyantha
ref|XP_010459734.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          242   9e-72    Camelina sativa [gold-of-pleasure]
gb|KHN09875.1|  4-coumarate--CoA ligase-like 9                          235   9e-72    Glycine soja [wild soybean]
gb|KFK44161.1|  hypothetical protein AALP_AA1G222800                    242   1e-71    Arabis alpina [alpine rockcress]
ref|XP_002979037.1|  hypothetical protein SELMODRAFT_268211             241   1e-71    
gb|ACL54157.1|  unknown                                                 240   1e-71    Zea mays [maize]
ref|XP_006416390.1|  hypothetical protein EUTSA_v10007270mg             242   1e-71    Eutrema salsugineum [saltwater cress]
gb|KJB74784.1|  hypothetical protein B456_012G007500                    242   1e-71    Gossypium raimondii
dbj|BAJ95119.1|  predicted protein                                      241   1e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006646572.1|  PREDICTED: 4-coumarate--CoA ligase-like 6-like     232   1e-71    Oryza brachyantha
ref|XP_007037922.1|  AMP-dependent synthetase and ligase family p...    247   2e-71    
ref|XP_007222465.1|  hypothetical protein PRUPE_ppa003506mg             241   2e-71    Prunus persica
ref|XP_006447133.1|  hypothetical protein CICLE_v10014804mg             241   2e-71    Citrus clementina [clementine]
ref|XP_004292919.2|  PREDICTED: 4-coumarate--CoA ligase-like 5          241   2e-71    Fragaria vesca subsp. vesca
emb|CBI40069.3|  unnamed protein product                                240   2e-71    Vitis vinifera
ref|XP_006476993.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-li...    241   2e-71    Citrus sinensis [apfelsine]
ref|XP_002265545.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          241   2e-71    Vitis vinifera
ref|XP_008346706.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          241   2e-71    
ref|XP_011652012.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          241   2e-71    Cucumis sativus [cucumbers]
ref|XP_004234005.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          240   3e-71    Solanum lycopersicum
ref|XP_004515681.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     241   3e-71    Cicer arietinum [garbanzo]
gb|KEH29987.1|  4-coumarate:CoA ligase-like protein                     238   3e-71    
ref|XP_002468571.1|  hypothetical protein SORBIDRAFT_01g048200          241   3e-71    
ref|XP_010501535.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          240   3e-71    
gb|EPS66829.1|  hypothetical protein M569_07946                         240   3e-71    
ref|NP_001142142.1|  putative AMP-dependent synthetase and ligase...    240   3e-71    
ref|XP_010943943.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          240   3e-71    
ref|XP_002982349.1|  hypothetical protein SELMODRAFT_116209             239   3e-71    
emb|CDY29527.1|  BnaA06g14430D                                          240   4e-71    
ref|XP_010477286.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    240   4e-71    
emb|CDY33631.1|  BnaC08g19310D                                          240   4e-71    
ref|XP_009336558.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          240   5e-71    
ref|XP_002270592.1|  PREDICTED: 4-coumarate--CoA ligase-like 9 is...    240   5e-71    
ref|XP_006342547.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     240   5e-71    
ref|XP_007209087.1|  hypothetical protein PRUPE_ppa003674mg             240   5e-71    
gb|EYU23108.1|  hypothetical protein MIMGU_mgv1a003608mg                240   6e-71    
ref|XP_007010053.1|  Acyl:coa ligase                                    240   6e-71    
ref|XP_007151545.1|  hypothetical protein PHAVU_004G055800g             239   6e-71    
gb|KJB38766.1|  hypothetical protein B456_006G271000                    239   7e-71    
ref|XP_007209086.1|  hypothetical protein PRUPE_ppa003658mg             239   9e-71    
ref|XP_006852180.2|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    237   1e-70    
ref|XP_001761993.1|  predicted protein                                  239   1e-70    
ref|XP_004152591.2|  PREDICTED: 4-coumarate--CoA ligase-like 9          239   1e-70    
ref|XP_010026707.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          239   1e-70    
ref|XP_010459729.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          239   1e-70    
gb|KHG23973.1|  4-coumarate--CoA ligase-like 7                          239   1e-70    
ref|XP_006356027.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     238   1e-70    
emb|CDP15004.1|  unnamed protein product                                238   2e-70    
ref|XP_009609463.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          228   2e-70    
dbj|BAJ86776.1|  predicted protein                                      239   2e-70    
ref|XP_012079878.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          239   2e-70    
emb|CDX96633.1|  BnaA08g21760D                                          238   2e-70    
ref|XP_009110224.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          238   2e-70    
ref|XP_002514964.1|  AMP dependent CoA ligase, putative                 238   2e-70    
dbj|BAJ84877.1|  predicted protein                                      239   2e-70    
ref|XP_010477284.1|  PREDICTED: 4-coumarate--CoA ligase-like 2 is...    238   2e-70    
gb|AHL44987.1|  4-coumarate:coenzyme A ligase 4                         238   2e-70    
ref|XP_002532625.1|  AMP dependent CoA ligase, putative                 238   3e-70    
gb|AHL44977.1|  4-coumarate:coenzyme A ligase 4                         238   3e-70    
ref|XP_008446209.1|  PREDICTED: uncharacterized protein LOC103489008    245   3e-70    
gb|EMS52826.1|  4-coumarate--CoA ligase-like 5                          230   3e-70    
ref|XP_006307145.1|  hypothetical protein CARUB_v10008735mg             238   3e-70    
ref|XP_009110228.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          238   3e-70    
ref|XP_010534096.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          238   4e-70    
sp|Q8RU95.2|4CLL6_ORYSJ  RecName: Full=4-coumarate--CoA ligase-li...    239   4e-70    
ref|XP_002966508.1|  hypothetical protein SELMODRAFT_85691              236   5e-70    
ref|XP_009359325.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          237   5e-70    
gb|AAP03016.1|  4-coumarate-CoA ligase-like protein                     238   6e-70    
ref|XP_007031778.1|  AMP-dependent synthetase and ligase family p...    237   6e-70    
gb|AGW27198.1|  4-coumarate:coenzyme A ligase 8                         233   6e-70    
gb|EYU43067.1|  hypothetical protein MIMGU_mgv1a004025mg                237   6e-70    
ref|XP_009103340.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          237   7e-70    
ref|XP_002982252.1|  hypothetical protein SELMODRAFT_179406             237   7e-70    
ref|XP_002315339.1|  hypothetical protein POPTR_0010s23680g             238   7e-70    
ref|XP_003553866.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-li...    236   8e-70    
ref|WP_045691886.1|  AMP-dependent synthetase                           236   8e-70    
ref|XP_006416393.1|  hypothetical protein EUTSA_v10007280mg             237   8e-70    
ref|XP_010261634.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          237   9e-70    
ref|WP_045709926.1|  AMP-dependent synthetase                           236   1e-69    
ref|XP_002988726.1|  hypothetical protein SELMODRAFT_128539             238   1e-69    
ref|NP_173472.1|  AMP-dependent synthetase and ligase family protein    237   1e-69    
gb|KJB40013.1|  hypothetical protein B456_007G042200                    236   1e-69    
emb|CBI40068.3|  unnamed protein product                                236   1e-69    
ref|XP_002270555.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          236   1e-69    
ref|XP_011031616.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          236   1e-69    
ref|XP_002311981.1|  hypothetical protein POPTR_0008s03140g             236   1e-69    
ref|XP_003523137.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-li...    237   1e-69    
emb|CDM84903.1|  unnamed protein product                                236   1e-69    
gb|KDO55659.1|  hypothetical protein CISIN_1g008895mg                   236   2e-69    
gb|AJT43268.1|  4-coumarate: coenzyme A ligase                          236   2e-69    
ref|XP_006440064.1|  hypothetical protein CICLE_v10019547mg             236   2e-69    
ref|XP_008222054.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          236   2e-69    
emb|CDX96638.1|  BnaA08g21810D                                          235   3e-69    
gb|KJB20365.1|  hypothetical protein B456_003G144900                    233   3e-69    
ref|XP_002893113.1|  F5M15.18                                           244   3e-69    
ref|XP_009149529.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          235   3e-69    
gb|AGE10595.1|  4-coumarate CoA ligase                                  235   3e-69    
ref|XP_009149527.1|  PREDICTED: 4-coumarate--CoA ligase-like 2          235   4e-69    
ref|XP_010484070.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          235   4e-69    
ref|WP_014066333.1|  AMP-dependent synthetase                           234   4e-69    
ref|XP_008361839.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          235   4e-69    
ref|XP_010250796.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          235   4e-69    
gb|EPS60018.1|  hypothetical protein M569_14786                         234   4e-69    
ref|XP_010520611.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          234   6e-69    
ref|XP_004310199.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    234   6e-69    
ref|XP_007223071.1|  hypothetical protein PRUPE_ppa003742mg             234   7e-69    
gb|KHN23273.1|  4-coumarate--CoA ligase-like 9                          229   7e-69    
ref|XP_009103339.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          234   8e-69    
ref|XP_006416394.1|  hypothetical protein EUTSA_v10007272mg             234   9e-69    
ref|XP_010539807.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    234   9e-69    
emb|CBI18880.3|  unnamed protein product                                233   1e-68    
gb|ERN13647.1|  hypothetical protein AMTR_s00049p00103270               223   1e-68    
ref|XP_002966178.1|  hypothetical protein SELMODRAFT_143817             234   1e-68    
ref|XP_002986342.1|  hypothetical protein SELMODRAFT_182368             233   1e-68    
ref|XP_002986325.1|  hypothetical protein SELMODRAFT_123905             234   1e-68    
ref|XP_010477290.1|  PREDICTED: 4-coumarate--CoA ligase-like 4 is...    233   2e-68    
ref|XP_007040775.1|  Acyl:coa ligase                                    233   2e-68    
gb|AGW27200.1|  4-coumarate:coenzyme A ligase 10                        228   2e-68    
ref|XP_010460206.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          233   2e-68    
ref|XP_002285921.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          233   2e-68    
ref|XP_002318708.2|  hypothetical protein POPTR_0012s09650g             233   2e-68    
gb|ACC63869.1|  4-coumarate:CoA ligase                                  233   2e-68    
ref|XP_003627898.1|  4-coumarate-CoA ligase-like protein                233   2e-68    
ref|XP_006436540.1|  hypothetical protein CICLE_v10033676mg             233   3e-68    
ref|XP_006485343.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     233   3e-68    
ref|XP_011044186.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          233   3e-68    
emb|CDX96637.1|  BnaA08g21800D                                          233   3e-68    
ref|XP_007031780.1|  AMP-dependent synthetase and ligase family p...    233   3e-68    
ref|XP_010692849.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          233   3e-68    
ref|XP_004301643.2|  PREDICTED: 4-coumarate--CoA ligase-like 6          233   3e-68    
gb|EYU23282.1|  hypothetical protein MIMGU_mgv1a006528mg                229   4e-68    
emb|CDY01370.1|  BnaA07g11430D                                          232   4e-68    
gb|EAY88402.1|  hypothetical protein OsI_09863                          233   4e-68    
ref|XP_009627505.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          232   4e-68    
ref|WP_045944478.1|  AMP-dependent synthetase                           232   4e-68    
gb|KHN45330.1|  4-coumarate--CoA ligase-like 9                          231   5e-68    
ref|XP_003602078.1|  4-coumarate-coa ligase                             232   5e-68    
gb|KJB14326.1|  hypothetical protein B456_002G119500                    232   5e-68    
ref|XP_006476995.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     232   6e-68    
ref|XP_009792274.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          232   6e-68    
ref|XP_011086752.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          232   6e-68    
gb|EYU34787.1|  hypothetical protein MIMGU_mgv1a025620mg                231   6e-68    
ref|XP_010477292.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          232   7e-68    
ref|WP_030395752.1|  AMP-dependent synthetase                           231   9e-68    
ref|XP_009110226.1|  PREDICTED: 4-coumarate--CoA ligase-like 8 is...    231   9e-68    
gb|AGW27199.1|  4-coumarate:coenzyme A ligase 9                         229   9e-68    
ref|WP_043468328.1|  AMP-dependent synthetase                           231   9e-68    
gb|KFK28050.1|  hypothetical protein AALP_AA8G465100                    231   1e-67    
gb|AID56317.1|  4-coumarate coenzyme A ligase 4                         231   1e-67    
ref|XP_009359465.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          231   1e-67    
ref|XP_002318710.2|  hypothetical protein POPTR_0012s09670g             231   1e-67    
ref|XP_006416396.1|  hypothetical protein EUTSA_v10007285mg             231   1e-67    
ref|WP_012844691.1|  AMP-dependent synthetase                           231   1e-67    
emb|CDY33628.1|  BnaC08g19280D                                          231   1e-67    
ref|XP_011628972.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    231   1e-67    
ref|XP_010087995.1|  4-coumarate--CoA ligase-like 6                     231   1e-67    
ref|XP_002979110.1|  hypothetical protein SELMODRAFT_177466             231   1e-67    
ref|WP_030311861.1|  AMP-dependent synthetase                           230   1e-67    
ref|XP_007045015.1|  AMP dependent CoA ligase, putative                 231   1e-67    
ref|XP_006851309.2|  PREDICTED: 4-coumarate--CoA ligase 1               231   1e-67    
ref|XP_006376894.1|  hypothetical protein POPTR_0012s09660g             231   2e-67    
sp|Q3E6Y4.2|4CLL3_ARATH  RecName: Full=4-coumarate--CoA ligase-li...    231   2e-67    
ref|XP_006579870.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     231   2e-67    
ref|XP_008239435.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          231   2e-67    
ref|XP_003602077.1|  4-coumarate-coa ligase                             231   2e-67    
ref|XP_002866551.1|  hypothetical protein ARALYDRAFT_919627             231   2e-67    
ref|XP_007137935.1|  hypothetical protein PHAVU_009G167800g             231   2e-67    
gb|KHG20084.1|  4-coumarate--CoA ligase-like 5                          230   2e-67    
ref|XP_004500662.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-li...    230   2e-67    
ref|XP_006280253.1|  hypothetical protein CARUB_v10026169mg             230   3e-67    
ref|XP_004308531.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          230   3e-67    
gb|KJB29671.1|  hypothetical protein B456_005G113000                    231   3e-67    
ref|XP_007017971.1|  OPC-8:0 CoA ligase1                                230   4e-67    
ref|XP_006416392.1|  hypothetical protein EUTSA_v10007637mg             227   4e-67    
emb|CAN65888.1|  hypothetical protein VITISV_009068                     230   4e-67    
ref|XP_003528115.1|  PREDICTED: 4-coumarate--CoA ligase-like 9-like     231   4e-67    
emb|CDY01369.1|  BnaA07g11420D                                          229   4e-67    
ref|XP_011097313.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          229   5e-67    
ref|XP_008389826.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          229   5e-67    
ref|XP_006394285.1|  hypothetical protein EUTSA_v10003983mg             229   5e-67    
gb|AAP03018.1|  4-coumarate-CoA ligase-like protein                     229   6e-67    
emb|CDY31883.1|  BnaC07g15330D                                          229   7e-67    
gb|KHN00949.1|  4-coumarate--CoA ligase-like 5                          224   8e-67    
ref|XP_006283429.1|  hypothetical protein CARUB_v10004477mg             229   8e-67    
ref|XP_011044188.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          229   1e-66    
ref|XP_007031782.1|  AMP-dependent synthetase and ligase family p...    228   1e-66    
ref|XP_006414022.1|  hypothetical protein EUTSA_v10024787mg             229   1e-66    
ref|XP_006424484.1|  hypothetical protein CICLE_v100281391mg            217   1e-66    
gb|KEH39398.1|  4-coumarate:CoA ligase-like protein                     226   1e-66    
gb|AAF79612.1|AC027665_13  F5M15.18                                     237   1e-66    
emb|CDY71478.1|  BnaAnng37600D                                          226   1e-66    
ref|XP_009385865.1|  PREDICTED: putative 4-coumarate--CoA ligase-...    228   1e-66    
ref|XP_008787558.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          228   2e-66    
ref|XP_004144410.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          228   2e-66    
ref|NP_201143.1|  4-coumarate--CoA ligase-like 9                        228   2e-66    
ref|XP_010477287.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    228   2e-66    
gb|KHN37880.1|  4-coumarate--CoA ligase-like 5                          228   3e-66    
ref|XP_003536288.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     228   3e-66    
ref|XP_011024331.1|  PREDICTED: 4-coumarate--CoA ligase-like 5 is...    228   3e-66    
emb|CDY45730.1|  BnaC02g42520D                                          225   3e-66    
ref|XP_010677414.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          228   3e-66    
ref|XP_008232324.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          228   4e-66    
ref|XP_012085635.1|  PREDICTED: 4-coumarate--CoA ligase-like 9 is...    227   4e-66    
gb|KCW78480.1|  hypothetical protein EUGRSUZ_D02624                     226   6e-66    
gb|KCW78479.1|  hypothetical protein EUGRSUZ_D02624                     226   6e-66    
ref|XP_002271586.3|  PREDICTED: 4-coumarate--CoA ligase-like 5          227   7e-66    
ref|XP_011652003.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          226   7e-66    
dbj|BAC42032.1|  putative 4-coumarate-CoA ligase                        227   8e-66    
gb|AAP03017.1|  4-coumarate-CoA ligase-like protein                     226   9e-66    
gb|KFK44164.1|  hypothetical protein AALP_AA1G223100                    226   9e-66    
ref|XP_010536450.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          226   9e-66    
ref|NP_193636.1|  4-coumarate--CoA ligase-like 6                        226   1e-65    
gb|AIB06734.1|  4-coumarate:CoA ligase                                  226   1e-65    
ref|XP_011627004.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          226   1e-65    
gb|KHN35141.1|  4-coumarate--CoA ligase 2                               221   1e-65    
gb|AGJ84134.1|  putative 4-coumarate:CoA ligase                         226   1e-65    
ref|XP_011028085.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          226   1e-65    
gb|KFK28573.1|  hypothetical protein AALP_AA7G013900                    226   1e-65    
gb|KCW78478.1|  hypothetical protein EUGRSUZ_D02624                     226   1e-65    
ref|XP_011044187.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          225   1e-65    
gb|EEC71975.1|  hypothetical protein OsI_04813                          227   2e-65    
ref|XP_010054104.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    225   2e-65    
ref|XP_010912839.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          225   2e-65    
gb|KCW49161.1|  hypothetical protein EUGRSUZ_K02744                     224   2e-65    
gb|KCW65301.1|  hypothetical protein EUGRSUZ_G02758                     224   2e-65    
ref|XP_008381603.1|  PREDICTED: 4-coumarate--CoA ligase-like 6          226   2e-65    
ref|XP_010037440.1|  PREDICTED: 4-coumarate--CoA ligase-like 9 is...    225   2e-65    
ref|XP_007144251.1|  hypothetical protein PHAVU_007G140700g             226   2e-65    
ref|XP_011024064.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    225   2e-65    
ref|XP_010518843.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    225   3e-65    
ref|XP_006307164.1|  hypothetical protein CARUB_v10008755mg             225   3e-65    
ref|XP_012072748.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          224   3e-65    
ref|XP_010940654.1|  PREDICTED: putative 4-coumarate--CoA ligase-...    224   3e-65    
ref|XP_009346655.1|  PREDICTED: 4-coumarate--CoA ligase-like 5          225   3e-65    
ref|XP_003555474.1|  PREDICTED: 4-coumarate--CoA ligase-like 5-like     225   3e-65    
gb|EFX65682.1|  hypothetical protein DAPPUDRAFT_204305                  224   3e-65    
ref|XP_010262467.1|  PREDICTED: putative 4-coumarate--CoA ligase-...    224   3e-65    
ref|XP_011014240.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          213   4e-65    
ref|XP_009132447.1|  PREDICTED: 4-coumarate--CoA ligase-like 6 is...    225   4e-65    
ref|XP_006366277.1|  PREDICTED: 4-coumarate--CoA ligase 2-like          224   4e-65    
ref|XP_009130250.1|  PREDICTED: 4-coumarate--CoA ligase-like 9          224   6e-65    
ref|XP_010459732.1|  PREDICTED: 4-coumarate--CoA ligase-like 4          224   6e-65    



>ref|XP_009603383.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana tomentosiformis]
Length=538

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/221 (85%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +CAKNF QA V QGYGMTETCG+V +E+  +GPRH+GSAG LV  VEAQIVSVDKL+ 
Sbjct  318  MEDCAKNFPQAVVFQGYGMTETCGIVAVESPYVGPRHTGSAGTLVPGVEAQIVSVDKLKP  377

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NPQATKLTID QGWVHTGDLGYF+++GMLYVVDRIKEL
Sbjct  378  LPPGQLGEIWVRGPNMMQGYFNNPQATKLTIDNQGWVHTGDLGYFDEEGMLYVVDRIKEL  437

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  438  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVQKF  497

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTF+NSVPKSASGKILRRELIEKVR+KL
Sbjct  498  IADQVAPFKRLRKVTFVNSVPKSASGKILRRELIEKVRSKL  538



>ref|XP_007150153.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris]
 gb|ESW22147.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris]
Length=536

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 208/221 (94%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F +ATV QGYGMTETCG+V +ENTR+G RHSGSAG+LV+ VEAQIVSVD L+ 
Sbjct  316  MEECAKRFPRATVAQGYGMTETCGIVSVENTRLGIRHSGSAGMLVAGVEAQIVSVDTLKA  375

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NPQAT+LTIDK+GWVHTGDLGYF++DG L+VVDRIKEL
Sbjct  376  LPPGQLGEIWVRGPNMMQGYHNNPQATRLTIDKKGWVHTGDLGYFDEDGQLFVVDRIKEL  435

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDV+KF
Sbjct  436  IKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVQKF  495

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFIN+VPK+ASGKILRRELIEKVR+K+
Sbjct  496  IAKQVAPFKRLRRVTFINAVPKTASGKILRRELIEKVRSKI  536



>gb|AGW47869.1| 4-coumarate:coenzyme A ligase 4 [Phaseolus vulgaris]
Length=536

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 208/221 (94%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F +ATV QGYGMTETCG+V +ENTR+G RHSGSAG+LV+ VEAQIVSVD L+ 
Sbjct  316  MEECAKRFPRATVAQGYGMTETCGIVSVENTRMGIRHSGSAGMLVAGVEAQIVSVDTLKA  375

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NPQAT+LTIDK+GWVHTGDLGYF++DG L+VVDRIKEL
Sbjct  376  LPPGQLGEIWVRGPNMMQGYHNNPQATRLTIDKKGWVHTGDLGYFDEDGQLFVVDRIKEL  435

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDV+KF
Sbjct  436  IKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVQKF  495

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFIN+VPK+ASGKILRRELIEKVR+K+
Sbjct  496  IAKQVAPFKRLRRVTFINAVPKTASGKILRRELIEKVRSKI  536



>emb|CDP07051.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   389 bits (999),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/221 (83%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKNF  A V+QGYGMTETCG+V +EN+ +G RHSGSAG+LV  VEAQIVSV+K + 
Sbjct  1    MQECAKNFPHALVLQGYGMTETCGIVSVENSNLGARHSGSAGMLVPGVEAQIVSVEKSKP  60

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPG+LGEIWVRGPNMMQGY+ NPQATKLTIDK GWVHTGDLGYF+++G LYVVDRIKEL
Sbjct  61   LPPGKLGEIWVRGPNMMQGYFNNPQATKLTIDKLGWVHTGDLGYFDEEGQLYVVDRIKEL  120

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPNSSLTEED+KK+
Sbjct  121  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEEDIKKY  180

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPKSASGKILRRELIEKVR+K+
Sbjct  181  IADQVAPFKRLRRVTFINSVPKSASGKILRRELIEKVRSKV  221



>ref|XP_009786809.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana sylvestris]
Length=538

 Score =   394 bits (1013),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKNF QA V QGYGMTETCG+V +E+  +GPRH+GSAG L   VEAQI+SVDKL+ 
Sbjct  318  MEECAKNFPQAVVFQGYGMTETCGIVAVESPYVGPRHTGSAGTLAPGVEAQIISVDKLKP  377

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NPQATKLTID QGWVHTGDLGYF+++GMLYVVDRIKEL
Sbjct  378  LPPGQLGEIWVRGPNMMQGYFNNPQATKLTIDNQGWVHTGDLGYFDEEGMLYVVDRIKEL  437

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK KG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP+ YVVRSPNSSLTEEDV+KF
Sbjct  438  IKCKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPITYVVRSPNSSLTEEDVQKF  497

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTF+NSVPKSASGKILRRELIEKVR+KL
Sbjct  498  IADQVAPFKRLRKVTFVNSVPKSASGKILRRELIEKVRSKL  538



>gb|KEH39397.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=539

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F  ATV QGYGMTETCG+V +ENTR+G RH+GSAG+LV+ VEAQIVSVD L+ 
Sbjct  319  MEECAKRFPHATVSQGYGMTETCGIVSVENTRMGIRHTGSAGMLVAGVEAQIVSVDTLKP  378

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMM GYY NPQA++LTIDK+GWVHTGDLGYF++DG L+VVDRIKEL
Sbjct  379  LPPGQLGEIWVRGPNMMPGYYNNPQASRLTIDKKGWVHTGDLGYFDEDGNLFVVDRIKEL  438

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPNSSLTEED++KF
Sbjct  439  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEEDIQKF  498

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFIN+VPK+ASGKILRRELI+K R+K+
Sbjct  499  IADQVAPFKRLRRVTFINTVPKTASGKILRRELIDKARSKI  539



>ref|XP_006340129.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Solanum tuberosum]
Length=541

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/221 (83%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +CAKNF QA V+QGYGMTETCG+V +EN   GPRH+GSAG L S VEAQIVSVDK + 
Sbjct  321  MEDCAKNFPQAVVMQGYGMTETCGIVSMENVYAGPRHTGSAGTLASGVEAQIVSVDKSKP  380

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMM+GY+ NPQATKLTID QGWVHTGDLGYF +DG+LYVVDRIKEL
Sbjct  381  LPPGQLGEIWVRGPNMMKGYFNNPQATKLTIDNQGWVHTGDLGYFTEDGLLYVVDRIKEL  440

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPNSSLTEE+V+KF
Sbjct  441  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEENVQKF  500

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRL+KVTFINSVPKSA+GKILRRELI+KVR+K+
Sbjct  501  IADQVAPFKRLKKVTFINSVPKSAAGKILRRELIDKVRSKI  541



>ref|XP_004251107.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Solanum lycopersicum]
Length=538

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +CAKNF QA V+QGYGMTETCG+V +EN  +GPRH+GSAG L   +EAQIVSVDK + 
Sbjct  318  MEDCAKNFPQAVVMQGYGMTETCGIVSVENMCVGPRHTGSAGSLAPGIEAQIVSVDKSKP  377

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMM+GY+ NPQAT LTID QGWVHTGDLGYF +DG+LYVVDRIKEL
Sbjct  378  LPPGQLGEIWVRGPNMMKGYFNNPQATMLTIDNQGWVHTGDLGYFTEDGLLYVVDRIKEL  437

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPNSSLTEEDV+KF
Sbjct  438  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEEDVQKF  497

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRL+KVTFINSVPKSASGKILRRELI+KVR+K+
Sbjct  498  IADQVAPFKRLKKVTFINSVPKSASGKILRRELIDKVRSKI  538



>gb|AHL44983.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica]
Length=543

 Score =   390 bits (1002),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKNF QA VIQGYGMTETCG+V IEN   GPRHSGS G+L   VE+QIVSVDKL+ 
Sbjct  323  MQECAKNFPQAIVIQGYGMTETCGIVSIENQHAGPRHSGSTGMLSPGVESQIVSVDKLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQ GEIWVRGPNMMQGY+ N QAT+LTIDKQGWVHTGD+GYF++DG LYVVDRIKEL
Sbjct  383  LPPGQSGEIWVRGPNMMQGYFNNSQATRLTIDKQGWVHTGDIGYFDEDGQLYVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+Q+APAELEGLLVSHPEI DA VIP+PDAEAGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  443  IKYKGFQIAPAELEGLLVSHPEILDAAVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTF NSVPKSASGKILRRELI KVR+KL
Sbjct  503  IADQVAPFKRLRRVTFTNSVPKSASGKILRRELIAKVRSKL  543



>gb|AGW27195.1| 4-coumarate:coenzyme A ligase 5 [Salvia miltiorrhiza]
Length=545

 Score =   390 bits (1002),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F QA V+QGYGMTETCG+V +EN   GPRHSGSAG+LV  VE QIVSV+ L+ 
Sbjct  325  MQECAKTFPQAVVMQGYGMTETCGIVSVENAYAGPRHSGSAGMLVPGVECQIVSVETLKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q+GEIWVRG NMMQGY++NPQATKLTIDKQGWVHTGDLGYF++DG+LYVVDRIKEL
Sbjct  385  LPPTQMGEIWVRGQNMMQGYFRNPQATKLTIDKQGWVHTGDLGYFDEDGLLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVP AYVVR+PNSSL+EED+KKF
Sbjct  445  IKYKGLQVAPAELEGLLVSHPEISDAVVIPYPDAEAGEVPAAYVVRAPNSSLSEEDIKKF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPKSASGKILRRELI+KVR+ L
Sbjct  505  IADQVAPFKRLRRVTFINSVPKSASGKILRRELIDKVRSNL  545



>gb|AIR95612.1| 4-coumarate:CoA ligase-like protein [Betula pendula]
Length=545

 Score =   387 bits (994),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 184/221 (83%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+N  QA V QGYGMTETCGVV +EN R+G RH+GSAGLLVS VE+QIVSVD L+ 
Sbjct  325  MEECARNIPQAVVAQGYGMTETCGVVSVENPRVGVRHTGSAGLLVSGVESQIVSVDTLKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGYY NPQATKLTIDKQGWVHTGDLGYF+ DG LYVVDRIKEL
Sbjct  385  LPPNQLGEIWVRGPNMMQGYYNNPQATKLTIDKQGWVHTGDLGYFDGDGHLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTE D  KF
Sbjct  445  IKYKGFQVAPAELEGLLISHPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLTEVDAMKF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFIN VPKSASGKILRRELIEKV +K+
Sbjct  505  IANQVAPFKRLRRVTFINKVPKSASGKILRRELIEKVGSKM  545



>ref|XP_010045319.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
Length=544

 Score =   387 bits (994),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +CAKNF QA V+QGYGMTETCG+V +EN   GPRH+GSAG LV+ VEAQ++SVD L+ 
Sbjct  324  MEDCAKNFPQADVMQGYGMTETCGIVSVENANFGPRHTGSAGQLVAGVEAQVISVDTLKS  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GYY NPQATKLTID +GWVHTGDLGYF+++G LYVVDRIKEL
Sbjct  384  LPPNQLGEIWVRGPNMMKGYYNNPQATKLTIDNKGWVHTGDLGYFDEEGQLYVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRSP SSLTEE+V+KF
Sbjct  444  IKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSPTSSLTEEEVQKF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTF+NSVPKSASGKILRRELI KVRAK+
Sbjct  504  IANQVAPFKRLRRVTFVNSVPKSASGKILRRELIAKVRAKI  544



>ref|XP_011089239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
7 [Sesamum indicum]
Length=549

 Score =   387 bits (994),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 200/225 (89%), Gaps = 4/225 (2%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIEN----TRIGPRHSGSAGLLVSAVEAQIVSVD  687
            M ECAKNF QA V+QGYGMTETCG+V IEN          HSGSAG L   VE QIVSVD
Sbjct  325  MQECAKNFPQAVVVQGYGMTETCGIVSIENPYASAXXXXXHSGSAGTLAPGVEGQIVSVD  384

Query  686  KLQHLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDR  507
            KL+ LPPGQLGEIWVRGPNMMQGY+ NPQATKLTIDKQGWVHTGDLGYF+ +G LYVVDR
Sbjct  385  KLKPLPPGQLGEIWVRGPNMMQGYFNNPQATKLTIDKQGWVHTGDLGYFDDEGQLYVVDR  444

Query  506  IKELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEED  327
            IKELIKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP+AYVVR+PNSSLTEED
Sbjct  445  IKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPIAYVVRAPNSSLTEED  504

Query  326  VKKFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            VKKFIA QVAP+KRLR+VTFINSVPKSASGKILRRELI+KVR+KL
Sbjct  505  VKKFIADQVAPFKRLRRVTFINSVPKSASGKILRRELIDKVRSKL  549



>gb|EYU18792.1| hypothetical protein MIMGU_mgv1a004091mg [Erythranthe guttata]
Length=544

 Score =   386 bits (992),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA NF QA V QGYGMTETCG+V IEN   GPRHSGSAG+LV  VE QIVSVDK   
Sbjct  324  MQECANNFPQAVVCQGYGMTETCGIVSIENPYSGPRHSGSAGMLVPGVECQIVSVDKSTP  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NP ATKLTIDKQ WVHTGDLGYF++DG L+VVDRIKEL
Sbjct  384  LPPGQLGEIWVRGPNMMQGYFNNPVATKLTIDKQRWVHTGDLGYFDEDGQLFVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKGYQVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP AYVVR+PNSSL+EED+KKF
Sbjct  444  IKYKGYQVAPAELEGLLVSHPEISDAVVIPFPDAEAGEVPAAYVVRAPNSSLSEEDIKKF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFI SVPKSA+GKILRRELIEKVR+K+
Sbjct  504  IAEQVAPFKRLRRVTFITSVPKSAAGKILRRELIEKVRSKI  544



>gb|KJB83874.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii]
Length=583

 Score =   386 bits (991),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/221 (81%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+NF QA V+QG+GMTETCGVV +ENT +G R++GS G+LVS VEAQIV  + L+ 
Sbjct  363  MEECARNFPQAVVMQGFGMTETCGVVSMENTSVGVRNTGSTGMLVSNVEAQIVCTESLKP  422

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP + GEIWVRGPNMMQGY+ NPQATKLTIDK+GW+HTGDLGYF++DG LYVVDRIKEL
Sbjct  423  LPPKKFGEIWVRGPNMMQGYFNNPQATKLTIDKKGWMHTGDLGYFDEDGNLYVVDRIKEL  482

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+Q+APAELEGLLVSHPEI DAVVIPYPDAEAGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  483  IKYKGFQIAPAELEGLLVSHPEISDAVVIPYPDAEAGEVPIAYVVRSPNSSLTEEDVQKF  542

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPKSASGKILRR+LIEKVRAK+
Sbjct  543  IAEQVAPFKRLRRVTFINSVPKSASGKILRRQLIEKVRAKI  583



>gb|KHN21493.1| 4-coumarate--CoA ligase-like 7 [Glycine soja]
Length=533

 Score =   384 bits (986),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F  A V QGYGMTETCG+V +EN R+G R+SGS G+LV+ +EAQ+VSVD L+ 
Sbjct  313  MKECAKRFPHAIVSQGYGMTETCGIVSVENARMGIRNSGSTGMLVAGMEAQVVSVDTLKP  372

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NPQAT+LT+DK+GWVHTGDLGYF++DG L+VVDRIKEL
Sbjct  373  LPPGQLGEIWVRGPNMMQGYHNNPQATRLTMDKKGWVHTGDLGYFDEDGQLFVVDRIKEL  432

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSH EI DAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDV+KF
Sbjct  433  IKYKGFQVAPAELEGLLVSHAEILDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVQKF  492

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KR+R+VTFIN+VPK+ASGKILRRELIEKVR+K+
Sbjct  493  IAKQVAPFKRIRRVTFINAVPKTASGKILRRELIEKVRSKI  533



>ref|NP_001243292.1| 4-coumarate--CoA ligase-like 7-like [Glycine max]
 gb|AEX25890.1| 4-coumarate:CoA ligase [Glycine max]
Length=540

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F  A V QGYGMTETCG+V +EN R+G R+SGS G+LV+ +EAQ+VSVD L+ 
Sbjct  320  MKECAKRFPHAIVSQGYGMTETCGIVSVENARMGIRNSGSTGMLVAGMEAQVVSVDTLKP  379

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NPQAT+LT+DK+GWVHTGDLGYF++DG L+VVDRIKEL
Sbjct  380  LPPGQLGEIWVRGPNMMQGYHNNPQATRLTMDKKGWVHTGDLGYFDEDGQLFVVDRIKEL  439

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSH EI DAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDV+KF
Sbjct  440  IKYKGFQVAPAELEGLLVSHAEILDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVQKF  499

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KR+R+VTFIN+VPK+ASGKILRRELIEKVR+K+
Sbjct  500  IAKQVAPFKRIRRVTFINAVPKTASGKILRRELIEKVRSKI  540



>gb|KCW87479.1| hypothetical protein EUGRSUZ_B03943 [Eucalyptus grandis]
Length=670

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +CAKNF QA V+QGYGMTETCG+V +EN   GPRH+GSAG LV+ VEAQ++SVD L+ 
Sbjct  450  MEDCAKNFPQADVMQGYGMTETCGIVSVENANFGPRHTGSAGQLVAGVEAQVISVDTLKS  509

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GYY NPQATKLTID +GWVHTGDLGYF+++G LYVVDRIKEL
Sbjct  510  LPPNQLGEIWVRGPNMMKGYYNNPQATKLTIDNKGWVHTGDLGYFDEEGQLYVVDRIKEL  569

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRSP SSLTEE+V+KF
Sbjct  570  IKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSPTSSLTEEEVQKF  629

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTF+NSVPKSASGKILRRELI KVRAK+
Sbjct  630  IANQVAPFKRLRRVTFVNSVPKSASGKILRRELIAKVRAKI  670



>ref|XP_004291645.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Fragaria vesca subsp. 
vesca]
Length=543

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F Q  V+QGYGMTETCG+V +ENT +GPRHSGSAG LVS VE QIVSVD L+ 
Sbjct  323  MEECAKVFPQGLVVQGYGMTETCGIVSVENTLVGPRHSGSAGTLVSGVECQIVSVDTLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM GY+ NPQAT+ TIDK GWVHTGDLGYF++ G L+VVDRIKEL
Sbjct  383  LPPKQLGEIWVRGPNMMIGYFNNPQATQQTIDKNGWVHTGDLGYFDESGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKGYQVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPN+SLTEED+K F
Sbjct  443  IKYKGYQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNTSLTEEDIKSF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVA +KRLR+VTFIN+VPKSASGKILRRELIEKVR+K+
Sbjct  503  IASQVASFKRLRRVTFINTVPKSASGKILRRELIEKVRSKI  543



>gb|AGA17924.1| CCL7 [Humulus lupulus]
Length=544

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK      V QGYGMTETCG+V +E+TR G RH+GSAG+L S VEAQIVSVD L+ 
Sbjct  324  MEECAKIVPHGIVAQGYGMTETCGIVSVEDTRGGKRHTGSAGMLSSGVEAQIVSVDTLKP  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NP+ATKLTIDK+GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  384  LPPNQLGEIWVRGPNMMQGYFNNPRATKLTIDKKGWVHTGDLGYFDEDGHLYVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDA+AGEVPVAYVVRSPNSSLTE+DVKKF
Sbjct  444  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDADAGEVPVAYVVRSPNSSLTEDDVKKF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IAGQVA +KRLRKVTFINSVPKSASGKILRRELI+KVR+ +
Sbjct  504  IAGQVASFKRLRKVTFINSVPKSASGKILRRELIQKVRSNI  544



>ref|XP_010267197.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nelumbo nucifera]
Length=543

 Score =   382 bits (980),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKNF QA V+QGYG+TETCG+V ++N R G RH+GS G LV  +EAQIVSVD L+ 
Sbjct  323  MEECAKNFPQAVVVQGYGLTETCGIVSLDNPRGGARHTGSTGTLVPGIEAQIVSVDTLKL  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NPQATK TIDKQGWVHTGDLGYF+ +G L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMQGYFNNPQATKSTIDKQGWVHTGDLGYFDDEGRLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLL+SHPEI DAVVIP PDAEAGEVP+AYVVR+PNSSLTEEDV+KF
Sbjct  443  IKYKGFQVAPAELEGLLLSHPEILDAVVIPLPDAEAGEVPIAYVVRTPNSSLTEEDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTF NSVPKSASGKILRRELI+KVR+KL
Sbjct  503  IAKQVAPFKRLRRVTFTNSVPKSASGKILRRELIQKVRSKL  543



>ref|XP_004487067.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cicer arietinum]
Length=539

 Score =   381 bits (979),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F    V QGYGMTET G+V +ENTR+G RH+GSAG+     EAQIVSVD L+ 
Sbjct  319  MEECAKRFPHTIVAQGYGMTETSGIVSVENTRMGVRHTGSAGMXXXXXEAQIVSVDTLKP  378

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPGQLGEIWVRGPNMMQGY+ NPQAT LTIDK GWVHTGDLGYF++DG L+VVDRIKEL
Sbjct  379  LPPGQLGEIWVRGPNMMQGYHNNPQATSLTIDKSGWVHTGDLGYFDEDGHLFVVDRIKEL  438

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVPVAYVVRSPNSSLTE+DV+KF
Sbjct  439  IKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEKDVQKF  498

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTFI++VPK+ASGKILRRELI+KVR+K+
Sbjct  499  IADQVAPFKRLRKVTFISTVPKTASGKILRRELIDKVRSKI  539



>ref|XP_003638044.1| 4-coumarate-coa ligase [Medicago truncatula]
Length=218

 Score =   369 bits (947),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  812  QGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGP  633
            +GYGMTETCG+V +ENTR+G RH+GSAG+LV+ VEAQIVSVD L+ LPPGQLGEIWVRGP
Sbjct  12   RGYGMTETCGIVSVENTRMGIRHTGSAGMLVAGVEAQIVSVDTLKPLPPGQLGEIWVRGP  71

Query  632  NMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELE  453
            NMM GYY NPQA++LTIDK+GWVHTGDLGYF++DG L+VVDRIKELIKYKG+QVAPAELE
Sbjct  72   NMMPGYYNNPQASRLTIDKKGWVHTGDLGYFDEDGNLFVVDRIKELIKYKGFQVAPAELE  131

Query  452  GLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKV  273
            GLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPNSSLTEED++KFIA QVAP+KRLR+V
Sbjct  132  GLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEEDIQKFIADQVAPFKRLRRV  191

Query  272  TFINSVPKSASGKILRRELIEKVRAKL  192
            TFIN+VPK+ASGKILRRELI+K R+K+
Sbjct  192  TFINTVPKTASGKILRRELIDKARSKI  218



>ref|XP_007016849.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 gb|EOY34468.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
Length=545

 Score =   379 bits (974),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+NF QA V+QGYGMTETCG+V +EN  +G RH+ S G+L S+VEAQIV  + L+ 
Sbjct  325  MEECARNFPQAVVLQGYGMTETCGIVSVENPNVGARHTASTGMLASSVEAQIVRTETLKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NPQATKLTID +GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  385  LPPNQLGEIWVRGPNMMQGYFNNPQATKLTIDGKGWVHTGDLGYFDEDGNLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVPVAYVVRSP+SSLTE DV+ F
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVPVAYVVRSPSSSLTEVDVQNF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFI+SVPKSASGKILRRELIEKVR+K+
Sbjct  505  IAKQVAPFKRLRRVTFISSVPKSASGKILRRELIEKVRSKM  545



>ref|XP_006373451.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|ERP51248.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=543

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN   AT+IQG+GMTETCG+V +E+ RIG RHSGSAG+L + +EAQI+SV+  + 
Sbjct  323  MKECAKNLPDATIIQGFGMTETCGIVSLEDPRIGVRHSGSAGILNAGIEAQIISVETAKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK TIDK+GWVHTGDLGYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKKGWVHTGDLGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVV PYPDAEAGEVPVAYVVRSPNS+LTEEDV+KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVTPYPDAEAGEVPVAYVVRSPNSALTEEDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            I+ QVAP+KRLRKVTFINSVPKSASGKILRREL++KV++K+
Sbjct  503  ISDQVAPFKRLRKVTFINSVPKSASGKILRRELVQKVKSKM  543



>gb|AFD33347.1| acyl-activating enzyme 3 [Cannabis sativa]
Length=543

 Score =   377 bits (969),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC+K      V QGYGMTETCG+V +E+ R G R+SGSAG+L S VEAQIVSVD L+ 
Sbjct  323  MEECSKVVPYGIVAQGYGMTETCGIVSMEDIRGGKRNSGSAGMLASGVEAQIVSVDTLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWV+GPNMMQGY+ NPQATKLTIDK+GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  383  LPPNQLGEIWVKGPNMMQGYFNNPQATKLTIDKKGWVHTGDLGYFDEDGHLYVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPNSSLTE DVKKF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTENDVKKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IAGQVA +KRLRKVTFINSVPKSASGKILRRELI+KVR+ +
Sbjct  503  IAGQVASFKRLRKVTFINSVPKSASGKILRRELIQKVRSNM  543



>emb|CBI17160.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   365 bits (937),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK+     V QGYGMTETCG+V  E  +IG +H+GS G LVS VEAQI+SVD L+ 
Sbjct  1    MEECAKSLPHVAVGQGYGMTETCGIVSKEIPKIGIQHTGSTGPLVSGVEAQIISVDTLKP  60

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATKLTIDK+GWVHTGD+GYF++ G L+VVDRIKEL
Sbjct  61   LPPNQLGEIWVRGPNMMKGYFNNPQATKLTIDKKGWVHTGDVGYFDEQGKLFVVDRIKEL  120

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LLVSHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDVK F
Sbjct  121  IKYKGFQVAPAELEALLVSHPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVKTF  180

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+V+FIN+VPKSASGKILRRELIEKVRAKL
Sbjct  181  IANQVAPFKKLRRVSFINTVPKSASGKILRRELIEKVRAKL  221



>ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
 gb|EMJ09656.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
Length=542

 Score =   376 bits (966),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK   Q  + QGYGMTETCG+  +ENT +GPRH+GS G+LVS VE QIVSVD L+ 
Sbjct  322  MEECAKVIPQGLIAQGYGMTETCGIASVENTLVGPRHTGSTGMLVSGVECQIVSVDTLKP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP +LGEIWVRGPNMM GY+ NPQAT  TIDK GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  382  QPPNKLGEIWVRGPNMMSGYFNNPQATNETIDKNGWVHTGDLGYFDEDGQLYVVDRIKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLL+SHPEI DAVVIP+PDAEAGEVPVAY VR+PNSSLTEEDVK F
Sbjct  442  IKYKGFQVAPAELEGLLISHPEILDAVVIPFPDAEAGEVPVAYCVRTPNSSLTEEDVKNF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPKSASGKILRRELI+KVR+K+
Sbjct  502  IANQVAPFKRLRRVTFINSVPKSASGKILRRELIDKVRSKI  542



>ref|XP_012064724.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X2 [Jatropha 
curcas]
Length=455

 Score =   374 bits (959),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK+   A V QGYGMTET G++ +EN RIG RH+GSAG LV  VEAQIVSVD L+ 
Sbjct  235  MEECAKSIPNAVVAQGYGMTETTGIISVENPRIGVRHTGSAGTLVPGVEAQIVSVDTLKP  294

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWVRGPNMM+GY+ NPQATK TID++GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  295  LPPKQTGEIWVRGPNMMRGYFNNPQATKDTIDRKGWVHTGDLGYFDEDGRLYVVDRIKEL  354

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  355  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVQKF  414

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRL++V+FIN+VPKSA+GKILRRELIEKV++KL
Sbjct  415  IADQVAPFKRLKRVSFINTVPKSAAGKILRRELIEKVKSKL  455



>ref|XP_002523698.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF38638.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=542

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK    A + QGYGMTET G+V +EN RIG RHSGSAG L + +EAQI+SVD L+ 
Sbjct  322  MEECAKTIPHAAIAQGYGMTETTGIVSVENPRIGVRHSGSAGTLAAGIEAQIISVDTLKP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK TIDK+GW+HTGDLGYF++DG LYVVDRIKEL
Sbjct  382  LPPNQLGEIWVRGPNMMRGYFNNPQATKQTIDKKGWLHTGDLGYFDEDGKLYVVDRIKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPE+ DAVVIP+PDAEAGEVPVAYVVRSPNSSLTEE+V+K+
Sbjct  442  IKYKGFQVAPAELEGLLVSHPELLDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEEEVQKY  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFIN+VPKSASGKILRRELIEKV++KL
Sbjct  502  IADQVAPFKRLRRVTFINTVPKSASGKILRRELIEKVKSKL  542



>ref|XP_011021220.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X1 [Populus 
euphratica]
Length=543

 Score =   374 bits (961),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN    T+IQG+GMTETCG+V +E+ RIG RHSGSAG+L + +EAQIVSV+ L+ 
Sbjct  323  MKECAKNLPDTTIIQGFGMTETCGIVSLEDPRIGVRHSGSAGILNAGIEAQIVSVETLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK TIDK+GW+HTGDLGYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLHTGDLGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVV PYPDAEAG VPVAYVVRSPNS+LTEEDV+KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVTPYPDAEAGAVPVAYVVRSPNSALTEEDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            I+ QVAP+KRLRKVTFI+SVPKSASGKILRREL++KV++K+
Sbjct  503  ISDQVAPFKRLRKVTFISSVPKSASGKILRRELVQKVKSKM  543



>ref|XP_011021221.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X2 [Populus 
euphratica]
Length=543

 Score =   374 bits (959),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN    T+IQG+GMTETCG+V +E+ RIG RHSGSAG+L + +EAQIVSV+ L+ 
Sbjct  323  MKECAKNLPDTTIIQGFGMTETCGIVSLEDPRIGVRHSGSAGILNAGIEAQIVSVETLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK TIDK+GW+HTGDLGYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLHTGDLGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVV PYPDAEAG VPVAYVVRSPNS+LTEEDV+KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVTPYPDAEAGAVPVAYVVRSPNSALTEEDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            I+ Q+AP+KRLRKVTFI+SVPKSASGKILRREL++KV++K+
Sbjct  503  ISDQLAPFKRLRKVTFISSVPKSASGKILRRELVQKVKSKM  543



>ref|XP_012064722.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X1 [Jatropha 
curcas]
 gb|KDP43987.1| hypothetical protein JCGZ_05454 [Jatropha curcas]
Length=542

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK+   A V QGYGMTET G++ +EN RIG RH+GSAG LV  VEAQIVSVD L+ 
Sbjct  322  MEECAKSIPNAVVAQGYGMTETTGIISVENPRIGVRHTGSAGTLVPGVEAQIVSVDTLKP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWVRGPNMM+GY+ NPQATK TID++GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  382  LPPKQTGEIWVRGPNMMRGYFNNPQATKDTIDRKGWVHTGDLGYFDEDGRLYVVDRIKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  442  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVQKF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRL++V+FIN+VPKSA+GKILRRELIEKV++KL
Sbjct  502  IADQVAPFKRLKRVSFINTVPKSAAGKILRRELIEKVKSKL  542



>ref|XP_002305282.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|EEE85793.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=543

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     + QGYGMTETCG+V +E++R+G RHSGSAG+L + +EAQIVSV+ L+ 
Sbjct  323  MKECAKNLPDTIISQGYGMTETCGIVSVEDSRLGVRHSGSAGILAAGIEAQIVSVETLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK T+DK+GWVHTGD+GYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYFNNPQATKDTMDKKGWVHTGDVGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHP+I DAVVIPYPDAEAGEVPVAYVVRSPNS+LTE DV+KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPQILDAVVIPYPDAEAGEVPVAYVVRSPNSALTEVDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTFIN+VPKSASGKILRRELI++V++K+
Sbjct  503  IADQVAPFKRLRKVTFINTVPKSASGKILRRELIQQVKSKI  543



>ref|XP_011004441.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Populus euphratica]
Length=543

 Score =   372 bits (954),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     + QGYGMTETCG+V +E++R+G RHSGSAG+L + +EAQIVSV+ L+ 
Sbjct  323  MKECAKNLPDTIISQGYGMTETCGIVSVEDSRLGVRHSGSAGILAAGIEAQIVSVETLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK TIDK+GW+HTGDLGYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLHTGDLGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHP+I DAVVIPYPDAEAGEVPVAYVVRSPNS+LTE DV+KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPQILDAVVIPYPDAEAGEVPVAYVVRSPNSALTEVDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTF N+VPKSASGKILRRELI++V++K+
Sbjct  503  IADQVAPFKRLRKVTFTNTVPKSASGKILRRELIQQVKSKI  543



>ref|XP_010111818.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
 gb|EXC31783.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
Length=665

 Score =   375 bits (963),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK   Q  VIQGYGMTETCG+V +E+TR G R++GSAG LVS VEAQIV VD L+ 
Sbjct  319  MEECAKIIPQGVVIQGYGMTETCGIVSVEDTRGGKRNTGSAGTLVSGVEAQIVGVDTLKP  378

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY  NPQATK T+DK+GWVHTGDLGYF++DG L+VVDRIKEL
Sbjct  379  LPPNQLGEIWVRGPNMMQGYLNNPQATKSTMDKKGWVHTGDLGYFDEDGHLFVVDRIKEL  438

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAYVVRSPNSSLTEEDV+KF
Sbjct  439  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEEDVQKF  498

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            IA QVAP+KRLRKVTFINSVPKSASGKILRRELIEK
Sbjct  499  IANQVAPFKRLRKVTFINSVPKSASGKILRRELIEK  534



>ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
 gb|ESR37730.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
Length=545

 Score =   370 bits (949),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN   ATVIQGYG+TET G+  +EN+  G R+ GSAG L   VEA IVSVD  + 
Sbjct  325  MEECAKNVPSATVIQGYGLTETSGIATMENSFAGSRNIGSAGALAPGVEALIVSVDTQKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIW+RGPNMMQGYY N QATKLTIDK+GWVHTGDLGYF+ DG LYVVDRIKEL
Sbjct  385  LPPNQLGEIWLRGPNMMQGYYNNEQATKLTIDKKGWVHTGDLGYFDGDGQLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVQKF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPKSASGKILRRELI KVRAK+
Sbjct  505  IAKQVAPFKRLRRVTFINSVPKSASGKILRRELIAKVRAKM  545



>gb|KHN38721.1| 4-coumarate--CoA ligase-like 7 [Glycine soja]
Length=435

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC + F    + QGYGMTETCG+V +EN R+G RH+GS G LVS VEAQIVSVD  + 
Sbjct  215  MEECGRRFPHVAICQGYGMTETCGIVSVENPRVGVRHTGSTGTLVSGVEAQIVSVDTQKP  274

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NP+AT+LTIDK+GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  275  LPPRQLGEIWVRGPNMMQGYHNNPEATRLTIDKKGWVHTGDLGYFDEDGQLYVVDRIKEL  334

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI +AVV+PYPD EAGEVP+AYVVRSPNSSLTEE+++KF
Sbjct  335  IKYKGFQVAPAELEGLLVSHPEILEAVVVPYPDDEAGEVPIAYVVRSPNSSLTEEEIQKF  394

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+VTFIN+VPK+ASGKILRREL  K R+K+
Sbjct  395  IAKQVAPFKKLRRVTFINNVPKTASGKILRRELTAKARSKI  435



>ref|XP_009356915.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri]
Length=545

 Score =   369 bits (947),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK   Q  V QGYGMTETCG+V +ENT  G RH+GS G+LVS VE QIVSVD L+ 
Sbjct  325  MEECAKIIPQGVVAQGYGMTETCGIVSVENTLAGSRHTGSTGMLVSGVECQIVSVDTLKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM GY+ NPQAT  TIDK GWVHTGDLGY ++DG LYVVDRIKEL
Sbjct  385  QPPKQLGEIWVRGPNMMTGYFNNPQATNETIDKNGWVHTGDLGYIDEDGQLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVPVAY VR+PNSSLTEEDVK F
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPVAYCVRTPNSSLTEEDVKSF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVA +KRLR+V+FINSVPKSASGKILRRELIEKVR+K+
Sbjct  505  IASQVASFKRLRRVSFINSVPKSASGKILRRELIEKVRSKI  545



>gb|KJB20364.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=517

 Score =   368 bits (944),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F QA V+QGYGMTETC ++ +EN   G RH+GSAGLL   +EAQIVS +  + 
Sbjct  297  MEECAKKFPQAVVMQGYGMTETCAIISMENLAFGVRHTGSAGLLAPGIEAQIVSTENPKP  356

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NP+ATK TID++GWVHTGDLGYFN++G LYVVDRIKEL
Sbjct  357  LPPKQLGEIWVRGPNMMQGYFNNPEATKQTIDEKGWVHTGDLGYFNENGYLYVVDRIKEL  416

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+Q+APAELEGLLVSHPEI DAV IPYPD EAGEVPVAYVVRSPNSSLTEEDV KF
Sbjct  417  IKYKGFQIAPAELEGLLVSHPEIVDAVTIPYPDDEAGEVPVAYVVRSPNSSLTEEDVLKF  476

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTF++SVPKS SGKILRRELI KVR+K+
Sbjct  477  IAKQVAPFKRLRKVTFVSSVPKSVSGKILRRELIAKVRSKM  517



>ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=545

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN   ATVIQGYG+TET G+  +EN+  G R+ GSAG L   VEA IVSVD  + 
Sbjct  325  MEECAKNVPSATVIQGYGLTETSGIATMENSFAGSRNIGSAGALAPGVEALIVSVDTQKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIW+RGPNMM+GYY N QATKLTIDK+GWVHTGDLGYF+ DG LYVVDRIKEL
Sbjct  385  LPPNQLGEIWLRGPNMMRGYYNNEQATKLTIDKKGWVHTGDLGYFDGDGQLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPLAYVVRSPNSSLTEEDVQKF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPKSASGKILRRELI KVRAK+
Sbjct  505  IAKQVAPFKRLRRVTFINSVPKSASGKILRRELIAKVRAKM  545



>ref|XP_002276353.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Vitis vinifera]
Length=544

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK+     V QGYGMTETCG+V  E  +IG +H+GS G LVS VEAQI+SVD L+ 
Sbjct  324  MEECAKSLPHVAVGQGYGMTETCGIVSKEIPKIGIQHTGSTGPLVSGVEAQIISVDTLKP  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATKLTIDK+GWVHTGD+GYF++ G L+VVDRIKEL
Sbjct  384  LPPNQLGEIWVRGPNMMKGYFNNPQATKLTIDKKGWVHTGDVGYFDEQGKLFVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LLVSHPEI DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDVK F
Sbjct  444  IKYKGFQVAPAELEALLVSHPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVKTF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+V+FIN+VPKSASGKILRRELIEKVRAKL
Sbjct  504  IANQVAPFKKLRRVSFINTVPKSASGKILRRELIEKVRAKL  544



>ref|XP_008226338.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Prunus mume]
Length=532

 Score =   365 bits (938),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            V QGYGMTETCG+  +ENT +GPRH+GS G+LVS VE QIVSVD L+  PP +LGEIWVR
Sbjct  324  VSQGYGMTETCGIASVENTLVGPRHTGSTGMLVSGVECQIVSVDTLKPQPPNKLGEIWVR  383

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GPNMM GY+ NPQAT  TID+ GWVHTGDLGYF++DG LYVVDRIKELIKYKG+QVAPAE
Sbjct  384  GPNMMSGYFNNPQATNETIDRNGWVHTGDLGYFDEDGQLYVVDRIKELIKYKGFQVAPAE  443

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LEGLLVSHPEI DAVVIP+PDAEAGEVPVAY VR+PNSSLTEEDVK FIA QVAP+KRLR
Sbjct  444  LEGLLVSHPEILDAVVIPFPDAEAGEVPVAYCVRTPNSSLTEEDVKTFIANQVAPFKRLR  503

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            +VTFINSVPKSASGKILRRELI+KVR+K+
Sbjct  504  RVTFINSVPKSASGKILRRELIDKVRSKI  532



>ref|XP_006591122.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X2 [Glycine 
max]
Length=558

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC + F    + QGYGMTETCG+V +EN R+G RH+GS G LVS VEAQIVSVD  + 
Sbjct  338  MEECGRRFPHVAICQGYGMTETCGIVSVENPRVGVRHTGSTGTLVSGVEAQIVSVDTQKP  397

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NP+AT+LTIDK+GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  398  LPPRQLGEIWVRGPNMMQGYHNNPEATRLTIDKKGWVHTGDLGYFDEDGQLYVVDRIKEL  457

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI +AVV+PYPD EAGEVP+AYVVRSPNSSLTEE+++KF
Sbjct  458  IKYKGFQVAPAELEGLLVSHPEILEAVVVPYPDDEAGEVPIAYVVRSPNSSLTEEEIQKF  517

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+VTFIN+VPK+ASGKILRREL  K R+K+
Sbjct  518  IAKQVAPFKKLRRVTFINNVPKTASGKILRRELTAKARSKI  558



>ref|XP_006591121.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X1 [Glycine 
max]
Length=567

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC + F    + QGYGMTETCG+V +EN R+G RH+GS G LVS VEAQIVSVD  + 
Sbjct  347  MEECGRRFPHVAICQGYGMTETCGIVSVENPRVGVRHTGSTGTLVSGVEAQIVSVDTQKP  406

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NP+AT+LTIDK+GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  407  LPPRQLGEIWVRGPNMMQGYHNNPEATRLTIDKKGWVHTGDLGYFDEDGQLYVVDRIKEL  466

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI +AVV+PYPD EAGEVP+AYVVRSPNSSLTEE+++KF
Sbjct  467  IKYKGFQVAPAELEGLLVSHPEILEAVVVPYPDDEAGEVPIAYVVRSPNSSLTEEEIQKF  526

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+VTFIN+VPK+ASGKILRREL  K R+K+
Sbjct  527  IAKQVAPFKKLRRVTFINNVPKTASGKILRRELTAKARSKI  567



>ref|XP_008384715.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Malus domestica]
Length=544

 Score =   365 bits (936),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK   Q  V QGYGMTETCG+V +ENT  G RH+GS G+LVS VE QIVSVD L+ 
Sbjct  324  MEECAKIIPQGVVAQGYGMTETCGIVSVENTLAGSRHTGSTGMLVSGVECQIVSVDTLKP  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM GY+ NPQAT  TIDK GWVHTGDLGY ++DG LYVVDRIKEL
Sbjct  384  QPPKQLGEIWVRGPNMMTGYFNNPQATNETIDKNGWVHTGDLGYIDEDGQLYVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PDAEAGEVP AY VR+PNSSLTEEDVK F
Sbjct  444  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVPAAYCVRTPNSSLTEEDVKSF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVA +KRLR+V+FINSVPKSASG ILRRELIEKVR+K+
Sbjct  504  IASQVASFKRLRRVSFINSVPKSASGXILRRELIEKVRSKI  544



>gb|KJB20366.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=518

 Score =   363 bits (932),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F QA V+QGYGMTETC ++ +EN   G RH+GSAGLL   +EAQIVS +  + 
Sbjct  297  MEECAKKFPQAVVMQGYGMTETCAIISMENLAFGVRHTGSAGLLAPGIEAQIVSTENPKP  356

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NP+ATK TID++GWVHTGDLGYFN++G LYVVDRIKEL
Sbjct  357  LPPKQLGEIWVRGPNMMQGYFNNPEATKQTIDEKGWVHTGDLGYFNENGYLYVVDRIKEL  416

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+Q+APAELEGLLVSHPEI DAV IPYPD EAGEVPVAYVVRSPNSSLTEEDV KF
Sbjct  417  IKYKGFQIAPAELEGLLVSHPEIVDAVTIPYPDDEAGEVPVAYVVRSPNSSLTEEDVLKF  476

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRA  198
            IA QVAP+KRLRKVTF++SVPKS SGKILRRELI K+ A
Sbjct  477  IAKQVAPFKRLRKVTFVSSVPKSVSGKILRRELIAKITA  515



>gb|AGO89328.1| Ca4CL11 [Salix arbutifolia]
Length=543

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     + QGYGMTET G V +E++R+G RHSGSAG+L + +EAQIVSV+ L+ 
Sbjct  323  MKECAKNLPGTIITQGYGMTETSGFVSMEDSRLGTRHSGSAGMLAAGIEAQIVSVETLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWVRG NMM+GY  NPQATK TID++GWVHTGD+GYF++DG L+VVDRIKEL
Sbjct  383  LPPTQSGEIWVRGLNMMRGYLNNPQATKDTIDEKGWVHTGDIGYFDEDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVPVAYVVRSPNS+LTE DVKKF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVPVAYVVRSPNSALTEVDVKKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTF+NSVPKSASGKILRR LIE+V++K+
Sbjct  503  IAEQVAPFKRLRKVTFVNSVPKSASGKILRRVLIEQVKSKI  543



>ref|XP_010455853.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 196/221 (89%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC +N     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   VEAQIVSV+  + 
Sbjct  323  MEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETAKL  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM+GY  NPQATK TIDK+GWVHTGDLGYFN++G LYVVDRIKEL
Sbjct  383  QPPNQLGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHTGDLGYFNEEGNLYVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PD EAGEVP+A+VVRSPNSS+TE+D++KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FINSVPKSA+GKILRREL+++VR+K+
Sbjct  503  IAKQVAPYKRLRRVSFINSVPKSAAGKILRRELVQQVRSKM  543



>ref|XP_007132314.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04308.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=548

 Score =   359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC + F    + QGYGMTETCG+V +EN R G RH+GS G+L S VEAQIV+VD  + 
Sbjct  328  MQECGRRFPHVAICQGYGMTETCGIVSVENPRAGIRHTGSTGMLASGVEAQIVTVDTQKP  387

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWVRGPNMM+GY+ NPQAT+LTID++GWVHTGD+GYF++DG LYVVDRIKEL
Sbjct  388  LPPTQSGEIWVRGPNMMKGYHNNPQATRLTIDEKGWVHTGDIGYFDEDGQLYVVDRIKEL  447

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLL+SHPEI DAVV+PYPD EAGEVP+AYVVRSPNSSLTEE++KKF
Sbjct  448  IKYKGFQVAPAELEGLLISHPEILDAVVVPYPDDEAGEVPIAYVVRSPNSSLTEEEIKKF  507

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+VTFI+SVP+++SGKILRRE+  K R+K+
Sbjct  508  IANQVAPFKKLRRVTFISSVPRTSSGKILRREITAKARSKI  548



>gb|AGW47873.1| 4-coumarate:coenzyme A ligase 8 [Phaseolus vulgaris]
Length=548

 Score =   359 bits (921),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC + F    + QGYGMTETCG+V +EN R G RH+GS G+L S VEAQIV+VD  + 
Sbjct  328  MQECGRRFPHVAICQGYGMTETCGIVSVENPRAGIRHTGSTGMLASGVEAQIVTVDTQKP  387

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWVRGPNMM+GY+ NPQAT+LTID++GWVHTGD+GYF++DG LYVVDRIKEL
Sbjct  388  LPPTQSGEIWVRGPNMMKGYHNNPQATRLTIDEKGWVHTGDIGYFDEDGQLYVVDRIKEL  447

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLL+SHPEI DAVV+PYPD EAGEVP+AYVVRSPNSSLTEE++KKF
Sbjct  448  IKYKGFQVAPAELEGLLISHPEILDAVVVPYPDDEAGEVPIAYVVRSPNSSLTEEEIKKF  507

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+VTFI+SVP+++SGKILRRE+  K R+K+
Sbjct  508  IANQVAPFKKLRRVTFISSVPRTSSGKILRREITAKARSKI  548



>ref|XP_008463063.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis melo]
Length=543

 Score =   358 bits (919),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA N   A VIQGYGMTETCGVV +EN  +G R+SGSAG L S VEA+IVSVD L+ 
Sbjct  323  MEECANNIPSAVVIQGYGMTETCGVVALENPAVGKRNSGSAGTLASGVEAKIVSVDTLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEI VRGPNMM GY+ NP+ATK TIDK GWVHTGDLGYF+++G LYVVDRIKEL
Sbjct  383  LPPNQYGEIHVRGPNMMLGYFNNPEATKQTIDKYGWVHTGDLGYFDENGQLYVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LLVSHPEI DAVVIPYPD EAGEVP+AY+VRS NSSLTEED+ KF
Sbjct  443  IKYKGFQVAPAELEALLVSHPEILDAVVIPYPDEEAGEVPIAYIVRSANSSLTEEDILKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QV+PYKRLR+VTFI++VPKS SGKILRRELIEKVRAK+
Sbjct  503  IADQVSPYKRLRRVTFISNVPKSVSGKILRRELIEKVRAKI  543



>gb|AGO89327.1| Ca4CL10 [Salix arbutifolia]
Length=548

 Score =   358 bits (920),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 193/226 (85%), Gaps = 5/226 (2%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     + QGYGMTET G+V +E+ RI  RHSGSAG+L + +EAQIVSV+    
Sbjct  323  MKECAKNLPDTIITQGYGMTETSGIVSVEDPRICSRHSGSAGILSAGIEAQIVSVETAVP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQAT-----KLTIDKQGWVHTGDLGYFNKDGMLYVVD  510
            LPP QLGEIWVRGPNMM+GY  NPQAT     K TIDK+GWVHTGDLGYF+ DG L+VVD
Sbjct  383  LPPNQLGEIWVRGPNMMRGYLNNPQATNPQATKDTIDKKGWVHTGDLGYFDDDGQLFVVD  442

Query  509  RIKELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEE  330
            RIKELIKYKG+QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVPVAYVVRSPNS+L  E
Sbjct  443  RIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVPVAYVVRSPNSTLAGE  502

Query  329  DVKKFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            DV+KFIA QVAP+KRLRKVTFINSVPKSASGKILRREL++KV++K+
Sbjct  503  DVQKFIADQVAPFKRLRKVTFINSVPKSASGKILRRELVQKVKSKM  548



>ref|XP_010422413.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   358 bits (919),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC +N     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   VEAQIVSV+  + 
Sbjct  323  MEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETAKL  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM+GY  NPQATK TIDK+GWVHTGDLGYFN++G LYVVDRIKEL
Sbjct  383  QPPNQLGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHTGDLGYFNEEGNLYVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PD EAGEVP+A+VVRSPNSS+TE+D++KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FINSVPKSA+GKILRREL+++VR+ +
Sbjct  503  IAKQVAPYKRLRRVSFINSVPKSAAGKILRRELVQQVRSNM  543



>ref|XP_006488029.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=546

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +C KN   AT+ QGYGMTETC  + +EN  +G R SGSAG LV+ VEAQIVSVD L+ 
Sbjct  326  MEDCQKNIPGATIFQGYGMTETCAPISLENPLVGVRRSGSAGTLVAGVEAQIVSVDTLKP  385

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPN+  GY+KN QATK TID++GW+HTGDLGYF+ DG LYVVDRIKEL
Sbjct  386  LPPNQLGEIWVRGPNVTPGYFKNEQATKQTIDERGWLHTGDLGYFDGDGQLYVVDRIKEL  445

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PD E+GEVP+AYVVRSPNSSLT EDV+KF
Sbjct  446  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDPESGEVPIAYVVRSPNSSLTAEDVQKF  505

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QV+PYKRLRKVTFINSVPKSASGKILRRELI KVR+K+
Sbjct  506  VAEQVSPYKRLRKVTFINSVPKSASGKILRRELIAKVRSKI  546



>ref|XP_004147290.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis sativus]
 gb|KGN64806.1| hypothetical protein Csa_1G108800 [Cucumis sativus]
Length=543

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA N   A VIQGYGMTETCGVV +EN  +G R+SGSAG L S VEA+IVSVD L+ 
Sbjct  323  MEECANNIPSAVVIQGYGMTETCGVVALENPAVGKRNSGSAGTLASGVEAKIVSVDTLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEI VRGPNMM GY+ NP+ATK TIDK GWVHTGDLGYF+++G LYVVDRIKEL
Sbjct  383  LPPNQYGEIHVRGPNMMLGYFNNPEATKQTIDKHGWVHTGDLGYFDENGQLYVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LLVSHPEI DAVVIP PD EAGEVP+AYVVRS NSSLTEED+ KF
Sbjct  443  IKYKGFQVAPAELEALLVSHPEILDAVVIPCPDEEAGEVPIAYVVRSANSSLTEEDILKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QV+PYKRLR+VTFI+SVPKS SGKILRRELIEKVRAK+
Sbjct  503  IADQVSPYKRLRRVTFISSVPKSVSGKILRRELIEKVRAKI  543



>ref|XP_002872738.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48997.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
Length=544

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC +N     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   VEAQIVSV+    
Sbjct  324  MEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGNS  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY  NPQATK TIDK+GWVHTGDLGYFN+DG LYVVDR+KEL
Sbjct  384  QPPNQQGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHTGDLGYFNEDGNLYVVDRLKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PD EAGEVP+A+VVRSPNSS+TE+D++KF
Sbjct  444  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FIN+VPKSA+GKILRREL+++VR+K+
Sbjct  504  IAKQVAPYKRLRRVSFINTVPKSAAGKILRRELVQQVRSKM  544



>ref|XP_006396625.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
 dbj|BAJ33700.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38078.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
Length=543

 Score =   356 bits (914),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC +N     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   VEAQIVSV+  + 
Sbjct  323  MEECGRNISNVVLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVESGKS  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM+GY  NPQATK TID++GWVHTGDLGYFN+DG L+VVDRIKEL
Sbjct  383  QPPNQLGEIWVRGPNMMKGYLNNPQATKETIDRKGWVHTGDLGYFNEDGNLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP PD EAGEVP+A+VVRSPNSS+TEED++ F
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAGEVPIAFVVRSPNSSITEEDIQAF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI+SVPKSA+GKILRREL+++VR+K+
Sbjct  503  IAKQVAPYKRLRRVSFISSVPKSAAGKILRRELVQQVRSKI  543



>gb|KEH29989.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=542

 Score =   356 bits (913),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA++     + QGYGMTETC VV IEN R+G RHSGSAG+LVS VEAQIVSVD  + 
Sbjct  322  MEECARHLPHVAIYQGYGMTETCAVVSIENPRVGIRHSGSAGMLVSGVEAQIVSVDTQKP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGE+ VRGPNMM+GYY N +ATK T+D +GWVHTGDLGYF++ G LYVVDRIKEL
Sbjct  382  LPPKQLGELCVRGPNMMEGYYNNREATKQTLDNEGWVHTGDLGYFDEIGRLYVVDRIKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKGYQVAPAELE LLVSHPEIQDAVV+P+PD EAGEVP+AYVVR PNSSL+EE++KKF
Sbjct  442  IKYKGYQVAPAELEDLLVSHPEIQDAVVVPFPDDEAGEVPIAYVVRLPNSSLSEEEIKKF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPK+ASGKILRRELI K R+ +
Sbjct  502  IANQVAPFKRLRRVTFINSVPKTASGKILRRELIAKARSNI  542



>emb|CDY46375.1| BnaA09g19890D [Brassica napus]
Length=542

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC KN     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   +EAQIVSV+  + 
Sbjct  322  MEECGKNIHNVVLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGIEAQIVSVESGKP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY+ NPQATK TID++GWVHTGDLGYFN+DG L+VVDR+KEL
Sbjct  382  QPPNQQGEIWVRGPNMMKGYFNNPQATKETIDRKGWVHTGDLGYFNEDGNLFVVDRLKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP PD EAGEVP+A+VVRSPNSS+TEED++KF
Sbjct  442  IKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAGEVPIAFVVRSPNSSITEEDIQKF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI++VPKSA+GKILRREL+++VR+K+
Sbjct  502  IAKQVAPYKRLRRVSFISTVPKSAAGKILRRELVQQVRSKM  542



>emb|CDY39155.1| BnaC09g21890D [Brassica napus]
Length=542

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC KN     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   +EAQIVSV+  + 
Sbjct  322  MEECGKNIPSVVLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGIEAQIVSVESGKP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY+ NPQATK TID++GWVHTGDLGYFN+DG L+VVDR+KEL
Sbjct  382  QPPNQQGEIWVRGPNMMKGYFNNPQATKETIDRKGWVHTGDLGYFNEDGNLFVVDRLKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP PD EAGEVP+A+VVRSPNSS+TEED++KF
Sbjct  442  IKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAGEVPIAFVVRSPNSSITEEDIQKF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI++VPKSA+GKILRREL+++VR+K+
Sbjct  502  IAKQVAPYKRLRRVSFISTVPKSAAGKILRRELVQQVRSKM  542



>ref|XP_006396627.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
 gb|ESQ38080.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
Length=543

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 195/222 (88%), Gaps = 1/222 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRI-GPRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M ECA+N     ++QGY MTETCGVV +EN  I G R+SGSAG+L   VEA+IVS+D   
Sbjct  322  MEECARNIPNVVLMQGYAMTETCGVVSVENPSILGKRNSGSAGMLAPCVEARIVSIDSGN  381

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             +PP QLGEIWVRGPNMM+GY+ NP+ATK TID+QGWVHTGDLGYFN+DG L+VVDRIKE
Sbjct  382  FMPPNQLGEIWVRGPNMMKGYHNNPKATKETIDEQGWVHTGDLGYFNEDGNLFVVDRIKE  441

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+QVAPAELEGLL+SHPE+ DAVVIP PD EAGEVP+A+VVRSPNSS+TEED++K
Sbjct  442  LIKYKGFQVAPAELEGLLLSHPELLDAVVIPLPDEEAGEVPIAFVVRSPNSSITEEDIQK  501

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            FIA QVAPYKRLR+V+FI+SVPKSASGKILRREL+++VR+K+
Sbjct  502  FIAKQVAPYKRLRRVSFISSVPKSASGKILRRELVQQVRSKM  543



>ref|XP_010431672.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=542

 Score =   353 bits (907),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 194/221 (88%), Gaps = 1/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +C +N       QGYGMTETCG+V +E+ R+G R+SGSAG+L   VEAQIVSV+  + 
Sbjct  323  MEDCGRNIPNVW-FQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETAKL  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM+GY  NPQATK TIDK+GWVHTGDLGYFN+DG LYVVDRIKEL
Sbjct  382  QPPNQLGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHTGDLGYFNEDGNLYVVDRIKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PD EAGEVP+A+VVRSPNSS+TE+D++KF
Sbjct  442  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FIN+VPKSA+GKILRREL+++VR+K+
Sbjct  502  IAKQVAPYKRLRRVSFINTVPKSAAGKILRRELVQQVRSKM  542



>gb|ADG46006.1| 4-coumarate coenzyme A ligase [Isatis tinctoria]
Length=543

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC KN     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   VEAQIVSV+  + 
Sbjct  323  MEECGKNIPNIVLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKS  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRG NMM+GY+ NPQATK TIDK+GWVHTGDLGYFN+DG L+VVDRIKEL
Sbjct  383  QPPNQQGEIWVRGANMMKGYFNNPQATKETIDKKGWVHTGDLGYFNEDGNLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP+PD EAGEVP+A+VVRSP SS+T+ED++KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDEEAGEVPIAFVVRSPKSSITQEDIQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI+SVPKSA+GKILRREL+++VR+K+
Sbjct  503  IAKQVAPYKRLRRVSFISSVPKSAAGKILRRELVQQVRSKM  543



>gb|AIA24410.1| 4-coumarate-CoA ligase [Sinopodophyllum hexandrum]
Length=533

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+      +IQGYG+TETCG+  +EN ++G RHSG+AG+L+   E++IVSVD +Q 
Sbjct  313  MKECARILPHVDIIQGYGLTETCGIASLENAKVGVRHSGAAGMLIPGTESKIVSVDTMQP  372

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGE+W+RGPN+MQGYY NPQATKL +DKQGW+ TGDLGYF++ G L++VDRIKEL
Sbjct  373  LPPNQLGEVWIRGPNVMQGYYNNPQATKLPLDKQGWLRTGDLGYFDEQGQLFIVDRIKEL  432

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK KG+QVAPAELEGLL+  PEI DAVVIP+PDAEAGEVP+AYVVRSPNSSL EEDV+ F
Sbjct  433  IKCKGFQVAPAELEGLLLPPPEILDAVVIPFPDAEAGEVPIAYVVRSPNSSLNEEDVQNF  492

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+K+LR+VTF+N+VPKSASGKILRRELIEKVR+KL
Sbjct  493  IAKQVAPFKKLRRVTFLNTVPKSASGKILRRELIEKVRSKL  533



>ref|XP_007203616.1| hypothetical protein PRUPE_ppa003871mg [Prunus persica]
 gb|EMJ04815.1| hypothetical protein PRUPE_ppa003871mg [Prunus persica]
Length=543

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN  QA V QGYG+TETCG+V +EN R G R SGS+G+L S +E+QIVS D L+ 
Sbjct  323  MEECAKNIPQAVVGQGYGLTETCGIVSLENFREGSRFSGSSGILASGIESQIVSTDTLKS  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEI VRGPNMMQGYY NP+ATKLT D+QGWVHTGDLGYF+++G L+VVDRIKEL
Sbjct  383  LPPNQLGEILVRGPNMMQGYYNNPEATKLTKDEQGWVHTGDLGYFDEEGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK   +QVAPAELEGLL+SHPEI DAVVIPYPD +AGEVPVAYVVR+PNSS+T++D++KF
Sbjct  443  IKCYSFQVAPAELEGLLLSHPEILDAVVIPYPDEKAGEVPVAYVVRAPNSSITQQDIQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            I  QVAP+KRLR+VTFIN VPKSA+GKILRRELI+KVR+K+
Sbjct  503  IEKQVAPFKRLRRVTFINCVPKSAAGKILRRELIQKVRSKI  543



>ref|XP_006287440.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
 gb|EOA20338.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
Length=544

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC +N     ++QGYGMTET G+V +E+ R+G R+SGSAG+L   VEAQIVSV+  + 
Sbjct  324  MEECGRNIPNVLLMQGYGMTETSGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKS  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM+GY  NPQATK TIDK+GWVHTGDLGYFN+DG LYVVDRIKEL
Sbjct  384  QPPNQLGEIWVRGPNMMKGYLNNPQATKETIDKKGWVHTGDLGYFNEDGNLYVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSH EI DAVVIP+PD EAGEVP+A+VVRSPNSS+TE+D++KF
Sbjct  444  IKYKGFQVAPAELEGLLVSHSEILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI SVPKSA+GKILRREL+++VR+K+
Sbjct  504  IAKQVAPYKRLRRVSFIKSVPKSAAGKILRRELVQQVRSKM  544



>ref|XP_009114499.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Brassica rapa]
Length=542

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC KN     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   +EAQIVSV+  + 
Sbjct  322  MEECGKNIPNVVLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGIEAQIVSVESGKP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY+ NPQATK TID++GWVHTGDLGYFN+DG L+VVDR+KEL
Sbjct  382  QPPNQQGEIWVRGPNMMKGYFNNPQATKETIDRKGWVHTGDLGYFNEDGNLFVVDRLKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIP PD EAGEVP+A+VVRSP+SS+TEED++KF
Sbjct  442  IKYKGFQVAPAELEGLLVSHPEILDAVVIPLPDEEAGEVPIAFVVRSPSSSITEEDIQKF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI++VPKSA+GKILRREL+++VR+K+
Sbjct  502  IAKQVAPYKRLRRVSFISTVPKSAAGKILRRELVQQVRSKM  542



>ref|XP_009335967.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri]
Length=545

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F Q  V QGYGMTE+CG + ++ T  G +H+GS G+LVS VE QIVSVD  + 
Sbjct  325  MEECAKKFPQGVVAQGYGMTESCGTISVDCTLAGTQHTGSTGMLVSGVECQIVSVDTQKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGP+MM GY+ NP+AT  TIDK GWVHTGD+GY +++G+LYVVDRIKEL
Sbjct  385  QPPKQLGEIWVRGPSMMAGYFNNPEATNETIDKNGWVHTGDIGYIDENGLLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI D+VVIP PDAEAGEVPVAY VR+PNSSLTEEDVK F
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEILDSVVIPLPDAEAGEVPVAYCVRTPNSSLTEEDVKSF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVA +KRLR+VTFI SVPKSASGKILRRELIEKVR+K+
Sbjct  505  IANQVASFKRLRRVTFIKSVPKSASGKILRRELIEKVRSKI  545



>ref|NP_192425.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
 sp|Q9M0X9.1|4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7; AltName: Full=4-coumarate--CoA 
ligase isoform 6; Short=At4CL6 [Arabidopsis 
thaliana]
 emb|CAB81058.1| 4-coumarate--CoA ligase-like protein [Arabidopsis thaliana]
 gb|AAM13899.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAM67483.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAP03022.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
 gb|AEE82486.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
Length=544

 Score =   350 bits (899),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 193/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC +N     ++QGYGMTETCG+V +E+ R+G R+SGSAG+L   VEAQIVSV+  + 
Sbjct  324  MEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKS  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY  NPQATK TIDK+ WVHTGDLGYFN+DG LYVVDRIKEL
Sbjct  384  QPPNQQGEIWVRGPNMMKGYLNNPQATKETIDKKSWVHTGDLGYFNEDGNLYVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHP+I DAVVIP+PD EAGEVP+A+VVRSPNSS+TE+D++KF
Sbjct  444  IKYKGFQVAPAELEGLLVSHPDILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI+ VPKSA+GKILRREL+++VR+K+
Sbjct  504  IAKQVAPYKRLRRVSFISLVPKSAAGKILRRELVQQVRSKM  544



>ref|XP_008241410.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Prunus mume]
Length=576

 Score =   352 bits (902),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN  QA V QGYG+TETCG+V +EN R G R SGS+G+L   +E+QIVS D L+ 
Sbjct  356  MEECAKNIPQAVVGQGYGLTETCGIVSLENFREGSRFSGSSGILAPGIESQIVSTDTLKS  415

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEI VRGPNMMQGYY NP+ATKLT D+QGWVHTGDLGYF+++G L+VVDRIKEL
Sbjct  416  LPPNQLGEILVRGPNMMQGYYNNPEATKLTKDEQGWVHTGDLGYFDEEGQLFVVDRIKEL  475

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK   +QVAPAELEGLL+SHPEI DAVVIPYPD +AGEVPVAYVVR+PNSS+T++D++KF
Sbjct  476  IKCYSFQVAPAELEGLLLSHPEILDAVVIPYPDEKAGEVPVAYVVRAPNSSITQQDIQKF  535

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            I  QVAP+KRLR+VTFINSVPKSA+GKILRRE I+KVR+K+
Sbjct  536  IDKQVAPFKRLRRVTFINSVPKSAAGKILRREFIQKVRSKI  576



>ref|XP_010538202.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Tarenaya hassleriana]
Length=546

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC KN     ++QGYGMTETCG++ +E+ R+G R++GSAG+LVS VEAQ+VSV+  + 
Sbjct  325  MDECGKNMPNVMLLQGYGMTETCGIISLEDPRLGKRNTGSAGMLVSGVEAQVVSVETQKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGPNMM+GY+ NP+ATK TIDK+GWVHTGDLGYF++DG LYVVDRIKEL
Sbjct  385  SPPKQLGEIWVRGPNMMRGYFNNPKATKETIDKKGWVHTGDLGYFDEDGNLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIPYPD EAGEVP+A+VVR+P SSLT+E+++ F
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDEEAGEVPIAFVVRAPGSSLTKEEIQNF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVR  201
            IA QVAP+KRLR+V+FI+SVPKSASGKILRREL+ +VR
Sbjct  505  IAKQVAPFKRLRRVSFISSVPKSASGKILRRELVHQVR  542



>gb|KFK32221.1| hypothetical protein AALP_AA6G213500 [Arabis alpina]
Length=542

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+N     + QGYGMTET G+V IE+TR G R+SGSAG+L   +EAQIVSV+  ++
Sbjct  322  MEECARNMPNLVLTQGYGMTETTGIVSIEDTRFGKRNSGSAGMLAPGIEAQIVSVETGKY  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGE+WVRGPNMM+GY  NP+ATK TID +GWVHTGDLGYFN+DG L+VVDRIKEL
Sbjct  382  QPPNQLGEVWVRGPNMMKGYLNNPKATKETIDSKGWVHTGDLGYFNEDGNLFVVDRIKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LLVSHPEI DA VIP+PD EAGEVP+A+VVRSPNSS+TE+D++ F
Sbjct  442  IKYKGFQVAPAELEDLLVSHPEILDAAVIPFPDEEAGEVPIAFVVRSPNSSITEKDIQDF  501

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QVAPYKRLR+V+FINSVPKSA+GKILRREL+++VR+K+
Sbjct  502  VAKQVAPYKRLRRVSFINSVPKSAAGKILRRELVQQVRSKM  542



>ref|XP_006424485.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina]
 ref|XP_006424486.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina]
 gb|ESR37725.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina]
 gb|ESR37726.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina]
Length=206

 Score =   337 bits (865),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -3

Query  809  GYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGPN  630
            GYGMTETC  + +EN  +G RHSGSAG L+  VEAQIVSVD L+ LPP QLGEIWVRGPN
Sbjct  1    GYGMTETCAPISLENPLVGVRHSGSAGTLLVGVEAQIVSVDTLKPLPPNQLGEIWVRGPN  60

Query  629  MMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELEG  450
            +  GY+KN QATK TID++GW+HTGDLGYF+ DG LYVVDRIKELIKYKG+QVAPAELEG
Sbjct  61   VTPGYFKNEQATKQTIDERGWLHTGDLGYFDGDGQLYVVDRIKELIKYKGFQVAPAELEG  120

Query  449  LLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKVT  270
            LLVSHPEI DAVVIP+PD E+GEVP+AYVVRSPNS LT EDV+KF+A QV+PYKRLRKVT
Sbjct  121  LLVSHPEILDAVVIPFPDPESGEVPIAYVVRSPNSLLTAEDVQKFVAEQVSPYKRLRKVT  180

Query  269  FINSVPKSASGKILRRELIEKVRAKL  192
            FINSVPKSASGKILRRELI KVR+K+
Sbjct  181  FINSVPKSASGKILRRELIAKVRSKI  206



>ref|XP_010689117.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=540

 Score =   348 bits (893),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC+K   QA +IQGYGMTET GV+ +E+ R+G RHSGS G+L + VE+QI+ VD L+ 
Sbjct  320  MKECSKVVPQARIIQGYGMTETSGVISLEHPRLGGRHSGSTGMLAAGVESQIIKVDTLKP  379

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ N QATK TID QGWVHTGDLGYF+++G LYVVDR+KEL
Sbjct  380  LPPKQLGEIWVRGPNMMKGYFNNQQATKSTIDNQGWVHTGDLGYFDEEGQLYVVDRLKEL  439

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE +L+SHPEI DA VIP+PD EAGEVPVAYVV SP SS+ EEDVKKF
Sbjct  440  IKYKGFQVAPAELEAVLISHPEILDAAVIPFPDDEAGEVPVAYVVSSPKSSVKEEDVKKF  499

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QVAP+KRLRKV FIN++PKSA+GK+LRRELIEK R+KL
Sbjct  500  VADQVAPFKRLRKVIFINAIPKSAAGKLLRRELIEKSRSKL  540



>ref|XP_008359628.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Malus domestica]
Length=545

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC K F Q  V QGYGMTE+CG++ ++ T  G RH+GS G+LVS +E QIVS+D  + 
Sbjct  325  MEECXKKFPQGVVAQGYGMTESCGIISVDYTXAGTRHTGSTGMLVSGIECQIVSIDTXKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP QLGEIWVRGP+MM GY+ NP+AT  TID+ GW+HTGDLGY ++ G+LYVVDRIKEL
Sbjct  385  QPPKQLGEIWVRGPSMMAGYFNNPEATNETIDRNGWLHTGDLGYIDEKGLLYVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI D+VVIP PDAEAGEVPVAY VR+PNSSLTEEDVK F
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEILDSVVIPLPDAEAGEVPVAYCVRTPNSSLTEEDVKSF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
             A QVA +KRLR+VTFI SVPKSASGKILRRELIEKVR+K+
Sbjct  505  XANQVASFKRLRRVTFIKSVPKSASGKILRRELIEKVRSKI  545



>ref|XP_002519487.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF42901.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=543

 Score =   348 bits (892),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     ++QGYGMTETCG++ IE+ + G R SGS GLLV  VE+QI+SVD  + 
Sbjct  323  MEECAKNLPHVEIVQGYGMTETCGIISIEDRKEGIRLSGSTGLLVPGVESQIISVDTAKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEI +RG NMM+GY+ NPQAT LTID+Q WVHTGDLGYFN +G L+VVDRIKEL
Sbjct  383  LPPNQLGEICLRGANMMEGYFNNPQATNLTIDEQAWVHTGDLGYFNAEGHLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  G+QVAPAELEGLL+ HPEI DAVVIP+PD +AGEVP+AYVVRSPNSSLTEEDV+KF
Sbjct  443  IKCYGFQVAPAELEGLLLLHPEILDAVVIPFPDPKAGEVPIAYVVRSPNSSLTEEDVQKF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLR+VTFINSVPKSASGKILRRELIEKV +K+
Sbjct  503  IAEQVAPFKRLRRVTFINSVPKSASGKILRRELIEKVGSKI  543



>ref|XP_010918637.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X1 [Elaeis 
guineensis]
Length=544

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENT-RIGPRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M + +KNF  A VIQGYGMTETCG++ +EN  +   R  GS G+L S VE ++VS++ L+
Sbjct  323  MADVSKNFPDADVIQGYGMTETCGIISLENPPKAEARWFGSTGILASGVEGKVVSINTLK  382

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGE+  RGPN+MQGY  NPQATKLT+D+QGW+HTGDLGYF++ G LYVVDRIKE
Sbjct  383  SLPPNQLGELCFRGPNIMQGYLNNPQATKLTLDEQGWLHTGDLGYFDEKGQLYVVDRIKE  442

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+QVAPAELEGLL+SH EI DAVVIP+PDAEAGEVP+A+VVRSPNSSLTEE+V+K
Sbjct  443  LIKYKGFQVAPAELEGLLLSHSEILDAVVIPFPDAEAGEVPIAFVVRSPNSSLTEENVQK  502

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            FIA QVAP+KRLR+VTF+NSVPKSASGKILRRELIEKVR+KL
Sbjct  503  FIAEQVAPFKRLRRVTFVNSVPKSASGKILRRELIEKVRSKL  544



>gb|EPS70306.1| hypothetical protein M569_04447, partial [Genlisea aurea]
Length=540

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F QA + QGYGMTETCG++ IE+  +GPR+SGS+G+L   VE++IVSV+  + 
Sbjct  324  MIECAKKFPQAAICQGYGMTETCGIISIESPHMGPRNSGSSGMLAPGVESRIVSVENSKA  383

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPG++GEIWVRG NMM+GY  NP+A+KLTIDKQGWVHTGDLGYF+++G+++VVDRIKEL
Sbjct  384  LPPGEVGEIWVRGQNMMRGYLNNPEASKLTIDKQGWVHTGDLGYFDEEGLVHVVDRIKEL  443

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLL+SH EI DA V+PYPD EAG+VPVA+VVR P SSL+EEDVKKF
Sbjct  444  IKYKGFQVAPAELEGLLISHDEILDAAVVPYPDEEAGQVPVAFVVRLPTSSLSEEDVKKF  503

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKV  204
            +A QVAP+KRLR+V+F+ +VPKSASGKILRRELIEKV
Sbjct  504  VADQVAPFKRLRRVSFVTAVPKSASGKILRRELIEKV  540



>ref|XP_010529378.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
7 [Tarenaya hassleriana]
Length=546

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC KNF    ++QGYGMTETCG++ +E+ R+G R++GS G+LVS VEAQIVS++  + 
Sbjct  325  MDECGKNFPNVMLLQGYGMTETCGIISMEDPRLGKRNTGSVGMLVSGVEAQIVSLETQKP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWV GPNMM+GY+ NPQATK TID++GWVHTGDLGYFN DG LY+VDRIKEL
Sbjct  385  LPPDQFGEIWVWGPNMMRGYFNNPQATKETIDEKGWVHTGDLGYFNDDGNLYIVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPE-IQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            IKYKG+QVAPAELEGLLVSHPE I DA V+P PD EAGEVP+A+VVR+PNSSLTEE+++ 
Sbjct  445  IKYKGFQVAPAELEGLLVSHPEIILDAAVVPCPDEEAGEVPIAFVVRAPNSSLTEEEIQN  504

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            FIA QVAP+KRL++V+FI+SVPK+ASGKILRRELI++VR+ +
Sbjct  505  FIAKQVAPFKRLQRVSFISSVPKTASGKILRRELIKQVRSNM  546



>ref|XP_004304462.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Fragaria vesca subsp. 
vesca]
Length=527

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 188/223 (84%), Gaps = 2/223 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDK--L  681
            M + AKN  QA ++QGYGMTE CG+V +EN R G   SGS G+L   +E++I+S+D   L
Sbjct  305  MEDTAKNIPQAAIVQGYGMTEACGIVSLENPREGSPFSGSTGILAPGIESRIISLDTSTL  364

Query  680  QHLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIK  501
            + LPP +LGEIWVRGPNMMQGYY NP+ATKLTIDKQGWVHTGDLGYF+++G LYVVDR+K
Sbjct  365  KALPPNELGEIWVRGPNMMQGYYNNPEATKLTIDKQGWVHTGDLGYFDEEGRLYVVDRLK  424

Query  500  ELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVK  321
            ELIK  GYQVAPAELEGLL+SHPEI DAVVIP+PDA+AGEVP+AYVVR PNS LTE+D+ 
Sbjct  425  ELIKSYGYQVAPAELEGLLLSHPEILDAVVIPFPDAKAGEVPIAYVVRVPNSLLTEQDIL  484

Query  320  KFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            KF+   VAP+KRLR +TF+ SVPKSASGKILRRELI+KVR+ +
Sbjct  485  KFVEKLVAPFKRLRSITFVTSVPKSASGKILRRELIQKVRSNM  527



>ref|XP_006488030.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=546

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            EC+KN    TV QGYGMTETCGVV +EN  +G ++SGSAG LV+ VEAQIV VD L+ LP
Sbjct  328  ECSKNLPTVTVFQGYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLP  387

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            P Q+GE+WVRGP +M GY+ N QATKL IDK+GW+HTGDLGYF++ G L++VDRIKELIK
Sbjct  388  PNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIK  447

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
              G+QVAPAELEG+LVSHPEI DAVVIP+PD EAGEVP+AYVVRSPNSSLT+EDV+KF+ 
Sbjct  448  CNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVV  507

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
             QVA YKRLR VTF NS+PK+ SGKILRRELI K+R+K+
Sbjct  508  KQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLRSKI  546



>ref|XP_010037648.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
 gb|KCW49390.1| hypothetical protein EUGRSUZ_K02929 [Eucalyptus grandis]
Length=549

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     +IQGYGMTET G+V +EN R  P+ SGS G LVS VE++IV VD    
Sbjct  329  MEECAKNIPHVDIIQGYGMTETSGIVSLENPREEPKLSGSTGTLVSGVESKIVCVDTSMP  388

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIW+RGPNMM+GY  N +ATKLTID +GWVHTGDLGYFN++G L+VVDR+K+L
Sbjct  389  LPPNQLGEIWLRGPNMMKGYLNNLEATKLTIDDKGWVHTGDLGYFNREGQLFVVDRLKDL  448

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  GYQVAPAELEGLL+SHPEI DAVVIP+PDA+AGEVP+AYVVRSPNSSLTE  V++F
Sbjct  449  IKCYGYQVAPAELEGLLLSHPEILDAVVIPFPDAKAGEVPIAYVVRSPNSSLTEVSVQEF  508

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTFINSVPK+ +GKILRREL EK R+ +
Sbjct  509  IANQVAPFKRLRKVTFINSVPKTPAGKILRRELKEKARSNI  549



>ref|XP_006843037.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda]
 ref|XP_011622865.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda]
 ref|XP_011622866.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda]
 gb|ERN04712.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda]
Length=543

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            + +CA+N   A V+QGYGMTE+CG++ +E    G  H GS G LV  VEA+IV+VD L+ 
Sbjct  323  LEDCARNIPLAEVVQGYGMTESCGIISLEMRMKGKHHFGSTGFLVPGVEAKIVNVDTLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIW+RGP++MQGY+ NPQATK TI K+GW+ TGDLGYF+ +G L+VVDRIKEL
Sbjct  383  LPPNQLGEIWIRGPHIMQGYFNNPQATKSTIVKEGWLLTGDLGYFDDEGRLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYK +Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRS  SS+TE+DV++F
Sbjct  443  IKYKAFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSQGSSITEKDVQEF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QVA +KRLR+VTF+NSVPKSASGKILRRELIEKVR+K+
Sbjct  503  VAKQVASFKRLRRVTFVNSVPKSASGKILRRELIEKVRSKM  543



>ref|XP_008808867.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Phoenix dactylifera]
Length=544

 Score =   333 bits (854),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 186/222 (84%), Gaps = 1/222 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIE-NTRIGPRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M E +KNF    VIQGYGMTETCG++  E   +   R  GS G+LV  VE ++VSVD L+
Sbjct  323  MTEVSKNFPDREVIQGYGMTETCGIISREFPLKAEARQFGSTGMLVPGVEGKVVSVDTLK  382

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGE+  RGPN+MQGY  NPQATKLT+D+QGW+HTGD+GY ++ G +YVVDRIKE
Sbjct  383  SLPPNQLGELCFRGPNIMQGYLNNPQATKLTLDEQGWLHTGDIGYIDEKGQVYVVDRIKE  442

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG QVAPAELEGLL+SH EI DA VIP+PDAEAGEVP+A+VVRSPNSSLTEEDV+K
Sbjct  443  LIKYKGLQVAPAELEGLLLSHSEILDAAVIPFPDAEAGEVPIAFVVRSPNSSLTEEDVQK  502

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            FIA QVAP+KRLR+VTF+NSVPKSASGKILRR LIEKVR+KL
Sbjct  503  FIAEQVAPFKRLRRVTFVNSVPKSASGKILRRVLIEKVRSKL  544



>emb|CDY46376.1| BnaA09g19900D [Brassica napus]
Length=539

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+N     ++QGY MTETCG+V +E+ R G R+SGSAG L S +EAQ+VSV+  + 
Sbjct  319  MEECARNIPNVVLMQGYAMTETCGIVSMEDPRRGKRNSGSAGTLASGIEAQVVSVESGKP  378

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY  NP+ATK TID+ GWVHTGDLGYFN+DG L++V+R+KEL
Sbjct  379  QPPNQQGEIWVRGPNMMKGYLNNPEATKETIDENGWVHTGDLGYFNEDGNLFIVERLKEL  438

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  G+QVAPAELEGLLVSHPE+ DA+VIP+PD  AGEVP+A+VVRSPN+S+TEED++KF
Sbjct  439  IKCNGFQVAPAELEGLLVSHPELLDAIVIPFPDVYAGEVPIAFVVRSPNTSITEEDIQKF  498

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+F++SVPKS +GK+LRREL E+VR+K+
Sbjct  499  IAKQVAPYKRLRRVSFVSSVPKSLAGKLLRRELREQVRSKM  539



>ref|XP_010037647.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
 gb|KCW49389.1| hypothetical protein EUGRSUZ_K02927 [Eucalyptus grandis]
Length=548

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     ++QGYGMTE CG++ +EN R  P+ SGS G LVS VE++IV V+ L  
Sbjct  328  MEECAKNIPHVDIVQGYGMTEACGIISMENPREEPKLSGSTGTLVSGVESKIVCVETLMP  387

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIW+RGPNMM+GY  N +ATKLTID +GWVHTGDLGYFN++G L+VVDR+K+L
Sbjct  388  LPPNQLGEIWLRGPNMMKGYLNNLEATKLTIDDKGWVHTGDLGYFNREGQLFVVDRLKDL  447

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  GYQVAPAELEGLL+SHPEI DAVVIP+ DA+AGEVP+AYVVRSPNSSLTE  V+KF
Sbjct  448  IKCYGYQVAPAELEGLLLSHPEILDAVVIPFHDAKAGEVPIAYVVRSPNSSLTEVSVQKF  507

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAP+KRLRKVTFINSVPK+ +GKILRR+L EK R+ +
Sbjct  508  IANQVAPFKRLRKVTFINSVPKTPAGKILRRKLKEKARSNI  548



>gb|KCW87478.1| hypothetical protein EUGRSUZ_B03942 [Eucalyptus grandis]
Length=626

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +CAKNF QA V+QGYGMTETCG+V +EN   GPRH+GSAG LV+ VEAQ++SVD L+ 
Sbjct  416  MEDCAKNFPQADVMQGYGMTETCGIVSVENANFGPRHTGSAGQLVAGVEAQVISVDTLKS  475

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GYY NPQATKLTID +GWVHTGDLGYF+++G LYVVDRIKEL
Sbjct  476  LPPNQLGEIWVRGPNMMKGYYNNPQATKLTIDNKGWVHTGDLGYFDEEGQLYVVDRIKEL  535

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRSP SSLTEE+V+KF
Sbjct  536  IKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSPTSSLTEEEVQKF  595

Query  314  IAGQVAPYKRLRKVTFINSVPK  249
            IA QVAP+KRL+        PK
Sbjct  596  IANQVAPFKRLKAGDIRQQRPK  617



>ref|XP_010101621.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
 gb|EXB89002.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
Length=547

 Score =   330 bits (847),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M  CAKN   A V+QGYGMTE+CG++  EN+  G R SGS G+L   +EAQI+SV+ ++ 
Sbjct  327  MEGCAKNVPNALVMQGYGMTESCGIISTENSWEGTRFSGSTGILAPGIEAQIISVETMKP  386

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEI  RGPNMMQGYY +PQATK  IDKQGWVHTGDLGYF+++G L+VVDRIK+L
Sbjct  387  LPPNQLGEICFRGPNMMQGYYNSPQATKSAIDKQGWVHTGDLGYFDEEGQLFVVDRIKDL  446

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  GYQVAPAELEGLL+SHPEI +AVVIP+PD +AGEVP+A++VRSPNSSLTE+ V++F
Sbjct  447  IKCYGYQVAPAELEGLLLSHPEILEAVVIPFPDEKAGEVPIAFIVRSPNSSLTEQGVQRF  506

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +  QVAP+KRLR+VTF++SVPKSASGK LRREL++KVR+ +
Sbjct  507  VEKQVAPFKRLRRVTFVSSVPKSASGKTLRRELVQKVRSNI  547



>gb|KDO37039.1| hypothetical protein CISIN_1g043808mg, partial [Citrus sinensis]
Length=206

 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -3

Query  809  GYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGPN  630
            GYGMTETCGVV +EN  +G ++SGSAG LV+ VEAQIV VD L+ LPP Q+GE+WVRGP 
Sbjct  1    GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPI  60

Query  629  MMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELEG  450
            +M GY+ N QATKL IDK+GW+HTGDLGYF++ G L++VDRIKELIK  G+QVAPAELEG
Sbjct  61   LMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEG  120

Query  449  LLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKVT  270
            +LVSHPEI DAVVIP+PD EAGEVP+AYVVRSPNSSLT+EDV+KF+  QVA YKRLR VT
Sbjct  121  VLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVT  180

Query  269  FINSVPKSASGKILRRELIEKVRAKL  192
            F NS+PK+ SGKILRRELI K+R+K+
Sbjct  181  FTNSIPKTTSGKILRRELIAKLRSKI  206



>ref|XP_011651966.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis sativus]
 gb|KGN58984.1| hypothetical protein Csa_3G740270 [Cucumis sativus]
Length=545

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC+K   QA +IQGYGMTETCGV+ +EN  +    SG+ G LVS VEAQI+S++  + 
Sbjct  325  MDECSKIIPQARIIQGYGMTETCGVISVENVGVESTQSGATGSLVSGVEAQILSIETQKR  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPG+ GEI VRGPNMM+GY+ N +AT  TID QGWVHTGD+GYFN++G L+VVDRIKEL
Sbjct  385  LPPGETGEICVRGPNMMKGYFNNQKATSQTIDDQGWVHTGDIGYFNEEGELFVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  G+QVAPAELE LL+SHP+I DA+VIP+PD +AGEVP+A+VVRSPNSS++EEDVK F
Sbjct  445  IKCYGFQVAPAELEALLLSHPQITDAIVIPHPDDKAGEVPIAFVVRSPNSSISEEDVKIF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +AGQVAP+KRLRKVTF +SVPKSASGK+LRRE+I +VRAK+
Sbjct  505  VAGQVAPFKRLRKVTFTSSVPKSASGKLLRREVIAQVRAKM  545



>ref|XP_008442710.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis melo]
Length=545

 Score =   328 bits (840),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC+K   QA +IQGYGMTETCGV+ +EN  +    SG+ G L S +EAQI+S++  + 
Sbjct  325  MEECSKIIPQARIIQGYGMTETCGVISVENMVVESTLSGATGSLGSGIEAQILSIETQKR  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPG+ GEI VRGPNMM+GY+ N +AT  TID QGWVHTGD+GYFN++G L+VVDRIKEL
Sbjct  385  LPPGETGEICVRGPNMMKGYFNNQKATSQTIDDQGWVHTGDIGYFNEEGELFVVDRIKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  G+QVAPAELE LL+SHP+I DA+VIP+PD +AGEVP+A+VVRSPNSS++EEDVKKF
Sbjct  445  IKCYGFQVAPAELEALLLSHPQITDAIVIPHPDDKAGEVPIAFVVRSPNSSISEEDVKKF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IAGQVAP+KRLRKVTF +SVPKSASGK+LRRE+I +VRAK+
Sbjct  505  IAGQVAPFKRLRKVTFTSSVPKSASGKLLRREVIAQVRAKM  545



>emb|CDY39153.1| BnaC09g21910D [Brassica napus]
Length=539

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+N     ++QGY MTETCG+V +E+ R G R+SGSAG+L S +EAQ+VSV+  + 
Sbjct  319  MEECARNIPNVVLMQGYAMTETCGIVSMEDPRRGKRNSGSAGMLASGIEAQVVSVESGKP  378

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY  NP+A K TID+ GWVHTGDLGY N+DG L++V+R+KEL
Sbjct  379  QPPNQQGEIWVRGPNMMKGYLNNPEANKETIDENGWVHTGDLGYINEDGNLFIVERLKEL  438

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  G+QVAPAELEGLLVSHPE+ DA+VIP+PD  AGEVP+A+VVRSPN+++TEED++KF
Sbjct  439  IKCNGFQVAPAELEGLLVSHPELLDAIVIPFPDVYAGEVPIAFVVRSPNTTITEEDIQKF  498

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+F++SVPKS +GK+LRREL E+VR+K+
Sbjct  499  IAEQVAPYKRLRRVSFVSSVPKSLAGKLLRRELREQVRSKM  539



>ref|XP_009114500.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Brassica rapa]
Length=541

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 190/223 (85%), Gaps = 2/223 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA+N     ++QGY MTETCG+V +E+ R G R+SGSAG L S +EAQ+VSV+  + 
Sbjct  319  MEECARNIPNVVLMQGYAMTETCGIVSMEDPRRGKRNSGSAGTLASGIEAQVVSVESGKP  378

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
             PP Q GEIWVRGPNMM+GY  NP+ATK TID+ GWVHTGDLGYFN+DG L++V+R+KEL
Sbjct  379  QPPNQQGEIWVRGPNMMKGYLNNPEATKETIDENGWVHTGDLGYFNEDGNLFIVERLKEL  438

Query  494  IKYKGY--QVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVK  321
            IK  G+  +VAPAELEGLLVSHPE+ DA+VIP+PD  AGEVP+A+VVRSPN+++TEED++
Sbjct  439  IKCNGFRGEVAPAELEGLLVSHPELLDAIVIPFPDVYAGEVPIAFVVRSPNTTITEEDIQ  498

Query  320  KFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            KFIA QVAPYKRLR+V+F++SVPK+A+GK+LRREL+++VR+K+
Sbjct  499  KFIAKQVAPYKRLRRVSFVSSVPKTAAGKLLRRELVQQVRSKM  541



>ref|XP_007027423.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
 gb|EOY07925.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
Length=617

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -3

Query  845  CAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPP  666
            CAKN     + QGYGMTE CG + +EN + G R SGS G L+  +E++IVSV+ ++ LPP
Sbjct  400  CAKNLAHVEIFQGYGMTEACGKISLENPKEGRRFSGSTGTLMPVIESKIVSVNTMKPLPP  459

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
             Q+GEIW+RGP +MQGY+ NP+ATKL +D++GW+ TGDLGYF++ G L+VVDRIKELIK 
Sbjct  460  HQIGEIWIRGPTIMQGYFNNPKATKLAMDEKGWLRTGDLGYFDEQGQLFVVDRIKELIKC  519

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
             G+QVAPAELEGLL+SHPEI D VVIP+PD +AGEVP+AY+VR+PNSSL E+DVK FIA 
Sbjct  520  NGFQVAPAELEGLLLSHPEIVDVVVIPFPDVKAGEVPIAYIVRAPNSSLNEDDVKIFIAE  579

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +VAPYKRLR+VTF+NSVP+SASGKILRRELI+KVR+K+
Sbjct  580  KVAPYKRLRRVTFLNSVPRSASGKILRRELIQKVRSKI  617



>ref|XP_009413145.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP-RHSGSAGLLVSAVEAQIVSVDKLQ  678
            M + AK+   A V+QGYGMTETCG++ ++   IG  R  GSAG+L S VEA++V+VD ++
Sbjct  323  MEDVAKHLPHADVVQGYGMTETCGILSLDLPTIGEVREYGSAGILASEVEAKVVNVDTME  382

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGE+  RGPN+M  Y  NP+ATKLT+ ++GW+HTGDLGYFN+ G L++VDRIKE
Sbjct  383  SLPPNQLGELCFRGPNIMPEYLNNPEATKLTL-REGWLHTGDLGYFNEKGQLFIVDRIKE  441

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+QVAPAELEGLL+SHPEI DA VIP+PDAEAGEVP+AYVVRSP SSLT EDV+ 
Sbjct  442  LIKYKGFQVAPAELEGLLLSHPEILDAAVIPFPDAEAGEVPIAYVVRSPTSSLTGEDVQN  501

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            FIA QVAPYKRLR+VTF++SVPKSASGKILRRE+IEKVR+KL
Sbjct  502  FIAKQVAPYKRLRRVTFVSSVPKSASGKILRREMIEKVRSKL  543



>emb|CAN70560.1| hypothetical protein VITISV_031619 [Vitis vinifera]
Length=663

 Score =   327 bits (837),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/257 (65%), Positives = 190/257 (74%), Gaps = 36/257 (14%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC K+     V QGYGMTETCG+V  E  +IG +H+G  G L S VEAQI+SVD L+ 
Sbjct  407  MEECXKSLPHVAVGQGYGMTETCGIVSKEIPKIGIQHTGXTGPLXSGVEAQIISVDTLKP  466

Query  674  LPPGQLGEIWVRGPNMMQG--------------------------------YYKNP----  603
            LPP QLGEIWVRGPNMM+                                 +YK      
Sbjct  467  LPPNQLGEIWVRGPNMMKDAVEKQNGSQLTLCRMQCKRYKDFIYCAVHCPXWYKWKLIFV  526

Query  602  QATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELEGLLVSHPEIQ  423
             ATKLTIDK+GWVHTGD+GYF++ G L+VVDRIKELIKYKG+QVAPAELE LLVSHPEI 
Sbjct  527  WATKLTIDKKGWVHTGDVGYFDEQGKLFVVDRIKELIKYKGFQVAPAELEALLVSHPEIL  586

Query  422  DAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKVTFINSVPKSA  243
            DAVVIP+PDAEAGEVP+AYVVRSPNSSLTEEDVK FIA QVAP+K+LR+V+FIN+VPKSA
Sbjct  587  DAVVIPFPDAEAGEVPIAYVVRSPNSSLTEEDVKTFIANQVAPFKKLRRVSFINTVPKSA  646

Query  242  SGKILRRELIEKVRAKL  192
            SGKILRRELIEKVRAKL
Sbjct  647  SGKILRRELIEKVRAKL  663



>ref|NP_001130746.1| uncharacterized protein LOC100191850 [Zea mays]
 gb|ACF79086.1| unknown [Zea mays]
Length=350

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP-RHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AKNF +A + QGYGMTETCG++ +E    G  R  GS G LVS VEA+IV V+ L 
Sbjct  129  MEGVAKNFPEAVIAQGYGMTETCGIISLEYPEKGQIRQFGSTGALVSGVEAKIVDVETLI  188

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGEI VRGPN+MQGY+ N QAT+ TI KQGW+HTGD+GYF++ G L+VVDR+KE
Sbjct  189  CLPPNQLGEICVRGPNIMQGYFNNVQATEFTI-KQGWLHTGDIGYFDEGGQLFVVDRLKE  247

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRS  SSLTE DV+K
Sbjct  248  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSSESSLTEVDVQK  307

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRA  198
            FI  QVA YK+LR+VTF++SVPKSASGKILRRELI KVR+
Sbjct  308  FIEKQVAYYKKLRRVTFVDSVPKSASGKILRRELISKVRS  347



>gb|ACF80143.2| unknown [Zea mays]
 tpg|DAA43422.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
 tpg|DAA43423.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=408

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP-RHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AKNF +A + QGYGMTETCG++ +E    G  R  GS G LVS VEA+IV V+ L 
Sbjct  187  MEGVAKNFPEAVIAQGYGMTETCGIISLEYPEKGQIRQFGSTGALVSGVEAKIVDVETLI  246

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGEI VRGPN+MQGY+ N QAT+ TI KQGW+HTGD+GYF++ G L+VVDR+KE
Sbjct  247  CLPPNQLGEICVRGPNIMQGYFNNVQATEFTI-KQGWLHTGDIGYFDEGGQLFVVDRLKE  305

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRS  SSLTE DV+K
Sbjct  306  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSSESSLTEVDVQK  365

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QVA YK+LR+VTF++SVPKSASGKILRRELI KVR+ 
Sbjct  366  FIEKQVAYYKKLRRVTFVDSVPKSASGKILRRELISKVRSS  406



>ref|XP_003558787.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Brachypodium distachyon]
Length=545

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 183/221 (83%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP-RHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AKNF  A + QGYGMTETCG++ +E    G  R  GS G LV+ VEA+IV V+ L+
Sbjct  324  MEAVAKNFPDALICQGYGMTETCGIISLEYPEKGQVRQFGSTGTLVTGVEAKIVDVETLK  383

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI VRGP++MQGY+ N QAT+ TI +QGW+HTGDLG F+ +G L+VVDR+KE
Sbjct  384  HLPPNQLGEICVRGPHIMQGYFNNVQATEFTI-RQGWLHTGDLGLFDDEGQLFVVDRLKE  442

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRSP+SSLTE DV+K
Sbjct  443  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSPDSSLTEVDVQK  502

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QV  YKRL++VTF++SVPKSASGKILRRELI KVR+ 
Sbjct  503  FIETQVTYYKRLKRVTFVSSVPKSASGKILRRELIAKVRSS  543



>gb|ACG28731.1| 4-coumarate--CoA ligase 2 [Zea mays]
Length=520

 Score =   316 bits (810),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP-RHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AKNF +A + QGYGMTETCG++ +E    G  R  GS G LVS VEA+IV V+ L 
Sbjct  299  MEGVAKNFPEAVIAQGYGMTETCGIISLEYPEKGQIRQFGSTGALVSGVEAKIVDVETLI  358

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGEI VRGPN+MQGY+ N QAT+ TI KQGW+HTGD+GYF++ G L+VVDR+KE
Sbjct  359  CLPPNQLGEICVRGPNIMQGYFNNVQATEFTI-KQGWLHTGDIGYFDEGGQLFVVDRLKE  417

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRS  SSLTE DV+K
Sbjct  418  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSSESSLTEVDVQK  477

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QVA YK+LR+VTF++SVPKSASGKILRRELI KVR+ 
Sbjct  478  FIEKQVAYYKKLRRVTFVDSVPKSASGKILRRELISKVRSS  518



>gb|AGA17927.1| CCL10 [Humulus lupulus]
Length=543

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M +CA+N   A +IQGYGMTETCG++ IE+++ G R SGS G+L   +E+QI+   +   
Sbjct  323  MEQCARNVPGAAIIQGYGMTETCGIISIEDSKKGCRFSGSTGMLAPGIESQIMDTKRWNP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIW+RGPNMMQGY  N +ATK TID+QGWV TGD+GYF+++G L+VVDR+KEL
Sbjct  383  LPPNQEGEIWLRGPNMMQGYLNNLEATKSTIDEQGWVKTGDIGYFDEEGQLFVVDRLKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK  G+QVAPAELE LL+SHPEI DAVVIP+PD +AGEVP+A VVRSPNSSL+EEDV++F
Sbjct  443  IKCYGFQVAPAELEALLLSHPEILDAVVIPFPDEKAGEVPIANVVRSPNSSLSEEDVQRF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            I  QVAP+K+LR+VTF++SV KS +GKILRRELI+KVR+K+
Sbjct  503  IEKQVAPFKKLRRVTFVSSVLKSPAGKILRRELIQKVRSKI  543



>gb|EMS62523.1| 4-coumarate--CoA ligase-like 1 [Triticum urartu]
Length=326

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 179/220 (81%), Gaps = 2/220 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A+NF  A ++QGYGMTETCG++ +E    G  R  GS G LV  VEA++V V+  +
Sbjct  105  MEAVARNFPDAEIVQGYGMTETCGIISLEYPEKGQARQFGSTGTLVVGVEAKVVDVETQK  164

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI +RGP +M+GY+ N +AT  TI KQGW+HTGDLGYF+ +G L+VVDR+KE
Sbjct  165  HLPPSQLGEICIRGPQIMEGYFNNVEATDFTI-KQGWLHTGDLGYFDDEGQLFVVDRLKE  223

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PD EAGEVP+AYVVRSP SSLTE DV+K
Sbjct  224  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDDEAGEVPIAYVVRSPASSLTEVDVQK  283

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRA  198
            FIA QV  YKRLR+VTF+ SVPKSA+GKILRRELI +VR+
Sbjct  284  FIAKQVTHYKRLRRVTFVESVPKSAAGKILRRELIAQVRS  323



>ref|XP_004985664.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=575

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 186/227 (82%), Gaps = 2/227 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIEN-TRIGPRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AK+F  A ++QGYGMTETCG++ +EN  R+  R  GS G LV  VEA+IV V+ L+
Sbjct  334  MEAVAKDFPDAEIVQGYGMTETCGIITLENPERVKVRQLGSTGTLVIQVEAKIVDVETLK  393

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI  RGPN+MQGY KN +AT+ TI KQGW+HTGDLGYF++ G L+VVDR+KE
Sbjct  394  HLPPNQLGEICARGPNIMQGYLKNVEATEFTI-KQGWLHTGDLGYFDEGGRLFVVDRLKE  452

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAG+VPVAYVVR+P SSL+E D++ 
Sbjct  453  LIKYKGFQIAPAELEGLLLSHPEIHDAVVIPFPDAEAGQVPVAYVVRAPQSSLSEADIQS  512

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL*WYSG  177
            FI  QVA YKRLR+VTF++SVPKS+SGKILRRELI +V  +L   SG
Sbjct  513  FIEKQVAHYKRLRRVTFVDSVPKSSSGKILRRELIGQVSQRLRQSSG  559



>ref|XP_008672616.1| PREDICTED: uncharacterized protein LOC100191850 isoform X1 [Zea 
mays]
 tpg|DAA43419.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein isoform 1 [Zea mays]
 tpg|DAA43420.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein isoform 2 [Zea mays]
Length=555

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP-RHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AKNF +A + QGYGMTETCG++ +E    G  R  GS G LVS VEA+IV V+ L 
Sbjct  334  MEGVAKNFPEAVIAQGYGMTETCGIISLEYPEKGQIRQFGSTGALVSGVEAKIVDVETLI  393

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGEI VRGPN+MQGY+ N QAT+ TI KQGW+HTGD+GYF++ G L+VVDR+KE
Sbjct  394  CLPPNQLGEICVRGPNIMQGYFNNVQATEFTI-KQGWLHTGDIGYFDEGGQLFVVDRLKE  452

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDAEAGEVP+AYVVRS  SSLTE DV+K
Sbjct  453  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAEAGEVPIAYVVRSSESSLTEVDVQK  512

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QVA YK+LR+VTF++SVPKSASGKILRRELI KVR+ 
Sbjct  513  FIEKQVAYYKKLRRVTFVDSVPKSASGKILRRELISKVRSS  553



>ref|XP_009401821.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Musa acuminata subsp. 
malaccensis]
Length=544

 Score =   315 bits (807),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 182/222 (82%), Gaps = 2/222 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP-RHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A N   A ++Q YGMTETCG++ +E    G  R  GS G +VS +EA++VSVD L+
Sbjct  324  MEIVANNLPHADIVQVYGMTETCGLISLEIPAPGEVRDFGSVGTMVSGMEAKVVSVDTLK  383

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGE+  RGPN+MQGY  NPQAT LT+ K GW+HTGDLGYF++ G L+VVDRIKE
Sbjct  384  PLPPNQLGELCFRGPNIMQGYINNPQATNLTL-KDGWLHTGDLGYFDEKGQLFVVDRIKE  442

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+QVAPAELEGLL+SHPEI DAVVIP+P+AEAGEVP+AYVVRSPNSSLTEEDV+ 
Sbjct  443  LIKYKGHQVAPAELEGLLLSHPEILDAVVIPFPNAEAGEVPIAYVVRSPNSSLTEEDVQN  502

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            FI+  VAP KRLR+VTF+NSVPKSA+GKILRR LIEK R+KL
Sbjct  503  FISKLVAPIKRLRRVTFVNSVPKSAAGKILRRVLIEKARSKL  544



>ref|XP_007027424.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
 gb|EOY07926.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
Length=203

 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -3

Query  800  MTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGPNMMQ  621
            MTE CG + +EN + G R SGS G L+  +E++IVSV+ ++ LPP Q+GEIW+RGP +MQ
Sbjct  1    MTEACGKISLENPKEGRRFSGSTGTLMPVIESKIVSVNTMKPLPPHQIGEIWIRGPTIMQ  60

Query  620  GYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELEGLLV  441
            GY+ NP+ATKL +D++GW+ TGDLGYF++ G L+VVDRIKELIK  G+QVAPAELEGLL+
Sbjct  61   GYFNNPEATKLAMDEKGWLRTGDLGYFDEQGQLFVVDRIKELIKCNGFQVAPAELEGLLL  120

Query  440  SHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKVTFIN  261
            SHPEI D VVIP+PD +AGEVP+AY+VR+PNSSL E+DVK FIA +VAPYKRLR+VTF+N
Sbjct  121  SHPEIVDVVVIPFPDVKAGEVPMAYIVRAPNSSLNEDDVKIFIAEKVAPYKRLRRVTFLN  180

Query  260  SVPKSASGKILRRELIEKVRAKL  192
            SVP+SASGKILRRELI+KVR+K+
Sbjct  181  SVPRSASGKILRRELIQKVRSKI  203



>ref|XP_011021222.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X3 [Populus 
euphratica]
Length=514

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN    T+IQG+GMTETCG+V +E+ RIG RHSGSAG+L + +EAQIVSV+ L+ 
Sbjct  323  MKECAKNLPDTTIIQGFGMTETCGIVSLEDPRIGVRHSGSAGILNAGIEAQIVSVETLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK TIDK+GW+HTGDLGYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLHTGDLGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVV PYPDAEAG VPVAYVVRSPNS+LTEEDV+KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVTPYPDAEAGAVPVAYVVRSPNSALTEEDVQKF  502

Query  314  IAGQVAPYKRLR  279
            I+ QV  +  +R
Sbjct  503  ISDQVLLWINIR  514



>emb|CBI30139.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  749  RHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQG  570
            RHSGS G+LV  VE+QIVS D L+ LPP QLGEIWV+G NMMQGY+ NPQATKLTID+QG
Sbjct  464  RHSGSTGILVPRVESQIVSEDTLKPLPPNQLGEIWVQGANMMQGYFNNPQATKLTIDEQG  523

Query  569  WVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAE  390
            WV TGDLGYF++ G L+VVDRIKELIK+KG+QVAPAELEGLL+SHPEI D+VVIP PD E
Sbjct  524  WVRTGDLGYFDEGGQLFVVDRIKELIKFKGFQVAPAELEGLLLSHPEILDSVVIPLPDVE  583

Query  389  AGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            AGEVP+AYVVRSP SSLTEEDV+KFIA QVAP+KRLR+VTFIN+VPKSASGKILRRELIE
Sbjct  584  AGEVPIAYVVRSPRSSLTEEDVQKFIAKQVAPFKRLRRVTFINNVPKSASGKILRRELIE  643

Query  209  KVRAKL  192
            KVR+K+
Sbjct  644  KVRSKI  649



>sp|Q0DV32.2|4CLL1_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 1 [Oryza sativa Japonica 
Group]
 gb|ABF94022.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH01189.1| unnamed protein product [Oryza sativa Japonica Group]
Length=552

 Score =   312 bits (800),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AK F  + ++QGYGMTETCG++ +E    G  R  GS G LVS VEA+IV +  L+
Sbjct  331  MEVVAKKFPDSEIVQGYGMTETCGIISLEYPEKGQAREFGSTGTLVSGVEAKIVDIKTLK  390

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP Q+GEI VRGPN+MQGY+ N QAT+ TI KQGW+HTGDLGYF+  G L+VVDR+KE
Sbjct  391  HLPPNQVGEICVRGPNVMQGYFNNVQATEFTI-KQGWLHTGDLGYFDGGGQLFVVDRLKE  449

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDA+AGEVP+AYVVRSP+SSLTE DV+K
Sbjct  450  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAKAGEVPIAYVVRSPDSSLTEVDVQK  509

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRA  198
            FI  QVA YKRL++VTF+ SVPKSASGKILRR+LI +VR+
Sbjct  510  FIEKQVAYYKRLKRVTFVGSVPKSASGKILRRQLIAQVRS  549



>ref|NP_001146510.1| uncharacterized protein LOC100280100 [Zea mays]
 gb|ACL54180.1| unknown [Zea mays]
Length=325

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 176/219 (80%), Gaps = 2/219 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A  F    +IQGYGMTETCG++ +E  + G  R  GS G LV+ VEA+IV+   ++
Sbjct  104  MVAMADRFPGVDIIQGYGMTETCGIISLEYVQKGCARQFGSTGALVTGVEAKIVNAKTMK  163

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI VRGPN+M+GY+ N QAT+ TI K GW+HTGDLGYF++ G L+VVDR+KE
Sbjct  164  HLPPSQLGEICVRGPNIMEGYFNNVQATESTI-KNGWLHTGDLGYFDERGQLHVVDRLKE  222

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DA VIPYPDAEAGEVP+AYVV SP SSL E DV+K
Sbjct  223  LIKYKGFQIAPAELEGLLLSHPEILDAAVIPYPDAEAGEVPIAYVVLSPKSSLAEADVQK  282

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVR  201
            FI  QVA YKRLRKVTF+ SVPKSA+GKILRRELI +VR
Sbjct  283  FIEKQVAHYKRLRKVTFVGSVPKSAAGKILRRELIAQVR  321



>ref|XP_006651051.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Oryza brachyantha]
Length=505

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AK F  + ++QGYGMTETCG++ +E    G  R  GS G LV+ VEA+I+ ++  Q
Sbjct  284  MEVVAKKFPDSEIVQGYGMTETCGIISLEYPEKGQAREFGSTGTLVTGVEAKIIDIETSQ  343

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI +RGPN+MQGY+ N QAT+ TI KQGW+HTGDLGYF+  G L+VVDR+KE
Sbjct  344  HLPPDQLGEICIRGPNVMQGYFNNVQATEFTI-KQGWLHTGDLGYFDGGGQLFVVDRLKE  402

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SH EI DAVVIP+PDAEAGEVP+AYVVRSP+SSLTE DV+K
Sbjct  403  LIKYKGFQIAPAELEGLLLSHSEILDAVVIPFPDAEAGEVPIAYVVRSPDSSLTEVDVQK  462

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QVA YKRL++V F+++VPKSASGKILRR+LI +VR+ 
Sbjct  463  FIEKQVAYYKRLKRVMFVDTVPKSASGKILRRQLIAQVRSS  503



>gb|KHM98913.1| 4-coumarate--CoA ligase-like 7, partial [Glycine soja]
Length=186

 Score =   297 bits (761),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 168/207 (81%), Gaps = 21/207 (10%)
 Frame = -3

Query  812  QGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGP  633
            QGYGMTETCG+V +EN R+G RH+GS G L S VEAQIVSVD  + LPP QLGEIWVRGP
Sbjct  1    QGYGMTETCGIVSLENPRVGVRHTGSTGTLGSGVEAQIVSVDTQKPLPPRQLGEIWVRGP  60

Query  632  NMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELE  453
            NMMQG                     DLGYF++DG LYVVDRIKELIKYKG+QVAPAELE
Sbjct  61   NMMQG---------------------DLGYFDEDGQLYVVDRIKELIKYKGFQVAPAELE  99

Query  452  GLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKV  273
            GLLVSHPEI +AVV+PYPD EAGEVP+AYVVRSPNSSLTEE+++KFIA QVAP+K+L++V
Sbjct  100  GLLVSHPEILEAVVVPYPDDEAGEVPIAYVVRSPNSSLTEEEIQKFIAKQVAPFKKLQRV  159

Query  272  TFINSVPKSASGKILRRELIEKVRAKL  192
            TFINSVPK+ASGKILRREL  K R+K+
Sbjct  160  TFINSVPKTASGKILRRELTAKARSKI  186



>gb|KJB36451.1| hypothetical protein B456_006G162900 [Gossypium raimondii]
Length=546

 Score =   310 bits (793),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 176/218 (81%), Gaps = 0/218 (0%)
 Frame = -3

Query  845  CAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPP  666
            CA       + QGYGMTE CG + +EN + G   SGS G L+  ++A+IVSV  +  LPP
Sbjct  329  CANILPHVEIFQGYGMTEACGKISMENPKEGLGFSGSTGSLMPLIQAKIVSVSTMNPLPP  388

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
             Q+GEIW+RGP +  GY+ NP+ATKL ID+QGW+ TGDLGYF++ G L+VVDRIKELIK 
Sbjct  389  NQIGEIWIRGPTITPGYFNNPEATKLGIDEQGWLRTGDLGYFDEQGQLFVVDRIKELIKC  448

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
             G+QVAPAELEGLL+SHP+I DAVVIP+PD +AGEVP+AYVVR PNSSLTEED K+F+A 
Sbjct  449  YGFQVAPAELEGLLLSHPDITDAVVIPFPDVKAGEVPIAYVVRDPNSSLTEEDFKQFVAN  508

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +VA YK+LR++TF+ SVPKSASGKILRRELIEKVR+K+
Sbjct  509  KVAHYKKLRRITFLESVPKSASGKILRRELIEKVRSKI  546



>emb|CDP06777.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 176/221 (80%), Gaps = 4/221 (2%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            + ECAKNF QA ++QGYG+TETCG++ IE+ + GP HSGS G+L   VE +I+ VD  + 
Sbjct  305  IEECAKNFPQAVIVQGYGVTETCGIISIEDVKTGPPHSGSTGVLFPGVECKILDVDTAEP  364

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q G+I VRG NMMQGY+KN  AT  TIDKQGWVHTGDLGYF+  G+LYVVDRIKEL
Sbjct  365  LPPFQKGQILVRGQNMMQGYFKNQIATNETIDKQGWVHTGDLGYFDDKGLLYVVDRIKEL  424

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LL++HPEI DA VIP PDAEAGE+PVA+VVRS NSSLTE +V+ F
Sbjct  425  IKYKGFQVAPAELEELLLTHPEISDAAVIPLPDAEAGEIPVAFVVRSSNSSLTEREVQNF  484

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
                V PYKRL +V F  S+PKSASGKILRR+L ++ ++ L
Sbjct  485  ----VTPYKRLHRVIFSRSIPKSASGKILRRKLRQRAQSNL  521



>gb|EMT32750.1| 4-coumarate--CoA ligase-like protein 1 [Aegilops tauschii]
Length=406

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 176/220 (80%), Gaps = 2/220 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A+NF  A ++QGYGMTETCG++ +E    G  R  GS G LV  VEA++V V+   
Sbjct  185  MEVVARNFPDAEIVQGYGMTETCGIISLEYPEKGQARQFGSTGTLVVGVEAKVVDVETQN  244

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI +RGP +MQGY+ N +AT  TI KQGW+HTGDLGYF+ +G L+VVDR+KE
Sbjct  245  HLPPSQLGEICIRGPQIMQGYFNNVEATDFTI-KQGWLHTGDLGYFDDEGQLFVVDRLKE  303

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKY G+Q+APAELEGLL+SHPEI DAVVIP+PD  AGEVP+AYVVRSP SSLTE DV+K
Sbjct  304  LIKYNGFQIAPAELEGLLLSHPEILDAVVIPFPDDVAGEVPIAYVVRSPASSLTEADVQK  363

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRA  198
            FIA QV  YKRLR+VTF+ SVPKSA+GKILRRELI +VR+
Sbjct  364  FIAKQVTHYKRLRRVTFVESVPKSAAGKILRRELIAQVRS  403



>dbj|BAJ88705.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   308 bits (789),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   AKNF  A ++QGYGMTETCG++ +E    G  R  GS G LV  VEA+++ V+  +
Sbjct  353  MEVVAKNFPDAEIVQGYGMTETCGIISLEYPEKGQARQFGSTGTLVVGVEAKVIDVETQK  412

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI +RGP++MQGY+ N +AT+ TI +QGW+HTGDLGYF+++G L+VVDR+KE
Sbjct  413  HLPPSQLGEICIRGPHIMQGYFNNVEATEFTI-RQGWLHTGDLGYFDEEGQLFVVDRLKE  471

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PD EAGEVP+AYVVRSP SSLTE DV+K
Sbjct  472  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDDEAGEVPIAYVVRSPASSLTEVDVQK  531

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FIA QV  YKRLR+VT + SVPKSA+GKILRRELI +VR+ 
Sbjct  532  FIAKQVTYYKRLRRVTLVESVPKSAAGKILRRELIAQVRSS  572



>ref|XP_004982544.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=550

 Score =   307 bits (786),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 178/221 (81%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A  F  A +IQGYGMTETCG++ +E  + G  R  GS G LV+ VEA+IV    ++
Sbjct  329  MEAVADKFPNAEIIQGYGMTETCGIISLEYPQKGRARQFGSTGALVTGVEAKIVDTKTMK  388

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI +RGPN+MQGY+ N +AT+ TI KQGW+HTGDLGYF++ G LYVVDR+KE
Sbjct  389  HLPPNQLGEICLRGPNIMQGYFNNVKATEFTI-KQGWLHTGDLGYFDERGQLYVVDRLKE  447

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SH +I DAVVIPYPD EAGEVP+AYVVRSP SSL+E DV+K
Sbjct  448  LIKYKGFQIAPAELEGLLLSHAQILDAVVIPYPDPEAGEVPIAYVVRSPKSSLSEVDVQK  507

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QV  YKRLRKVTF++SVPKS SGKILRRELI +VR+ 
Sbjct  508  FIEKQVTHYKRLRKVTFVDSVPKSVSGKILRRELIAQVRSS  548



>ref|XP_004985665.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like isoform X1 [Setaria 
italica]
Length=546

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A+NF    + QGYGMTET G++ +E    G  R  GS G LVS VEA+IV ++ L+
Sbjct  325  MEVVARNFPGTVIAQGYGMTETSGIISLEYPENGQARQFGSTGSLVSGVEAKIVDIETLK  384

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             +PP QLGEI VRGPN+MQGY+ N QAT+ TI K+GW+HTGD+GYF++ G LYVVDR+KE
Sbjct  385  CMPPNQLGEICVRGPNIMQGYFNNVQATEFTI-KEGWLHTGDIGYFDEGGQLYVVDRLKE  443

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDA+AGEVP+AYVVRSP SSLTE DV+K
Sbjct  444  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAKAGEVPIAYVVRSPVSSLTEVDVQK  503

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QVA YK+L++VTF++SVPKSASGKILRRELI KVR+ 
Sbjct  504  FIEKQVAYYKKLKRVTFVDSVPKSASGKILRRELIAKVRSS  544



>gb|ABR17274.1| unknown [Picea sitchensis]
Length=540

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 178/221 (81%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK   QA V QGYG+TE+CG+  I   +    H GSAG LV  +EA+IV+++  + 
Sbjct  320  MEECAKRIPQAAVTQGYGLTESCGIATITFPKERNSHFGSAGTLVPGLEAKIVNLETGRS  379

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GE+W+RGPN+M GY+ NP ATK+T+DK+GW+HTGD+GYF+ +G L++VDRIKEL
Sbjct  380  LPPNQSGEVWLRGPNIMTGYFNNPNATKMTLDKEGWLHTGDMGYFDDEGGLFIVDRIKEL  439

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QV PAELEGLL++HP+I DA VIP PD  AGEVP+AYVVR+P SSLTE+DV  +
Sbjct  440  IKYKGFQVPPAELEGLLLTHPQIVDAGVIPLPDLNAGEVPIAYVVRTPGSSLTEKDVMAY  499

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QVAP+KRL ++ F++S+PKS+SGKILRRELI K ++KL
Sbjct  500  VAKQVAPFKRLHRINFVDSIPKSSSGKILRRELIAKTKSKL  540



>tpg|DAA50089.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=550

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 176/219 (80%), Gaps = 2/219 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A  F    +IQGYGMTETCG++ +E  + G  R  GS G LV+ VEA+IV+   ++
Sbjct  329  MVAMADRFPGVDIIQGYGMTETCGIISLEYVQKGCARQFGSTGALVTGVEAKIVNAKTMK  388

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI VRGPN+M+GY+ N QAT+ TI K GW+HTGDLGYF++ G L+VVDR+KE
Sbjct  389  HLPPSQLGEICVRGPNIMEGYFNNVQATESTI-KNGWLHTGDLGYFDERGQLHVVDRLKE  447

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DA VIPYPDAEAGEVP+AYVV SP SSL E DV+K
Sbjct  448  LIKYKGFQIAPAELEGLLLSHPEILDAAVIPYPDAEAGEVPIAYVVLSPKSSLAEADVQK  507

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVR  201
            FI  QVA YKRLRKVTF+ SVPKSA+GKILRRELI +VR
Sbjct  508  FIEKQVAHYKRLRKVTFVGSVPKSAAGKILRRELIAQVR  546



>ref|XP_004982543.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=550

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 178/221 (81%), Gaps = 2/221 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A  F  A +IQ YGMTETCG++ +E  + G  R  GS G LVS VEA+IV    ++
Sbjct  329  MEAVADKFPNAEIIQSYGMTETCGMISLEYPQKGRTRPFGSTGSLVSGVEAKIVDAKTMK  388

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
            HLPP QLGEI VRGPN+M+GY  N +AT+LTI KQGW+HTGDLGYF++ G LYVVDR+KE
Sbjct  389  HLPPNQLGEICVRGPNIMRGYLNNVEATELTI-KQGWLHTGDLGYFDERGQLYVVDRLKE  447

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SH ++ DAVVIPYPD EAGEVP+AYVVRSPNSSL+E DV+K
Sbjct  448  LIKYKGFQIAPAELEGLLLSHAQVLDAVVIPYPDPEAGEVPIAYVVRSPNSSLSEADVQK  507

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            FI  QVA YKR RKV F++SVPKSASGKILRRELI +VR+ 
Sbjct  508  FIEKQVAYYKRPRKVKFVDSVPKSASGKILRRELIAQVRSS  548



>gb|AGO89329.1| Ca4CL12 [Salix arbutifolia]
Length=529

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN     + QGYGMTET G+V +E+ RI  RHSGSAG+L + +EAQIVSV+    
Sbjct  323  MKECAKNLPDTIITQGYGMTETSGIVSVEDPRICSRHSGSAGILSAGIEAQIVSVETAVP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY  NPQATK TIDK+GWVHTGDLGYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYLNNPQATKDTIDKKGWVHTGDLGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLLVSHPEI DAVVIPYPDAEAGEVPVAYVVRSPNS+L  EDV+KF
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVIPYPDAEAGEVPVAYVVRSPNSTLAGEDVQKF  502

Query  314  IAGQVA  297
            IA QV+
Sbjct  503  IADQVS  508



>gb|EEC74534.1| hypothetical protein OsI_10054 [Oryza sativa Indica Group]
Length=587

 Score =   301 bits (771),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = -3

Query  809  GYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGP  633
            GYGMTETCG++ +E    G  R  GS G LVS VEA+IV +  L+HLPP Q+GEI VRGP
Sbjct  381  GYGMTETCGIMSLEYPEKGQAREFGSTGTLVSGVEAKIVDIKTLKHLPPNQVGEICVRGP  440

Query  632  NMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELE  453
            N+MQGY+ N QAT+ TI KQGW+HTGDLGYF+  G L+VVDR+KELIKYKG+Q+APAELE
Sbjct  441  NVMQGYFNNVQATEFTI-KQGWLHTGDLGYFDGGGQLFVVDRLKELIKYKGFQIAPAELE  499

Query  452  GLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKV  273
            GLL+SHPEI DAVVIP+PDA+AGEVP+AYVVRSP+SSLTE DV+KFI  QVA YKRL++V
Sbjct  500  GLLLSHPEILDAVVIPFPDAKAGEVPIAYVVRSPDSSLTEVDVQKFIEKQVAYYKRLKRV  559

Query  272  TFINSVPKSASGKILRRELIEKVRAK  195
            TF+ SVPKSASGKILRR+LI +VR+ 
Sbjct  560  TFVGSVPKSASGKILRRQLIAQVRSS  585



>ref|XP_002466906.1| hypothetical protein SORBIDRAFT_01g016420 [Sorghum bicolor]
 gb|EER93904.1| hypothetical protein SORBIDRAFT_01g016420 [Sorghum bicolor]
Length=564

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 173/209 (83%), Gaps = 2/209 (1%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWV  642
            ++QGYGMTETCG++ +E  + G  R  GS G LV  VEA+IV    ++HLPP QLGEI V
Sbjct  355  LLQGYGMTETCGIISLEYVQKGRARQFGSTGALVIGVEAKIVDTKTMKHLPPNQLGEICV  414

Query  641  RGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPA  462
            RGPN+M+GY+ N QAT+ TI KQGW+HTGDLGYF++ G L+VVDR+KELIKYKG+Q+APA
Sbjct  415  RGPNIMEGYFNNVQATEFTI-KQGWLHTGDLGYFDERGQLHVVDRLKELIKYKGFQIAPA  473

Query  461  ELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRL  282
            ELEGLL+SHPEI DA VIPYPD EAGEVP+AYVVRSP SSL E DV+KFI  QVA YKRL
Sbjct  474  ELEGLLLSHPEILDAAVIPYPDPEAGEVPIAYVVRSPKSSLAEVDVQKFIEKQVAHYKRL  533

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAK  195
            RKV F++SVPKSA+GKILRRELI +VR+ 
Sbjct  534  RKVKFVDSVPKSAAGKILRRELIAQVRSS  562



>ref|XP_004497538.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cicer arietinum]
Length=558

 Score =   299 bits (766),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 179/226 (79%), Gaps = 10/226 (4%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHS------GSAGLLVSAVEAQIVS  693
            M ECAK   Q  +IQGYGMTE  G++ +EN    P+ S      GS G L+  +E+QIVS
Sbjct  333  MQECAKILPQVEIIQGYGMTEASGLISVEN----PKESCFIAVSGSTGTLIPCIESQIVS  388

Query  692  VDKLQHLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVV  513
            ++  + LPP QLGEIW+RGP +M+GY+ NP+ATKLTID +GW+ TGDLGYF++ G L+VV
Sbjct  389  LETSKPLPPNQLGEIWLRGPTIMKGYFNNPEATKLTIDDKGWMLTGDLGYFDEKGQLFVV  448

Query  512  DRIKELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTE  333
            DRIKELIK  GYQVAPAELE LLVSHPEI DA VIP PDA+AGEVPVA+VVRSP+SS+TE
Sbjct  449  DRIKELIKCSGYQVAPAELEDLLVSHPEISDAGVIPSPDAKAGEVPVAFVVRSPDSSITE  508

Query  332  EDVKKFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            E+++KF+A QVAPYKRLR+V+FI+ +PKS +GKILR++LI   R K
Sbjct  509  EEIQKFVAKQVAPYKRLRRVSFIDKIPKSPTGKILRKDLIIFDRQK  554



>gb|EEE58336.1| hypothetical protein OsJ_09444 [Oryza sativa Japonica Group]
Length=598

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 174/207 (84%), Gaps = 2/207 (1%)
 Frame = -3

Query  809  GYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGP  633
            GYGMTETCG++ +E    G  R  GS G LVS VEA+IV +  L+HLPP Q+GEI VRGP
Sbjct  381  GYGMTETCGIISLEYPEKGQAREFGSTGTLVSGVEAKIVDIKTLKHLPPNQVGEICVRGP  440

Query  632  NMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELE  453
            N+MQGY+ N QAT+ TI KQGW+HTGDLGYF+  G L+VVDR+KELIKYKG+Q+APAELE
Sbjct  441  NVMQGYFNNVQATEFTI-KQGWLHTGDLGYFDGGGQLFVVDRLKELIKYKGFQIAPAELE  499

Query  452  GLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLRKV  273
            GLL+SHPEI DAVVIP+PDA+AGEVP+AYVVRSP+SSLTE DV+KFI  QVA YKRL++V
Sbjct  500  GLLLSHPEILDAVVIPFPDAKAGEVPIAYVVRSPDSSLTEVDVQKFIEKQVAYYKRLKRV  559

Query  272  TFINSVPKSASGKILRRELIEKVRAKL  192
            TF+ SVPKSASGKILRR+LI +  +KL
Sbjct  560  TFVGSVPKSASGKILRRQLIAQPFSKL  586



>ref|XP_011087155.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Sesamum indicum]
Length=545

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 174/221 (79%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            + ECAK F Q  + QGYG+TETCG V +EN     +HSGS G+L   VEA+I+ ++++Q 
Sbjct  325  LEECAKVFPQTALYQGYGLTETCGAVSLENAAASSQHSGSTGMLDPGVEARIMDLERMQP  384

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWVRGPN+M GY+KN +ATK TID +GW+HTGDLGYF+ +G ++VVDR+KEL
Sbjct  385  LPPLQKGEIWVRGPNVMLGYFKNEKATKETIDDEGWLHTGDLGYFDNEGRIHVVDRLKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LL++HPEI+DA VI   D +AGEVP+A+VVRS  SSLTE + K F
Sbjct  445  IKYKGFQVAPAELEELLLTHPEIKDAAVIGLSDVDAGEVPIAFVVRSSYSSLTEVETKDF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLRKV F   +PKSA+GKILRREL  +  +KL
Sbjct  505  IAKQVAPYKRLRKVIFSEEIPKSAAGKILRRELRHRFLSKL  545



>gb|KEH42182.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=551

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 174/220 (79%), Gaps = 2/220 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP--RHSGSAGLLVSAVEAQIVSVDKL  681
            M EC K      VIQGYGMTE CG+V IEN + G     SGS G L+ +VE++I+++  L
Sbjct  326  MQECTKILPHVHVIQGYGMTEACGLVSIENPKEGSLISVSGSTGTLIPSVESRIINLATL  385

Query  680  QHLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIK  501
            + LPP QLGEIW+RGP +MQGY+ NP+ATKL I+ QGW+ TGDLGYF++ G L+VVDRIK
Sbjct  386  KPLPPNQLGEIWLRGPTIMQGYFNNPEATKLAINDQGWMITGDLGYFDEKGQLFVVDRIK  445

Query  500  ELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVK  321
            ELIK  GYQVAPAELE LLVSHPEI DA VIP PDA+ GEVPVA+VVR PNSS+T+ED++
Sbjct  446  ELIKCSGYQVAPAELEDLLVSHPEISDAGVIPSPDAKVGEVPVAFVVRLPNSSITKEDIQ  505

Query  320  KFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVR  201
            KF+A QVAPYKRLR+VTF+  +PK A+GKILR++L+   R
Sbjct  506  KFVAKQVAPYKRLRRVTFLEKIPKLATGKILRKDLVSFDR  545



>gb|KEH42183.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=555

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 172/216 (80%), Gaps = 2/216 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGP--RHSGSAGLLVSAVEAQIVSVDKL  681
            M  CA+   +  +IQGYGMTE CG++  EN + G    +SGS G LV +VE+QIVS+   
Sbjct  330  MQACAEILPKIEIIQGYGMTEACGLISFENPKEGAFLSNSGSTGKLVPSVESQIVSLQTS  389

Query  680  QHLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIK  501
            + LPP QLGEIW+RGP MMQGY+ NP+ATK TI+ QGW  TGDLGYF++ G L+VVDRIK
Sbjct  390  KSLPPNQLGEIWLRGPVMMQGYFNNPEATKQTINDQGWTLTGDLGYFDEKGQLFVVDRIK  449

Query  500  ELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVK  321
            ELIK  GYQVAPAELE LL+SHPEI DA VIP PDA+AGEVPVA+VVRS NS +TEED+K
Sbjct  450  ELIKCNGYQVAPAELEDLLISHPEISDAGVIPSPDAKAGEVPVAFVVRSLNSLITEEDIK  509

Query  320  KFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
            KF+A +VAPYKRLR+VTFI  +PKS +GKILR++L+
Sbjct  510  KFVAKEVAPYKRLRRVTFIEKIPKSPTGKILRKDLV  545



>gb|ABR18186.1| unknown [Picea sitchensis]
Length=540

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 176/221 (80%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECA    QA + QGYG+TE+CG+  I   +    H GSAG LV  +EA+IV+++  + 
Sbjct  320  MQECANKIPQAIMTQGYGLTESCGIATIIFPKERNGHFGSAGTLVPGLEAKIVNLETGRP  379

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GE+W+RGPN+M GY+ NP ATK+T+DK+GW+HTGD+GYF+  G L++VDRIKEL
Sbjct  380  LPPNQRGEVWLRGPNIMTGYFNNPNATKMTLDKEGWLHTGDMGYFDDKGGLFIVDRIKEL  439

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELEGLL++HP+I DA VIP+PD  AGEVP+AYVV +P SSLTE++   +
Sbjct  440  IKYKGFQVAPAELEGLLLTHPQIVDAGVIPFPDLNAGEVPIAYVVCTPGSSLTEKNFMDY  499

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QVAP+KRL ++ F++S+P+S+SGKILRRELI K ++KL
Sbjct  500  VAKQVAPFKRLHRINFVDSIPRSSSGKILRRELIAKTKSKL  540



>gb|AIY34663.1| 4-coumarate:CoA ligase-like protein [Ornithogalum saundersiae]
Length=547

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 172/218 (79%), Gaps = 1/218 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M E A+ F    V+QGYG+TET  ++ +E  +   R  GS G L++ +EA++++VD LQ 
Sbjct  322  MEEVARAFDGVDVVQGYGLTETTSIISLERCKEKGRKIGSTGYLMAGIEAKVITVDTLQP  381

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            +PP   GE+  RGPNMMQGY+ NP+AT+LT+D +GW+HTGDLGYF++ G LYV DRIKEL
Sbjct  382  VPPRMNGELLFRGPNMMQGYFNNPEATRLTLDDEGWLHTGDLGYFDEKGRLYVEDRIKEL  441

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IK KG+QVAPAELE +L+SHP+I DA V+P  DAEAG+VP+A+VV  P+SSLTE DV+KF
Sbjct  442  IKCKGFQVAPAELEAVLISHPQILDAAVVPMEDAEAGQVPIAFVV-CPDSSLTETDVQKF  500

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVR  201
            +A +VAPYKRLR+V F+N +PK+ASGKILRREL ++ +
Sbjct  501  VANEVAPYKRLRRVVFVNGIPKTASGKILRRELTQEAK  538



>ref|XP_011087272.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Sesamum indicum]
Length=546

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 168/219 (77%), Gaps = 0/219 (0%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            ECA+ F  A V QGYGMTET G +   N R    +SGS G+L   VEAQIV++  ++ LP
Sbjct  328  ECARIFPDAVVYQGYGMTETGGPISFGNVRTDTPYSGSTGVLAPGVEAQIVNLGTMKPLP  387

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            P + GEIWVRG  +MQGY+ N +AT  TID+QGW+HTGD+GYF++ G LYVVDR+KELIK
Sbjct  388  PLRRGEIWVRGLMVMQGYFNNQKATMETIDEQGWLHTGDIGYFDEKGRLYVVDRVKELIK  447

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
              GYQVAPAELE LL++HPEI+DA VI   DAE GEVP+AYVVRS  +SL EE+VK FIA
Sbjct  448  CNGYQVAPAELEELLLTHPEIKDAAVIGLADAEVGEVPIAYVVRSSTTSLVEEEVKTFIA  507

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
             QVA YKRLR+V F +S+PKSASGKILR+EL ++  +KL
Sbjct  508  EQVAAYKRLRRVIFTDSIPKSASGKILRKELAQRFLSKL  546



>ref|XP_010918638.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X2 [Elaeis 
guineensis]
Length=512

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENT-RIGPRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M + +KNF  A VIQGYGMTETCG++ +EN  +   R  GS G+L S VE ++VS++ L+
Sbjct  323  MADVSKNFPDADVIQGYGMTETCGIISLENPPKAEARWFGSTGILASGVEGKVVSINTLK  382

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             LPP QLGE+  RGPN+MQGY  NPQATKLT+D+QGW+HTGDLGYF++ G LYVVDRIKE
Sbjct  383  SLPPNQLGELCFRGPNIMQGYLNNPQATKLTLDEQGWLHTGDLGYFDEKGQLYVVDRIKE  442

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+QVAPAELEGLL+SH EI DAVVIP+PDAEAGEVP+A+VVRSPNSSLTEE+V+K
Sbjct  443  LIKYKGFQVAPAELEGLLLSHSEILDAVVIPFPDAEAGEVPIAFVVRSPNSSLTEENVQK  502

Query  317  FIAGQ  303
            FIA Q
Sbjct  503  FIAEQ  507



>ref|XP_006424487.1| hypothetical protein CICLE_v10029864mg [Citrus clementina]
 gb|ESR37727.1| hypothetical protein CICLE_v10029864mg [Citrus clementina]
Length=509

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            EC+KN    TV QGYGMTETCGVV +EN  +G ++SGS G LV+ VEAQIV VD L+ LP
Sbjct  328  ECSKNLPTVTVFQGYGMTETCGVVTVENPLLGVQNSGSTGTLVAGVEAQIVCVDTLKPLP  387

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            P Q+GE+WVRGP +M GY+ N QATKL IDK+GW+HTGDLGYF++ G L++VDRIKELIK
Sbjct  388  PNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIK  447

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
              G+QV   ELEG+LVSHPEI DAVVIP+PD EAGEVP+AYVVRSPNSSLT+EDV+KF+A
Sbjct  448  CNGFQV---ELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVA  504



>gb|AHI15919.1| 4-coumarate:CoA ligase 3 [Dryopteris fragrans]
Length=543

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 162/221 (73%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            + E  + F    + QGYGMTET GVV +   +   ++  + G LVS +EA +V     + 
Sbjct  323  LEELYQRFEAPDIRQGYGMTETTGVVSVAILKSTKKNYATVGPLVSGMEAVVVDPSSGKR  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            L P + GE WVRGPN+MQGY  NP+AT  T+D+ GW+HTGDLGY + +G LY++DR+KEL
Sbjct  383  LSPNKQGEFWVRGPNIMQGYLNNPEATTSTLDRDGWLHTGDLGYIDDEGNLYIMDRLKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LL+ H EI DA V+P+PD EAGEVP+AYVVRS  SSL E+DV +F
Sbjct  443  IKYKGFQVAPAELEALLLMHSEIVDAAVVPFPDDEAGEVPLAYVVRSSGSSLCEQDVIQF  502

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QVAPYK++RKV FI  +PKS+SGKILRREL    ++KL
Sbjct  503  VASQVAPYKKVRKVKFIEVIPKSSSGKILRRELTHNSQSKL  543



>gb|ABR17473.1| unknown [Picea sitchensis]
Length=548

 Score =   265 bits (678),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 161/209 (77%), Gaps = 0/209 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            F +  + QGYG+TET G +   N+    R +G+ GLL   VEA++V  D  + LPP Q G
Sbjct  333  FPRIQIRQGYGLTETTGAIAYTNSDEENRRNGTVGLLSDVVEAKVVDPDSAKPLPPNQRG  392

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            E+W+RGP +M+GY+ N  AT  T+D +GW+ TGDL YF+++G L+VVDR+K+LIKYK YQ
Sbjct  393  ELWLRGPTVMKGYFGNEHATATTLDSEGWLRTGDLCYFDEEGFLFVVDRLKDLIKYKAYQ  452

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            VAPAELE LL+SHPEI +A VIPYPD EAG++P+A+V RSP+S+L+E DV KF+A QV  
Sbjct  453  VAPAELEELLLSHPEISEAAVIPYPDQEAGQIPMAFVARSPSSNLSESDVIKFVAEQVVH  512

Query  293  YKRLRKVTFINSVPKSASGKILRRELIEK  207
            YK++R+V F NS+PK+ASGKILR++LIEK
Sbjct  513  YKKIRRVAFTNSIPKNASGKILRKDLIEK  541



>gb|KDP29158.1| hypothetical protein JCGZ_16547 [Jatropha curcas]
Length=479

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC KN     +IQGYG TETCG++ IEN R     SGS G+LV  V++QIVSVD  + 
Sbjct  278  MEECTKNLPHIDIIQGYGSTETCGIISIENPRESTCLSGSTGMLVPGVQSQIVSVDMSKP  337

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEI ++G NMMQGY+ N QATKLTID+QGWVHTGD+GYFN+ G L+VVDRIKEL
Sbjct  338  LPPNQLGEICLQGANMMQGYFNNSQATKLTIDEQGWVHTGDVGYFNEKGQLFVVDRIKEL  397

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
             K  G+QVAPAELEGLL+SHPEI DAVV P+P ++AG VP+AYVV SP+SSLTEEDV+KF
Sbjct  398  NKCNGFQVAPAELEGLLLSHPEILDAVVFPFPYSKAGGVPIAYVVHSPDSSLTEEDVQKF  457

Query  314  IAGQV  300
            I  QV
Sbjct  458  IVEQV  462



>gb|ADE77047.1| unknown [Picea sitchensis]
Length=373

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 159/219 (73%), Gaps = 0/219 (0%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            E    F   +++QGYG+TET G           RH GS G+L   +EA+IV  D +  LP
Sbjct  150  EFVARFPSVSLLQGYGLTETTGRGASTENEEESRHYGSVGMLTPNIEAKIVDPDSITPLP  209

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            P + GE+W+RGP +M+GY+ NP+AT   +DK GW+ TGDL Y + +G L+VVDR+KELIK
Sbjct  210  PNKKGELWLRGPVVMKGYFNNPEATASALDKDGWLRTGDLCYIDDNGYLFVVDRLKELIK  269

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YKGYQVAPAELE LL+SHPEI +A VIP+ D EAG+VP+AY+VR P S+L E +V  F+A
Sbjct  270  YKGYQVAPAELEALLLSHPEIAEAAVIPFEDREAGQVPMAYIVRKPGSTLYETNVTDFVA  329

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
             QVAPYK++R+V F++ +PK+A+GK LR++LI+   +KL
Sbjct  330  QQVAPYKKVRRVAFVSEIPKTAAGKTLRKDLIKLATSKL  368



>ref|XP_004514911.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cicer arietinum]
Length=552

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 160/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + F   T++QGYG+TET GV    N     R  G+AGLL S+ EA IV +D  Q L   Q
Sbjct  337  EKFPNVTILQGYGLTETSGVGASTNCFEESRKYGTAGLLSSSTEAMIVDIDTAQPLAINQ  396

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY  N +ATK T+  +GW+ TGD+ Y + DG L+VVDR+KELIKYKG
Sbjct  397  TGELWLRGPTIMKGYLSNEEATKSTLTSEGWLKTGDICYIDSDGYLFVVDRLKELIKYKG  456

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++H  I DA VIPYP+ EAG++P+AYVVR   S+++E+ V  F+AGQV
Sbjct  457  YQVPPAELEALLLTHHAILDAAVIPYPNKEAGQIPMAYVVRKAGSNISEKQVMDFVAGQV  516

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+RKVTFI+S+PK+ SGKILR++LI+   AKL
Sbjct  517  APYKRIRKVTFISSIPKNPSGKILRKDLIKLATAKL  552



>ref|XP_002985866.1| hypothetical protein SELMODRAFT_446445 [Selaginella moellendorffii]
 gb|EFJ13043.1| hypothetical protein SELMODRAFT_446445 [Selaginella moellendorffii]
Length=545

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M  C++    A + QGYG+TE+ G+  +   R  PR  G+AG LVS  EA +V  +  + 
Sbjct  326  METCSRRLPLADIRQGYGLTESTGLALLTLPREDPRFMGAAGTLVSGTEAMVVDPETCKP  385

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            +PP + GE+W+RG  +M+GY  NP AT  TIDK GW+HTGDL Y N+ G  +V+DR+KEL
Sbjct  386  VPPQKSGELWLRGQQIMKGYLNNPTATASTIDKNGWLHTGDLVYVNQ-GRFFVLDRMKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LL+SHP + DA V+P  D EAG+VP+AYVV+ PN+++ E +V  F
Sbjct  445  IKYKGFQVAPAELEALLLSHPSLLDAAVVPLADEEAGQVPIAYVVKKPNATVDESNVLNF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI+++PKSA+GKILRREL    ++KL
Sbjct  505  IAKQVAPYKRLRRVSFIDAIPKSAAGKILRRELTALPQSKL  545



>ref|XP_004514323.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cicer arietinum]
Length=552

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 158/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +   T++QGYG+TET G     N     R  G+ GLL S+ EA IV +D  Q L   Q
Sbjct  337  EKYPNVTILQGYGLTETSGFGASTNCFEESRKYGTTGLLSSSTEAMIVDIDTAQPLAINQ  396

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY +N +ATK T+   GW+ TGD+ Y + DG L+VVDR+KELIKYKG
Sbjct  397  TGELWLRGPTIMKGYLRNEEATKSTLTSDGWLKTGDVCYIDSDGYLFVVDRLKELIKYKG  456

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP I D  VIPYPD EAG++P+AYVVR   SS++E+ V  ++AGQV
Sbjct  457  YQVPPAELEALLLTHPAILDVAVIPYPDKEAGQIPMAYVVRKAGSSISEKQVIDYVAGQV  516

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYK++RKVTFI+ +PK+ SGKILR++L++  RAKL
Sbjct  517  APYKKIRKVTFISFIPKNPSGKILRKDLVKLARAKL  552



>ref|XP_003545004.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Glycine max]
Length=549

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            +   T++QGYG+TE+ GV    ++    R  G+AGLL  A +A IV  +  Q LP  + G
Sbjct  336  YPNVTILQGYGLTESTGVGASTDSLEESRRYGTAGLLSPATQAMIVDPESGQSLPVNRTG  395

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            E+W+RGP +M+GY+ N +AT  T+D +GW+ TGD+ Y + DG +++VDR+KELIKYKGYQ
Sbjct  396  ELWLRGPTIMKGYFSNEEATTSTLDSKGWLRTGDICYIDNDGFIFIVDRLKELIKYKGYQ  455

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            V PAELE LL++HP I DA VIPYPD EAG+ P+AYVVR   SSL+E  V  F+AGQVAP
Sbjct  456  VPPAELEALLLTHPAILDAAVIPYPDKEAGQHPMAYVVRKAGSSLSETQVMDFVAGQVAP  515

Query  293  YKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            YKR+RKV FI+S+PK+ SGKILR++LI+   +KL
Sbjct  516  YKRIRKVAFISSIPKNPSGKILRKDLIKLATSKL  549



>ref|XP_002985111.1| hypothetical protein SELMODRAFT_157069 [Selaginella moellendorffii]
 gb|EFJ13986.1| hypothetical protein SELMODRAFT_157069 [Selaginella moellendorffii]
Length=523

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 155/212 (73%), Gaps = 1/212 (0%)
 Frame = -3

Query  845  CAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPP  666
            C + F    V QGYG+TE+  +  + +      H GSAGLL S   A+++ V   + LPP
Sbjct  305  CLERFPDVKVRQGYGLTESTAIASVADPD-DLEHYGSAGLLSSNTLAKVIDVGSGRPLPP  363

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
             Q GEIW+ GP +M GY  NP+AT  T+D +GW+HTGDLGYF+  G LYVVDRIKELIKY
Sbjct  364  NQQGEIWIHGPTIMDGYLNNPKATAETVDAEGWLHTGDLGYFDDSGNLYVVDRIKELIKY  423

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
            KG+QVAPAELE LL+SH ++ DA VIP+PD EAG+VP+A +VR    SL  + V KF++ 
Sbjct  424  KGFQVAPAELEALLLSHSQVVDAAVIPFPDEEAGQVPLAVIVRKQGCSLDGQGVMKFVSD  483

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            QVAPYK++RKV FI+++PKSASGKILRREL++
Sbjct  484  QVAPYKKVRKVMFIDAIPKSASGKILRRELVQ  515



>ref|NP_001140329.1| uncharacterized protein LOC100272376 [Zea mays]
 gb|ACF83595.1| unknown [Zea mays]
 gb|AFW84287.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=442

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 162/215 (75%), Gaps = 6/215 (3%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGP---RHSGSAGLLVSAVEAQIVSVDKLQHL  672
            A  F    +IQGYG+TET G V    + +GP   +  GS G L S +EA+IV     + L
Sbjct  222  AAIFPNIELIQGYGLTETSGSVA---STVGPDECKAYGSVGKLASHLEAKIVDPSTGEVL  278

Query  671  PPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELI  492
             PGQ GE+WVRGP +M+GY  + +AT  T+D +GW+ TGDL YFN+DG+LY+VDR+KELI
Sbjct  279  GPGQRGELWVRGPVVMKGYVGDDEATAATVDSEGWLKTGDLCYFNEDGLLYIVDRLKELI  338

Query  491  KYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFI  312
            KYKGYQV PAELE +L SHP+I DA VIPYPD +AG++P+A++VR P S+LTE+ V  F+
Sbjct  339  KYKGYQVPPAELEHILNSHPDIMDAAVIPYPDEDAGQLPMAFIVRKPGSNLTEQQVMDFV  398

Query  311  AGQVAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            A QVAPYK++R+V F++++PKS +GKILRREL+E+
Sbjct  399  AKQVAPYKKVRRVAFVSAIPKSPAGKILRRELVEQ  433



>gb|ADE77598.1| unknown [Picea sitchensis]
Length=303

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 156/219 (71%), Gaps = 0/219 (0%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            E    F  AT+ +GY +TET GV    +     RH GS G+L    EA++V  D    L 
Sbjct  85   EFGSRFPTATLFKGYALTETTGVGASADCEEESRHHGSVGMLAPNTEAKVVDPDSGAPLS  144

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            P + GE+W+RGP +M+GY+KNP AT   +D  GW+ TGDL Y + +G L+VVDR+KELIK
Sbjct  145  PNKRGELWLRGPFVMKGYFKNPDATTSALDVHGWLRTGDLCYIDDEGYLFVVDRLKELIK  204

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YKGYQVAPAELE LL+SHPEI DA VIP+PD  AG+VP+AY+V+ P ++L+E  V  F+ 
Sbjct  205  YKGYQVAPAELEALLLSHPEIVDAAVIPFPDKAAGQVPMAYIVQKPGNTLSEISVIDFVT  264

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
             QVAPYK++R+V F++ +PK+A+GKILR++LI+   +KL
Sbjct  265  QQVAPYKKIRRVAFVSKIPKTAAGKILRKDLIKLATSKL  303



>ref|XP_007160602.1| hypothetical protein PHAVU_001G001300g [Phaseolus vulgaris]
 gb|ESW32596.1| hypothetical protein PHAVU_001G001300g [Phaseolus vulgaris]
Length=547

 Score =   255 bits (651),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            +   T++QGYG+TE+ GV    ++    R  G+AGLL  A +A IV  D  + LP    G
Sbjct  334  YPNVTILQGYGLTESTGVGASTDSLEESRRYGTAGLLSPATQAMIVDPDSGRSLPVNSTG  393

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            E+W+RGP +M+GY+ N +AT  T+D +GW+ TGD+ Y + DG +++VDR+KELIKYKGYQ
Sbjct  394  ELWLRGPTIMKGYFNNEEATTSTLDSKGWLRTGDVCYIDNDGFIFIVDRLKELIKYKGYQ  453

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            V PAELE LL++HP I DA VIPYPD E G+ P+AYVVR   SSL+E  V  F+AGQVAP
Sbjct  454  VPPAELEALLLTHPAISDAAVIPYPDKEVGQFPMAYVVRKDGSSLSESQVMDFVAGQVAP  513

Query  293  YKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            YKR+RKV FI+SVPK+ SGKILR++LI+   +KL
Sbjct  514  YKRIRKVAFISSVPKNPSGKILRKDLIKLATSKL  547



>ref|XP_002984802.1| hypothetical protein SELMODRAFT_181279 [Selaginella moellendorffii]
 gb|EFJ14052.1| hypothetical protein SELMODRAFT_181279 [Selaginella moellendorffii]
Length=545

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M  C++    A + QGYG+TE+ G+  +      PR  G+AG LVS  EA +V  +  + 
Sbjct  326  MEACSRRLPLADIRQGYGLTESTGMALLTLPGEDPRFMGAAGSLVSGTEAMVVDPETCKP  385

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            +PP + GE+W+RG  +M+GY  NP AT  TID+ GW+HTGDL Y N+ G  +V+DR+KEL
Sbjct  386  VPPQKSGELWLRGQQIMKGYLNNPTATASTIDENGWLHTGDLVYVNQ-GRFFVLDRMKEL  444

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG+QVAPAELE LL+SHP + DA V+P  D EAG+VP+AYVV+ PN+++ E +V  F
Sbjct  445  IKYKGFQVAPAELEALLLSHPSLLDAAVVPLADEEAGQVPIAYVVKKPNATVDESNVLNF  504

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            IA QVAPYKRLR+V+FI+++PKSA+GKILRREL    ++KL
Sbjct  505  IAKQVAPYKRLRRVSFIDAIPKSAAGKILRRELTALPQSKL  545



>ref|XP_011021223.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X4 [Populus 
euphratica]
Length=472

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAKN    T+IQG+GMTETCG+V +E+ RIG RHSGSAG+L + +EAQIVSV+ L+ 
Sbjct  323  MKECAKNLPDTTIIQGFGMTETCGIVSLEDPRIGVRHSGSAGILNAGIEAQIVSVETLKP  382

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMM+GY+ NPQATK TIDK+GW+HTGDLGYF+ DG L+VVDRIKEL
Sbjct  383  LPPNQLGEIWVRGPNMMRGYFNNPQATKDTIDKRGWLHTGDLGYFDDDGQLFVVDRIKEL  442

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIP  405
            IKYKG+QVAPAELEGLLVSHPEI DAVV P
Sbjct  443  IKYKGFQVAPAELEGLLVSHPEILDAVVTP  472



>ref|XP_011628970.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Amborella trichopoda]
Length=548

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 160/208 (77%), Gaps = 0/208 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            F +  ++QGYG+TET G+    +T    R  G+AGLL   +EA++V  D  + L P Q G
Sbjct  328  FPKVAIMQGYGLTETSGIGASADTPEESRRYGTAGLLSPNMEAKVVDPDTGEALLPNQRG  387

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            ++W+RGP++M+GY+ N +AT   +D +GW+ TGDL YF++DG L+VVDR+KELIKYKGYQ
Sbjct  388  DLWLRGPSIMKGYFSNAEATAGALDAEGWLKTGDLCYFDEDGFLFVVDRLKELIKYKGYQ  447

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            VAPAELE LL++HP I+DA V+P+PD EAG++P+A+VVR   SSL+E  + +F+A QVAP
Sbjct  448  VAPAELEALLLTHPNIEDAAVVPFPDKEAGQIPMAFVVRKAGSSLSEATLMEFVAAQVAP  507

Query  293  YKRLRKVTFINSVPKSASGKILRRELIE  210
            YK++R+V F++++PK+ASGK LR++LI 
Sbjct  508  YKKIRRVAFVSAIPKNASGKTLRKDLIS  535



>gb|AHI15920.1| 4-coumarate:CoA ligase 4 [Dryopteris fragrans]
Length=550

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 152/221 (69%), Gaps = 0/221 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M      F    + QGYG+TET  V     T     H GS GLL +  E +IV VD  + 
Sbjct  330  MDSFYSRFPMIKIPQGYGLTETTAVGSHTVTEEEATHFGSVGLLAANTELKIVDVDSGKP  389

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP + GEIW RGP +M+GY+  P  T  TIDK+GW+HTGDLGY + +G LY+VDR+KEL
Sbjct  390  LPPCEKGEIWFRGPTIMKGYFGRPGETASTIDKEGWLHTGDLGYVDAEGFLYIVDRLKEL  449

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKG QVAPAELE +L+SHP I DA VIPY D EAG++P+A+VVR P S L E DV  F
Sbjct  450  IKYKGLQVAPAELEAVLLSHPGIVDAAVIPYADNEAGQIPMAFVVRGPQSVLREVDVIDF  509

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +A QVA YK++RKV F+  +PKSASGKILRREL+    +KL
Sbjct  510  VAKQVASYKKVRKVAFVGDIPKSASGKILRRELVSAAMSKL  550



>ref|XP_002970786.1| hypothetical protein SELMODRAFT_231716 [Selaginella moellendorffii]
 gb|EFJ28112.1| hypothetical protein SELMODRAFT_231716 [Selaginella moellendorffii]
Length=502

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 153/212 (72%), Gaps = 1/212 (0%)
 Frame = -3

Query  845  CAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPP  666
            C + F    V QGYG+TE+  +  + +      H GSAGLL S   A+++ V   + LPP
Sbjct  284  CLERFPDVKVRQGYGLTESTAIASVADPD-DLEHYGSAGLLSSNTLAKVIDVGSGRPLPP  342

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
             Q GEIW+ GP +M  Y  NP AT  T+D +GW+HTGDLGYF+  G LYVVDRIKELIKY
Sbjct  343  NQQGEIWIHGPTIMDEYLNNPNATAETVDAEGWLHTGDLGYFDDSGNLYVVDRIKELIKY  402

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
            KG+QVAPAELE LL+SH ++ DA VIP+PD EAG+VP+A +VR    SL  + V KF++ 
Sbjct  403  KGFQVAPAELEALLLSHSQVVDAAVIPFPDEEAGQVPLAVIVRKQGCSLDGQGVMKFVSD  462

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            QVAPYK++RKV FI+++PKSASGKILRREL++
Sbjct  463  QVAPYKKVRKVMFIDAIPKSASGKILRRELVQ  494



>gb|AGA17922.1| CCL5 [Humulus lupulus]
Length=551

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 161/216 (75%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            +N+   +++QGYG+TE+ G+    +     R  G+AG+L  ++EA+IV+ +  + L   +
Sbjct  336  ENYPTVSILQGYGLTESTGIGASTDCLQESRRYGTAGMLSPSMEAKIVNPETGEALSVNR  395

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+ N +AT  TID +GW+ TGDL Y ++DG ++VVDR+KELIKYKG
Sbjct  396  TGELWLRGPTIMKGYFSNEEATSSTIDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKG  455

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQVAPAELE LL+SHPEI DA VIPYPD EAG+ P+AYVVR   S+L+E  V  FIA  V
Sbjct  456  YQVAPAELEALLLSHPEISDAAVIPYPDKEAGQFPMAYVVRKGGSNLSESTVMDFIAKLV  515

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+RKV F+ S+PK+ SGKILR++LI+   +KL
Sbjct  516  APYKRIRKVAFVASIPKNPSGKILRKDLIKLATSKL  551



>ref|XP_006646571.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Oryza brachyantha]
Length=385

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 159/217 (73%), Gaps = 6/217 (3%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQ  678
            + A  F    ++QGYG+TE+ G V      +GP  S   GS G L S ++A+IV     +
Sbjct  163  QFAAVFPNVEIVQGYGLTESSGAVA---ATVGPEESKMYGSVGKLASHLQAKIVDPSTGE  219

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             L PGQ GE+WVRGP +M+GY  + +AT  T+D +GW+ TGDL YFN+DG LY+VDR+KE
Sbjct  220  ELGPGQRGELWVRGPIVMKGYVGDDEATAATVDSEGWLKTGDLCYFNEDGFLYIVDRLKE  279

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKGYQV PAELE +L SHPEI DA VIPYPD EAG++P+A++VR PNS++T+E V  
Sbjct  280  LIKYKGYQVPPAELEHILQSHPEIVDAAVIPYPDEEAGQLPMAFIVRQPNSNITKEQVMD  339

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            ++A  VAPYK++R+V F+ ++ KS +GKILRREL+++
Sbjct  340  YVAKHVAPYKKVRRVAFVPTITKSPAGKILRRELVQQ  376



>ref|XP_006372917.1| hypothetical protein POPTR_0017s06220g [Populus trichocarpa]
 gb|ERP50714.1| hypothetical protein POPTR_0017s06220g [Populus trichocarpa]
Length=552

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 154/213 (72%), Gaps = 0/213 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M   A  F    + QGYG+TE+ GV+   N+    RH GS G L +  EA+IV  D    
Sbjct  327  MKVFADRFPTVDLWQGYGLTESTGVLSRSNSPEESRHWGSVGRLTAGCEAKIVDADTGDA  386

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPG+ GE+WVRG  +M+GY  +P+AT  T+D  GW+ TGDL Y +++G L+VVDR+KEL
Sbjct  387  LPPGKQGELWVRGSTIMKGYVGDPEATSTTLDPDGWLRTGDLCYIDEEGFLFVVDRLKEL  446

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKGYQVAPAELE LL SHPEI DA VIPYPD EAG+VP+A+VV+ P S + E  V  F
Sbjct  447  IKYKGYQVAPAELEQLLQSHPEIADAAVIPYPDEEAGQVPMAFVVKQPQSRINEGGVMDF  506

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRREL  216
            +A QVAPYK++R+V F++++PKS +GKILR+EL
Sbjct  507  VAKQVAPYKKVRRVEFVSAIPKSPAGKILRKEL  539



>ref|XP_008777804.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
4 [Phoenix dactylifera]
Length=551

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 157/209 (75%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    ++    R  G+AGLL    EA+IV  D    LP  + GE+W+R
Sbjct  343  ILQGYGLTESTGIGASTDSAEESRRFGTAGLLSPNTEARIVDPDTGVSLPVKRTGELWIR  402

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP +M+GY+KNP+AT  T+D +GW+ TGD+ Y ++DG L+VVDR+KELIKYKGYQV PAE
Sbjct  403  GPYVMKGYFKNPEATSSTLDSEGWLRTGDICYIDEDGFLFVVDRLKELIKYKGYQVPPAE  462

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL+SHPEI DA VIP+PD E G+ P+AYVVR   S L+E  V +F+A QVAPYKR+R
Sbjct  463  LEALLLSHPEITDAAVIPFPDREVGQFPMAYVVRKAGSHLSETGVMEFVAKQVAPYKRIR  522

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV F++++PK+ SGKILR++LI+   +KL
Sbjct  523  KVAFVSAIPKNPSGKILRKDLIKLATSKL  551



>gb|AKA59704.1| phenylalanoyl CoA ligase [Taxus baccata]
Length=555

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            E    F    ++QGYG+TET  +    +T+   RH G+AG+L    +A+IV  D    LP
Sbjct  337  EFISRFPTIKLMQGYGLTETTAIGASTDTQEESRHYGTAGMLSPNTDAKIVDPDSGLALP  396

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            P   GE+W+RGP +M+GY+ NP+AT   +D+ GW+ TGDL Y + +G ++VVDR+KELIK
Sbjct  397  PNHRGELWLRGPTIMKGYFSNPEATSSAMDRSGWLRTGDLCYIDTEGYVFVVDRLKELIK  456

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YKGYQVAPAELE LL+SHPEI D  VIP+PD EAG+VP+AY+VR   S+L+E  V  F+A
Sbjct  457  YKGYQVAPAELEALLLSHPEIADVAVIPFPDKEAGQVPMAYIVRKQGSTLSEASVIGFVA  516

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
             QVAPYK++R+V F++ +PK+A GKILR++LI+   ++L
Sbjct  517  KQVAPYKKVRRVAFVSGIPKNAPGKILRKDLIKLSTSRL  555



>gb|KCW83189.1| hypothetical protein EUGRSUZ_B00139 [Eucalyptus grandis]
Length=382

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 6/212 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGP---RHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            + F    +IQGYG+TETCG        +GP    H GS G +   +EA+IV       LP
Sbjct  163  EKFPHVEIIQGYGLTETCGGA---TRTLGPDEASHHGSVGRIAENMEAKIVDPTTGDPLP  219

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PGQ GE+W+RGP +M+GY  + +AT  TID  GW+ TGDL Y +  G L++VDR+KELIK
Sbjct  220  PGQRGELWLRGPTIMKGYVGDDKATAETIDSNGWLRTGDLCYIDSKGFLFIVDRLKELIK  279

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YKGYQV PAELE LL S+P+I DA VIPYPD EAG++P+A+VVR P S++TE  V  FIA
Sbjct  280  YKGYQVPPAELEHLLHSNPDIADAAVIPYPDEEAGQIPMAFVVRKPGSNITESQVMDFIA  339

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
             QVAPYK++R+V FI+S+PKS +GKILRREL+
Sbjct  340  KQVAPYKKIRRVAFISSIPKSPAGKILRRELV  371



>ref|XP_009413046.1| PREDICTED: 4-coumarate--CoA ligase-like 4 [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 160/209 (77%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TET G+    ++    R  G+AG+L    EA+IV  D    LP  + GE+W+R
Sbjct  344  ILQGYGLTETTGIGASTDSAEESRRYGTAGMLSPNTEARIVDPDSGAALPVNRTGELWLR  403

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP +M+ Y+K P+AT+ T+ + GW+ TGDL Y ++DG L+VVDR+KELIKYKGYQVAPAE
Sbjct  404  GPYVMKEYFKKPEATRTTLVEDGWLRTGDLCYIDEDGYLFVVDRLKELIKYKGYQVAPAE  463

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HP+I DA VIPYPD EAG++P+AYVVR   S+L+EE+V KF+  QVAPYKR+R
Sbjct  464  LEALLLTHPDIADAAVIPYPDKEAGQIPMAYVVRKDGSNLSEEEVIKFVGRQVAPYKRIR  523

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV F++++PK+ SGKILR++L++   +KL
Sbjct  524  KVAFVSAIPKNPSGKILRKDLVKLATSKL  552



>gb|KCW65282.1| hypothetical protein EUGRSUZ_G02739 [Eucalyptus grandis]
Length=393

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = -3

Query  812  QGYGMTETCGVVCI----ENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIW  645
            QGYG+TETCG        E+ +    H GS G L+    A+IV ++    LPP + GE+W
Sbjct  182  QGYGLTETCGAASFFALDEDAK---AHPGSCGSLLPHFSAKIVDIETGSPLPPNKEGELW  238

Query  644  VRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAP  465
            +R P +M+GY +N +AT  T+D +GW+ TGDLGYF++DG LY+VDRIKELIK+ GYQVAP
Sbjct  239  LRSPTIMKGYLQNEEATTATLDPEGWLRTGDLGYFDEDGFLYIVDRIKELIKHNGYQVAP  298

Query  464  AELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKR  285
            AELE LL+SHP+I DA VIP  + EAG+VP+AYVV++  S+LTE  V +FIA QVAPYK+
Sbjct  299  AELEALLLSHPQIVDAAVIPLENEEAGQVPMAYVVKASGSALTENQVIRFIADQVAPYKK  358

Query  284  LRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +R+V FI+++PKSA+GKILR++LI + + +L
Sbjct  359  VRRVGFISTIPKSAAGKILRKQLISQTQQQL  389



>ref|XP_004985666.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like isoform X2 [Setaria 
italica]
Length=546

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 148/185 (80%), Gaps = 2/185 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIG-PRHSGSAGLLVSAVEAQIVSVDKLQ  678
            M   A+NF    + QGYGMTET G++ +E    G  R  GS G LVS VEA+IV ++ L+
Sbjct  325  MEVVARNFPGTVIAQGYGMTETSGIISLEYPENGQARQFGSTGSLVSGVEAKIVDIETLK  384

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             +PP QLGEI VRGPN+MQGY+ N QAT+ TI K+GW+HTGD+GYF++ G LYVVDR+KE
Sbjct  385  CMPPNQLGEICVRGPNIMQGYFNNVQATEFTI-KEGWLHTGDIGYFDEGGQLYVVDRLKE  443

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKG+Q+APAELEGLL+SHPEI DAVVIP+PDA+AGEVP+AYVVRSP SSLTE DV+K
Sbjct  444  LIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAKAGEVPIAYVVRSPVSSLTEVDVQK  503

Query  317  FIAGQ  303
            FI  Q
Sbjct  504  FIEKQ  508



>ref|XP_006852174.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Amborella trichopoda]
 gb|ERN13641.1| hypothetical protein AMTR_s00049p00100040 [Amborella trichopoda]
Length=537

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            AK F +  V QGYG+TE+ G      TR+  +  GSAG L + +EA+IV  +  + L PG
Sbjct  319  AKRFPKVEVKQGYGLTESTGTAT-RTTRLENKKHGSAGKLSANIEARIVDPETNKPLAPG  377

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
              GE+W+R P  M+GY  N +AT  T+D +GW+ TGDL Y + +G L+VVDR+KELIKYK
Sbjct  378  MRGELWLRSPTNMKGYVGNAEATAATLDHEGWLKTGDLCYIDDEGYLFVVDRLKELIKYK  437

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE LL+SHPEI DA VIPYPD EAG++P+A+VVR P SSL+E+ V +FIA Q
Sbjct  438  AYQVPPAELEHLLLSHPEIADAAVIPYPDEEAGQIPMAFVVRRPGSSLSEKQVMEFIAKQ  497

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRA  198
            VAPYK++RK++F+ S+PKS +GKILR++L+ + R+
Sbjct  498  VAPYKKIRKLSFVGSIPKSPAGKILRKDLVAQARS  532



>ref|XP_011034909.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Populus euphratica]
Length=554

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 157/210 (75%), Gaps = 0/210 (0%)
 Frame = -3

Query  821  TVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWV  642
            T++QGYG+TE+  +    +T    R  G+AGLL    EA+IV  +  + LP  Q GE+W+
Sbjct  345  TILQGYGLTESTAIGASTDTLEESRRYGTAGLLSPNTEAKIVDPESGKALPVNQTGELWL  404

Query  641  RGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPA  462
            R P++M+GY+ N +AT  TID +GW+ TGDL Y + DG ++VVDR+KELIKYKGYQV PA
Sbjct  405  RAPSVMKGYFGNAEATSSTIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPA  464

Query  461  ELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRL  282
            ELE LL++HPEI DA VIP+PD + G+ P+AYVVR   S+L+E+ V+ FIAGQVAPYKR+
Sbjct  465  ELEALLLAHPEISDAAVIPFPDKDVGQFPMAYVVRKAGSNLSEKAVQDFIAGQVAPYKRI  524

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAKL  192
            R+V FI ++PK+ SGKILR++LI+   +KL
Sbjct  525  RRVAFIAAIPKNPSGKILRKDLIKLATSKL  554



>ref|XP_011037054.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Populus euphratica]
 ref|XP_011037055.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Populus euphratica]
Length=546

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 152/213 (71%), Gaps = 0/213 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M   A  F    + QGYG+TE+ GV+   N+    RH GS G L +  EA+IV  D    
Sbjct  326  MKVFADRFPTVDLWQGYGLTESTGVLSRSNSPEESRHWGSVGRLTAGCEAKIVDADTGDA  385

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPPG+ GE+WVRG  +M+GY  +P AT  T+D  GW+ TGDL Y +++G L+VVDR+KEL
Sbjct  386  LPPGKQGELWVRGSTIMKGYVGDPAATSTTLDPDGWLRTGDLCYIDEEGFLFVVDRLKEL  445

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKF  315
            IKYKGYQVAPAELE LL SHPEI DA VIPYPD EAG+VP+A+VV+ P S + E  V  F
Sbjct  446  IKYKGYQVAPAELEQLLQSHPEIADAAVIPYPDEEAGQVPMAFVVKQPQSRINERGVMDF  505

Query  314  IAGQVAPYKRLRKVTFINSVPKSASGKILRREL  216
            +A QVAPYK++R+V F++ +PKS +GKILR+EL
Sbjct  506  VAKQVAPYKKVRRVEFVSVIPKSPAGKILRKEL  538



>emb|CBI15627.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCG-VVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPP  666
            +  F    ++QGYG+TE+ G    + +     RH GS G L+  +EA+IV     + LPP
Sbjct  305  SARFPNVQMVQGYGLTESGGGAAGMADLDEAKRH-GSVGRLMHDMEAKIVDPKTGEALPP  363

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
            GQ GE+W+RGP +M+GY  + +AT  T+D++GW+ TGDL YF+ DG L++VDR+KELIKY
Sbjct  364  GQQGELWLRGPTIMKGYVGDDEATAATLDQEGWLKTGDLCYFDSDGFLFIVDRLKELIKY  423

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
            K YQV PAELE LL S+PEI DA VIPYPD EAG++P+A+VVR P SS+TE  V +FIA 
Sbjct  424  KAYQVPPAELEHLLQSNPEIADAAVIPYPDEEAGQIPMAFVVRKPGSSITEAQVMEFIAK  483

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            QVAPYK++R+V F+NS+PKS +GKILRREL+    +K
Sbjct  484  QVAPYKKIRRVAFVNSIPKSPAGKILRRELVNHALSK  520



>ref|XP_009595630.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Nicotiana tomentosiformis]
Length=549

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 153/210 (73%), Gaps = 6/210 (3%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLPPG  663
            F    +IQGYG+TET G     +   GP  S   GSAG L   VEA+IV  D  + LPPG
Sbjct  332  FPNVMIIQGYGLTETTGGATGMS---GPEESDRYGSAGRLAVNVEAKIVDPDSGETLPPG  388

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP +M+GY  + QAT  T+D +GW+ TGDL YF+ DG LYVVDR+KELIKYK
Sbjct  389  QRGELWIRGPTIMKGYVGDEQATSATLDSEGWLKTGDLCYFDADGFLYVVDRLKELIKYK  448

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE LL S P++ DA VIPYPD EAG++P+AYVVR P S+++E  +   IA Q
Sbjct  449  AYQVPPAELEHLLQSIPDVADAAVIPYPDEEAGQIPMAYVVRRPGSTISESQIIDVIAKQ  508

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELI  213
            VAPYK++R+V FIN++PKS +GKILRREL+
Sbjct  509  VAPYKKIRRVAFINAIPKSPAGKILRRELV  538



>ref|XP_002893114.1| opc-8:0 CoA ligase1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69373.1| opc-8:0 CoA ligase1 [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+ G+    +T    R  G+AG L +++E +IV     Q L P 
Sbjct  328  AEKYPTVKILQGYGLTESTGIGASTDTVEESRRYGTAGKLSASMEGRIVDPVTGQILGPN  387

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W++GP++M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYK
Sbjct  388  QTGELWLKGPSIMKGYFSNEEATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYK  447

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQVAPAELE LL++HPEI DA VIP+PD E G+ P+AYVVR   SSL+E+ + +F+A Q
Sbjct  448  GYQVAPAELEALLLTHPEITDAAVIPFPDKEVGQFPMAYVVRKTGSSLSEKSIMEFVAKQ  507

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            VAPYKR+RKV F++S+PK+ SGKILR++LI+
Sbjct  508  VAPYKRIRKVAFVSSIPKNPSGKILRKDLIK  538



>ref|XP_003590732.1| 4-coumarate-coa ligase [Medicago truncatula]
 gb|AES60983.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=539

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 167/214 (78%), Gaps = 9/214 (4%)
 Frame = -3

Query  833  FXQATVIQGYGMTE-TCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLPP  666
            F  A++IQGYG+TE T GV+ I    +GP  +   G+ G LVS +EA+IV+ +  + + P
Sbjct  322  FPHASIIQGYGLTESTAGVIRI----VGPEEASRGGTTGKLVSGMEAKIVNPNTGEAMSP  377

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
            G+ GE+WVRGP +M+GY  +P AT +T+   GW+ TGD+ YF+ +G +YVVDR+KELIKY
Sbjct  378  GEQGELWVRGPPIMKGYVGDPVATSVTL-VDGWLRTGDICYFDNEGFVYVVDRLKELIKY  436

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
            KGYQVAPAELE LL SHPEI+DA VIPYPD +AG++P+A+V+R P+SS+ E ++  F+A 
Sbjct  437  KGYQVAPAELEQLLQSHPEIKDAAVIPYPDEDAGQIPLAFVIRQPHSSMGEAEIINFVAK  496

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELIEKV  204
            QVAPYK++R+V F+NS+PK+A+GKILR++L+ K+
Sbjct  497  QVAPYKKVRRVVFVNSIPKNATGKILRKDLLNKI  530



>ref|XP_002510640.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF52827.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=549

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+ G+    +T    R  G+AGLL  ++EA+IV  +  + L   
Sbjct  333  AEKYPTVRILQGYGLTESTGIGASTDTLEESRRYGTAGLLSPSMEAKIVEPENGKALTVN  392

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
              GE+W+RGP++M+GY+ N +AT  T+D +GW+ TGDL Y + DG ++VVDR+KELIKYK
Sbjct  393  HTGELWLRGPSIMKGYFSNAEATSSTLDSEGWLRTGDLCYIDDDGFVFVVDRLKELIKYK  452

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQV PAELE LL++H EI DA VIP+PD EAG+VP+AYVVR   S+L+E  V  F+A Q
Sbjct  453  GYQVPPAELEALLLTHAEISDAAVIPFPDKEAGQVPMAYVVRKAGSNLSESSVMDFVARQ  512

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            VAPYKR+R+VTFI ++PK+ SGKILR++LI+   +KL
Sbjct  513  VAPYKRIRRVTFIAAIPKNPSGKILRKDLIKLATSKL  549



>ref|XP_008787716.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Phoenix 
dactylifera]
Length=553

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 154/208 (74%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  NFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQL  657
             F    V+QGYG+TE+ G           +  GSAG L + +EA+IV     + LPPG+ 
Sbjct  335  RFPNIEVVQGYGLTESTGGASATMGSEESQKYGSAGRLSACLEAKIVDPTTGEALPPGRR  394

Query  656  GEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGY  477
            GE+W+RGP +M+GY  + +AT  T+D +GW+ TGDL YF++DG ++VVDR+KELIKYK Y
Sbjct  395  GELWLRGPIIMKGYIGDAEATASTLDSEGWLKTGDLCYFDQDGFIFVVDRLKELIKYKAY  454

Query  476  QVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVA  297
            QV PAELE LL SHPEI DA VIP PD EAG++P+A++VR P SSL+EE V  F+A QVA
Sbjct  455  QVPPAELEHLLQSHPEIADAAVIPLPDEEAGQIPMAFIVRQPGSSLSEEQVMNFVAKQVA  514

Query  296  PYKRLRKVTFINSVPKSASGKILRRELI  213
            PYK++R+V F++S+PKSA+GKILRRELI
Sbjct  515  PYKKVRRVAFVSSIPKSAAGKILRRELI  542



>ref|XP_010663724.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Vitis vinifera]
Length=550

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCG-VVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPP  666
            +  F    ++QGYG+TE+ G    + +     RH GS G L+  +EA+IV     + LPP
Sbjct  332  SARFPNVQMVQGYGLTESGGGAAGMADLDEAKRH-GSVGRLMHDMEAKIVDPKTGEALPP  390

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
            GQ GE+W+RGP +M+GY  + +AT  T+D++GW+ TGDL YF+ DG L++VDR+KELIKY
Sbjct  391  GQQGELWLRGPTIMKGYVGDDEATAATLDQEGWLKTGDLCYFDSDGFLFIVDRLKELIKY  450

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
            K YQV PAELE LL S+PEI DA VIPYPD EAG++P+A+VVR P SS+TE  V +FIA 
Sbjct  451  KAYQVPPAELEHLLQSNPEIADAAVIPYPDEEAGQIPMAFVVRKPGSSITEAQVMEFIAK  510

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            QVAPYK++R+V F+NS+PKS +GKILRREL+    +K
Sbjct  511  QVAPYKKIRRVAFVNSIPKSPAGKILRRELVNHALSK  547



>emb|CAN74074.1| hypothetical protein VITISV_000975 [Vitis vinifera]
Length=546

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+ G+    ++    R  G+AGLL  ++EA+IV     + L   
Sbjct  330  AEKYPSVKILQGYGLTESTGIGASTDSLEESRRYGTAGLLSPSMEAKIVDPGSGKALTVN  389

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP +M+GY+ NP+AT  T+D  GW+ TGDL Y + DG +++VDR+KELIKYK
Sbjct  390  QTGELWLRGPTIMKGYFSNPEATTSTLDSSGWLRTGDLCYIDDDGFIFIVDRLKELIKYK  449

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQV PAELE LL++HPEI DA VIP+PD E G+ P+AY+ R   S+L+E  V  FIA Q
Sbjct  450  GYQVPPAELEALLLTHPEIADAAVIPFPDKEVGQYPMAYINRKAGSNLSESAVMDFIAKQ  509

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            VAPYKR+R+V F++S+PK+ASGKILR++LI+   +KL
Sbjct  510  VAPYKRIRRVAFVDSIPKNASGKILRKDLIQLATSKL  546



>ref|XP_009790448.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Nicotiana sylvestris]
Length=549

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 152/210 (72%), Gaps = 6/210 (3%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLPPG  663
            F    +IQGYG+TET G     +   GP  S   GSAG L    EA+IV  D  + LPPG
Sbjct  332  FPNVMIIQGYGLTETTGGATGMS---GPEESDRYGSAGRLAVNAEAKIVDPDSGETLPPG  388

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP +M+GY  + QAT  T+D +GW+ TGDL YF+ DG LYVVDR+KELIKYK
Sbjct  389  QRGELWIRGPTIMKGYVGDKQATSATLDSEGWLKTGDLCYFDADGFLYVVDRLKELIKYK  448

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE LL S P++ DA VIPYPD EAGE+P+AY+VR P S+++E  +   IA Q
Sbjct  449  AYQVPPAELEHLLQSIPDVADAAVIPYPDEEAGEIPMAYIVRRPGSTISESQIIDAIAKQ  508

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELI  213
            VAPYK++R+V FIN++PKS +GKILRREL+
Sbjct  509  VAPYKKIRRVAFINAIPKSPAGKILRRELV  538



>ref|NP_564115.1| OPC-8:0 CoA ligase1 [Arabidopsis thaliana]
 sp|Q84P21.2|4CLL5_ARATH RecName: Full=4-coumarate--CoA ligase-like 5; AltName: Full=4-coumarate--CoA 
ligase isoform 9; Short=At4CL9; AltName: Full=Peroxisomal 
OPC-8:0-CoA ligase 1 [Arabidopsis thaliana]
 gb|AAK25960.1|AF360250_1 unknown protein [Arabidopsis thaliana]
 gb|AAK64105.1| unknown protein [Arabidopsis thaliana]
 gb|ABJ98946.1| peroxisomal OPC-8:0 CoA ligase [Arabidopsis thaliana]
 gb|AEE29980.1| OPC-8:0 CoA ligase1 [Arabidopsis thaliana]
Length=546

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+ G+    +T    R  G+AG L +++E +IV     Q L P 
Sbjct  328  AEKYPTVKILQGYGLTESTGIGASTDTVEESRRYGTAGKLSASMEGRIVDPVTGQILGPK  387

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W++GP++M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYK
Sbjct  388  QTGELWLKGPSIMKGYFSNEEATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYK  447

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQVAPAELE LL++HPEI DA VIP+PD E G+ P+AYVVR   SSL+E+ + +F+A Q
Sbjct  448  GYQVAPAELEALLLTHPEITDAAVIPFPDKEVGQFPMAYVVRKTGSSLSEKTIMEFVAKQ  507

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            VAPYKR+RKV F++S+PK+ SGKILR++LI+
Sbjct  508  VAPYKRIRKVAFVSSIPKNPSGKILRKDLIK  538



>ref|XP_010045504.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Eucalyptus grandis]
Length=470

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 6/212 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGP---RHSGSAGLLVSAVEAQIVSVDKLQHLP  669
            + F    +IQGYG+TETCG        +GP    H GS G +   +EA+IV       LP
Sbjct  251  EKFPHVEIIQGYGLTETCGGA---TRTLGPDEASHHGSVGRIAENMEAKIVDPTTGDPLP  307

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PGQ GE+W+RGP +M+GY  + +AT  TID  GW+ TGDL Y +  G L++VDR+KELIK
Sbjct  308  PGQRGELWLRGPTIMKGYVGDDKATAETIDSNGWLRTGDLCYIDSKGFLFIVDRLKELIK  367

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YKGYQV PAELE LL S+P+I DA VIPYPD EAG++P+A+VVR P S++TE  V  FIA
Sbjct  368  YKGYQVPPAELEHLLHSNPDIADAAVIPYPDEEAGQIPMAFVVRKPGSNITESQVMDFIA  427

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
             QVAPYK++R+V FI+S+PKS +GKILRREL+
Sbjct  428  KQVAPYKKIRRVAFISSIPKSPAGKILRRELV  459



>gb|AAP03021.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
Length=546

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+ G+    +T    R  G+AG L +++E +IV     Q L P 
Sbjct  328  AEKYPTVKILQGYGLTESTGIGASTDTVEESRRYGTAGKLSASMEGRIVDPVTGQILGPK  387

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W++GP++M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYK
Sbjct  388  QTGELWLKGPSIMKGYFSNEEATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYK  447

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQVAPAELE LL++HPEI DA VIP+PD E G+ P+AYVVR   SSL+E+ + +F+A Q
Sbjct  448  GYQVAPAELEALLLTHPEITDAAVIPFPDKEVGQFPMAYVVRKTGSSLSEKTIMEFVAKQ  507

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            VAPYKR+RKV F++S+PK+ SGKILR++LI+
Sbjct  508  VAPYKRIRKVAFVSSIPKNPSGKILRKDLIK  538



>ref|XP_012073683.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Jatropha curcas]
 gb|KDP36837.1| hypothetical protein JCGZ_08128 [Jatropha curcas]
Length=550

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+  +    +T    R  G+AGLL  ++EA+IV  +  + LP  
Sbjct  334  AEKYPTVRILQGYGLTESTAIGASTDTPEESRRYGTAGLLSPSMEAKIVDPESGKPLPVN  393

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP++M+GY+ N +AT  T+D +GW+ TGDL Y + DG ++VVDR+KELIKYK
Sbjct  394  QTGELWLRGPSIMKGYFGNVEATSSTLDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYK  453

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQV PAELE LL++H +I DA VIP PD EAG++P+AYVVR   SSL+E  V  F+A Q
Sbjct  454  GYQVPPAELEALLLTHVDISDAAVIPLPDKEAGQIPMAYVVRKAGSSLSETAVMDFVARQ  513

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            VAPYKR+R+V FI+++PK+ASGKILR++LI+   +KL
Sbjct  514  VAPYKRIRRVAFISAIPKNASGKILRKDLIQLATSKL  550



>gb|AGW27194.1| 4-coumarate:coenzyme A ligase 4 [Salvia miltiorrhiza]
Length=552

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 160/209 (77%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            V+QGYG+TE+ G+    +++      G+AGLL  ++EA+IV+ +    LP  + GE+W+R
Sbjct  344  VLQGYGLTESTGIGASTDSQEESSRYGTAGLLSPSMEAKIVNPETGAPLPVNRTGELWLR  403

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP++M+GY+ N +AT  T+D QGW+ TGDL Y ++DG ++VVDR+KELIKYKGYQV PAE
Sbjct  404  GPSIMKGYFSNEEATASTLDSQGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAE  463

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HP+I D+ VIP+PD EAG++P+AYVVR   S++TE  V  FIA QVAPYKR+R
Sbjct  464  LEALLLTHPQIDDSAVIPFPDKEAGQIPMAYVVRKKGSTITESQVMDFIAQQVAPYKRIR  523

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            +V F+ SVPK+ SGKILR++LI+   +K+
Sbjct  524  RVAFVASVPKNPSGKILRKDLIKLAVSKI  552



>gb|KHG05050.1| 4-coumarate--CoA ligase-like 5 [Gossypium arboreum]
Length=549

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 157/209 (75%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    ++    R  G+AG+L  ++EA++V  D  + L   Q GE+W+R
Sbjct  341  ILQGYGLTESTGIGASTDSLEESRKYGTAGMLSPSMEAKVVDPDSGKALNVNQTGELWLR  400

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP++M+GY+ NP+AT  T+D  GW+ TGDL Y ++DG +++VDR+KELIK+KGYQV PAE
Sbjct  401  GPSVMKGYFSNPEATTSTLDSDGWLRTGDLCYIDEDGFIFIVDRLKELIKFKGYQVPPAE  460

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL+SHP+I DA VIP+PD E G+ P+AYVVR P S+L+E  V  F+  QVAPYKR+R
Sbjct  461  LEALLLSHPDILDAAVIPFPDREVGQFPMAYVVRKPGSNLSETGVMDFVGRQVAPYKRIR  520

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV F+ S+PK+ SGKILR++LI+   +KL
Sbjct  521  KVAFVASIPKNPSGKILRKDLIKLATSKL  549



>gb|AIS92507.1| 4-coumarate:CoA ligase 3 [Epimedium sagittatum]
Length=550

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 162/209 (78%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TET GV    ++ +  R  G+AGL+  ++EA++V     + L   + GE+W+R
Sbjct  342  ILQGYGLTETAGVGASTDSLVESRRYGTAGLMSPSMEAKVVDPVTGEALGVNRTGELWLR  401

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP++M+GY+ NP+AT  T+D +GW+ TGDL YF++DG ++VVDR+KELIKYKGYQVAPAE
Sbjct  402  GPSVMKGYFSNPEATTSTLDSEGWLRTGDLCYFDEDGYIFVVDRLKELIKYKGYQVAPAE  461

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++H E+ DA VIP+PD + G+ P+AYVVR   S+L+E  V +FIA QVAPYKR+R
Sbjct  462  LEALLLTHSEVTDAAVIPFPDKDVGQFPMAYVVRKAGSNLSETAVMEFIAKQVAPYKRIR  521

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            +V+F++++PK+ SGKILR++LI+   +K+
Sbjct  522  RVSFVSAIPKNPSGKILRKDLIKLATSKI  550



>ref|XP_010905239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
4 [Elaeis guineensis]
Length=551

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 156/209 (75%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    ++    R  G+AGLL    EA+IV  D    LP  + GE+W+R
Sbjct  343  ILQGYGLTESTGIGASTDSAEESRRYGTAGLLSPNTEARIVDPDTGVSLPVNRTGELWIR  402

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP +M+GY+KNPQAT  T+D +GW+ TGD+ Y ++DG L+VVDR+KELIKYKGYQV PAE
Sbjct  403  GPYVMKGYFKNPQATSSTLDSEGWLRTGDICYVDEDGYLFVVDRLKELIKYKGYQVPPAE  462

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HPEI DA VIP+PD   G+ P+AY+VR   S L+E  V +F+A QVAPYKR+R
Sbjct  463  LEALLLTHPEIADAAVIPFPDRAVGQYPMAYIVRKAGSRLSETGVMEFVAKQVAPYKRIR  522

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV F++++PK+ SGKILR++LI+   +KL
Sbjct  523  KVAFVSAIPKNPSGKILRKDLIKLATSKL  551



>ref|XP_007017972.1| OPC-8:0 CoA ligase1 isoform 1 [Theobroma cacao]
 gb|EOY15197.1| OPC-8:0 CoA ligase1 isoform 1 [Theobroma cacao]
Length=549

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 157/209 (75%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    ++    R  G+AG+L  ++EA+IV  D  + L   Q GE+W+R
Sbjct  341  ILQGYGLTESTGIGASTDSLEESRKYGTAGMLSPSMEAKIVDPDSGKALTVNQTGELWLR  400

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP++M+GY+ NP+AT  T+D +GW+ TGD+ Y + DG ++VVDR+KELIKYKGYQV PAE
Sbjct  401  GPSIMKGYFSNPEATASTLDSEGWLKTGDICYIDDDGFIFVVDRLKELIKYKGYQVPPAE  460

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HPEI DA VIP+PD E G+ P+AYVVR    +L+E  V  F+A QVAPYKR+R
Sbjct  461  LEALLLTHPEIFDAAVIPFPDKEVGQFPMAYVVRKTGCNLSETAVMDFVARQVAPYKRIR  520

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV F++S+PK+ SGKILR++LI+   +KL
Sbjct  521  KVAFVSSIPKNPSGKILRKDLIKLATSKL  549



>ref|XP_010068871.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Eucalyptus grandis]
 gb|KCW65469.1| hypothetical protein EUGRSUZ_G02879 [Eucalyptus grandis]
Length=568

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 157/211 (74%), Gaps = 7/211 (3%)
 Frame = -3

Query  812  QGYGMTETCGVVCI----ENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIW  645
            QGYG+TETCG        E+ +    HSGS G L+    A+IV +     LPP + GE+W
Sbjct  357  QGYGLTETCGAASFFALDEDAK---AHSGSCGSLLPHFSAKIVDIKTGSPLPPNKEGELW  413

Query  644  VRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAP  465
            +R P +M+GY +N +AT  T+D +GW+ TGDLGYF++DG LY+VDRIKELIK+ GYQVAP
Sbjct  414  LRSPTIMKGYLRNEEATTATLDPEGWLRTGDLGYFDEDGFLYIVDRIKELIKHNGYQVAP  473

Query  464  AELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKR  285
            AELE LL+SHP+I DA VIP  + EAG+VP+AYVV++  S LTE  V +FIA QVAPYK+
Sbjct  474  AELEALLLSHPQIVDAAVIPLENEEAGQVPMAYVVKASGSELTENQVIRFIADQVAPYKK  533

Query  284  LRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +R+V FI+++PKSA+GKILR++LI + + +L
Sbjct  534  VRRVGFISTIPKSAAGKILRKQLISQTQQQL  564



>ref|XP_010068841.1| PREDICTED: 4-coumarate--CoA ligase-like 5, partial [Eucalyptus 
grandis]
Length=517

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = -3

Query  812  QGYGMTETCGVVCI----ENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIW  645
            QGYG+TETCG        E+ +    H GS G L+    A+IV ++    LPP + GE+W
Sbjct  306  QGYGLTETCGAASFFALDEDAK---AHPGSCGSLLPHFSAKIVDIETGSPLPPNKEGELW  362

Query  644  VRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAP  465
            +R P +M+GY +N +AT  T+D +GW+ TGDLGYF++DG LY+VDRIKELIK+ GYQVAP
Sbjct  363  LRSPTIMKGYLQNEEATTATLDPEGWLRTGDLGYFDEDGFLYIVDRIKELIKHNGYQVAP  422

Query  464  AELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKR  285
            AELE LL+SHP+I DA VIP  + EAG+VP+AYVV++  S+LTE  V +FIA QVAPYK+
Sbjct  423  AELEALLLSHPQIVDAAVIPLENEEAGQVPMAYVVKASGSALTENQVIRFIADQVAPYKK  482

Query  284  LRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +R+V FI+++PKSA+GKILR++LI + + +L
Sbjct  483  VRRVGFISTIPKSAAGKILRKQLISQTQQQL  513



>ref|XP_006473755.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Citrus sinensis]
 gb|KDO85040.1| hypothetical protein CISIN_1g008946mg [Citrus sinensis]
Length=548

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 161/216 (75%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + + +  ++QGYG+TE+ G+    ++    R  G+AG+L  ++EA+IV  D  + L   Q
Sbjct  333  QKYPKVRILQGYGLTESTGIGASTDSLEESRKYGTAGMLSPSMEAKIVDPDSGKALLVNQ  392

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W++GP++M+GY+ NP+AT  T+D +GW+ TGDL Y + DG +++VDR+KELIKYKG
Sbjct  393  TGELWLKGPSIMKGYFSNPEATTSTLDSEGWLRTGDLCYIDDDGFIFIVDRLKELIKYKG  452

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP+I DA V+P+PD EAG+ P+AYVVR   S L+E +V  F+A QV
Sbjct  453  YQVPPAELEALLLTHPKISDAAVVPFPDKEAGQYPMAYVVREAGSRLSENEVMDFVARQV  512

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+R+V F+ S+PK+ SGKILR++LI+   +KL
Sbjct  513  APYKRVRRVAFVASIPKNPSGKILRKDLIKLATSKL  548



>ref|XP_004297550.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Fragaria vesca subsp. 
vesca]
Length=552

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 151/209 (72%), Gaps = 0/209 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            K F    ++QGYG+TE+ G           +   S G L   +EA+IV  D  + LPPGQ
Sbjct  333  KRFPNVEIVQGYGLTESGGGATRMADPEEAKQYASVGRLAENLEAKIVDPDTGEALPPGQ  392

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY  + +AT  T+DK GW+ TGDL YF+ +G LY+VDR+KELIKYK 
Sbjct  393  RGELWLRGPTIMKGYVGDDKATAETLDKDGWLKTGDLCYFDNEGFLYIVDRLKELIKYKA  452

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE +L SHP+I DA VIPYPD EAG++P+AYVVR P S++TE  V  F+A QV
Sbjct  453  YQVPPAELEHILNSHPDIADAAVIPYPDEEAGQIPMAYVVRKPGSNITEAIVTDFVAKQV  512

Query  299  APYKRLRKVTFINSVPKSASGKILRRELI  213
            APYK++R V+FINS+PKS +GKILRREL+
Sbjct  513  APYKKIRHVSFINSIPKSPAGKILRRELV  541



>gb|KEH40252.1| acyl:CoA ligase [Medicago truncatula]
Length=560

 Score =   248 bits (633),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +   ++ QGYG+TE+ G+     +    R  G+AGL+ ++ EA IV  +  Q LP  +
Sbjct  345  EKYPNVSIFQGYGLTESSGIGASTESLEESRKYGTAGLVSASTEAMIVDTETAQPLPVNR  404

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP  M+GY+ N +AT+ TI  +GW+ TGD+ Y + DG L+VVDR+KELIKYKG
Sbjct  405  TGELWLRGPTTMKGYFSNEEATRSTITPEGWLKTGDVCYIDSDGFLFVVDRLKELIKYKG  464

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP I DA VIPYPD EAG+VP+AYVVR+  S+L+   V  F+A QV
Sbjct  465  YQVPPAELEALLLTHPAILDAAVIPYPDKEAGQVPMAYVVRNVGSNLSGSQVMDFVAEQV  524

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+RKV FI+S+PK+ SGKILR++LI+   +KL
Sbjct  525  APYKRIRKVAFISSIPKNPSGKILRKDLIKLATSKL  560



>ref|XP_006303947.1| hypothetical protein CARUB_v10008763mg [Capsella rubella]
 gb|EOA36845.1| hypothetical protein CARUB_v10008763mg [Capsella rubella]
Length=549

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 160/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+ G+    +T    R  G+AG L +++E +IV     Q L P 
Sbjct  331  AEKYSTVKIMQGYGLTESTGIGASTDTVEESRRYGTAGKLSASMEGRIVDPVTGQILGPN  390

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W++GP++M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYK
Sbjct  391  QTGELWLKGPSIMKGYFSNEEATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYK  450

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQVAPAELE LL++HPEI DA  IP+PD   G+ P+AYVVR+  SSL+E+ + +F+A Q
Sbjct  451  GYQVAPAELEALLLTHPEITDAACIPFPDKAVGQFPMAYVVRNTGSSLSEKSIMEFVAKQ  510

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            VAPYKR+RKV F+ S+PK+ SGKILR++LI+   +K
Sbjct  511  VAPYKRIRKVVFVTSIPKNPSGKILRKDLIKLATSK  546



>ref|XP_002456793.1| hypothetical protein SORBIDRAFT_03g042910 [Sorghum bicolor]
 gb|EES01913.1| hypothetical protein SORBIDRAFT_03g042910 [Sorghum bicolor]
Length=555

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 160/215 (74%), Gaps = 6/215 (3%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGP---RHSGSAGLLVSAVEAQIVSVDKLQHL  672
            A  F    ++QGYG+TE+ G V    + +GP   +  GS G L S +EA+IV     + L
Sbjct  335  AAIFPNIELVQGYGLTESSGSVA---STVGPDECKAYGSVGKLASHLEAKIVDPSTGEAL  391

Query  671  PPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELI  492
             PGQ GE+WVRGP +M+GY  + +AT  T+D +GW+ TGDL YFN+DG LY+VDR+KELI
Sbjct  392  GPGQRGELWVRGPVVMKGYVGDDEATAATVDSEGWLKTGDLCYFNEDGFLYIVDRLKELI  451

Query  491  KYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFI  312
            KYKGYQV PAELE +L SHP+I DA VIPYPD + G++P+A++VR P S+LT++ V  F+
Sbjct  452  KYKGYQVPPAELEHILNSHPDIMDAAVIPYPDEDVGQLPMAFIVRKPGSNLTKQQVMDFV  511

Query  311  AGQVAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            A QVAPYK++R+V F++++PKS +GKILRREL+E+
Sbjct  512  AKQVAPYKKVRRVAFVSAIPKSPAGKILRRELVEQ  546



>ref|XP_008356586.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Malus domestica]
Length=291

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 155/210 (74%), Gaps = 2/210 (1%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTET-CGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            + F    ++QGYG+TET  G   + ++     H+ S G L   +EA+IV  +  + LPPG
Sbjct  72   ERFPTVEIVQGYGLTETGXGATRMIBSEETKSHA-SVGRLSENMEAKIVDPETGEALPPG  130

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            + GE+W+RGP++M+GY  + +AT  T DK GW+ TGDL YF+ +G LY+VDR+KELIKYK
Sbjct  131  KRGELWLRGPSVMKGYVGDXKATAETXDKDGWLKTGDLCYFDDEGFLYIVDRLKELIKYK  190

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE +L+ HP+I DA VIPYPD +AGE+P+AYVVR P S++TE  V  F+A Q
Sbjct  191  AYQVPPAELEHILLXHPDIADAAVIPYPDEDAGEIPMAYVVRKPGSNITEVLVMDFVAKQ  250

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELI  213
            V+PYK++R+V FINS+PKS +GKILRREL+
Sbjct  251  VSPYKKIRRVAFINSIPKSXAGKILRRELV  280



>gb|EMT09525.1| 4-coumarate--CoA ligase-like protein 5 [Aegilops tauschii]
Length=291

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 156/212 (74%), Gaps = 6/212 (3%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLPPG  663
            F    ++QGYG+TE+ G V    + +GP  S   GS G L S ++A+IV     + L PG
Sbjct  74   FPNVQIVQGYGLTESSGSVA---STVGPEESKAYGSVGKLASHLQAKIVDPSTGEALGPG  130

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+WVRGP +M+GY  + +AT  T+D +GW+ TGDL YFN+DG LY+VDR+KELIKYK
Sbjct  131  QRGELWVRGPLVMKGYVGDDKATAETVDSEGWLKTGDLCYFNEDGFLYIVDRLKELIKYK  190

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQV PAELE +L SHPEI DA VI YPD +AG++P+A++VR P S+LT + V  ++A  
Sbjct  191  GYQVPPAELEHILQSHPEIADAAVIGYPDEDAGQLPMAFIVRQPGSNLTGQQVMDYVAKH  250

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            VAPYK++R+V F+N++ KS +GKILRREL+++
Sbjct  251  VAPYKKVRRVAFVNAITKSPAGKILRRELVQQ  282



>ref|XP_002285920.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Vitis vinifera]
Length=549

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A+ +    ++QGYG+TE+ G+    ++    R  G+AGLL  ++EA+IV     + L   
Sbjct  333  AEKYPSVKILQGYGLTESTGIGASTDSLEESRRYGTAGLLSPSMEAKIVDPGSGKALTVN  392

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP +M+GY+ NP+ T  T+D  GW+ TGDL Y + DG +++VDR+KELIKYK
Sbjct  393  QTGELWLRGPTIMKGYFSNPEVTTSTLDSSGWLRTGDLCYIDDDGFIFIVDRLKELIKYK  452

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQV PAELE LL++HPEI DA VIP+PD E G+ P+AY+ R   S+L+E  V  FIA Q
Sbjct  453  GYQVPPAELEALLLTHPEIADAAVIPFPDKEVGQYPMAYINRKAGSNLSESAVMDFIAKQ  512

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            VAPYKR+R+V F++S+PK+ASGKILR++LI+   +KL
Sbjct  513  VAPYKRIRRVAFVDSIPKNASGKILRKDLIQLATSKL  549



>gb|ERM96395.1| hypothetical protein AMTR_s00001p00239750 [Amborella trichopoda]
Length=544

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 160/211 (76%), Gaps = 2/211 (1%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGV-VCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            + F    + QGYGMTET G+    E    G R+ GSAGLL+  +EA+IV  +  + +PP 
Sbjct  324  RRFPGVVLTQGYGMTETAGIGASTETPEEGKRY-GSAGLLIPDMEAKIVDPETGESMPPN  382

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            + GE+W+RGP++M+GY+ N +AT  T++ +GW+ TGDL YF++DG L+VVDR+KELIKYK
Sbjct  383  RRGELWLRGPSVMKGYFSNAEATAGTLNSEGWLRTGDLCYFDEDGFLFVVDRLKELIKYK  442

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQVAPAELE LL++HP ++DA V+P+PD EAG++PVA+VV+   S L+   +  F+A +
Sbjct  443  GYQVAPAELEALLLTHPNVEDAAVVPFPDKEAGQIPVAFVVKKVESHLSNATLLSFVADR  502

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            VAPYK++R+V F+ S+PK++SGKILR++LI 
Sbjct  503  VAPYKKIRRVMFVRSIPKTSSGKILRKDLIN  533



>gb|KJB20367.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=446

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M ECAK F QA V+QGYGMTETC ++ +EN   G RH+GSAGLL   +EAQIVS +  + 
Sbjct  297  MEECAKKFPQAVVMQGYGMTETCAIISMENLAFGVRHTGSAGLLAPGIEAQIVSTENPKP  356

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP QLGEIWVRGPNMMQGY+ NP+ATK TID++GWVHTGDLGYFN++G LYVVDRIKEL
Sbjct  357  LPPKQLGEIWVRGPNMMQGYFNNPEATKQTIDEKGWVHTGDLGYFNENGYLYVVDRIKEL  416

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIP  405
            IKYKG+Q+APAELEGLLVSHPEI DAV IP
Sbjct  417  IKYKGFQIAPAELEGLLVSHPEIVDAVTIP  446



>ref|XP_008452936.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Cucumis melo]
Length=550

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + F    ++QGYG+TE+ G+    ++    R  G+AGLL  + E  IV  +  + LP  +
Sbjct  335  EKFPHVAILQGYGLTESTGIGASTDSLEESRRYGTAGLLSPSTEGMIVDPETGEALPVNR  394

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYKG
Sbjct  395  TGELWLRGPTVMKGYFGNVEATNSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKG  454

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP I DA VIPYPD + G+ P+AYVVR   S L+ +D+ +F+A QV
Sbjct  455  YQVPPAELEALLLTHPNISDAAVIPYPDKDVGQFPMAYVVRKAGSDLSHDDIMQFVAKQV  514

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+R+V F++S+PK+ SGKILR++LI+   +KL
Sbjct  515  APYKRIRRVAFVDSIPKNPSGKILRKDLIKLATSKL  550



>ref|XP_006435318.1| hypothetical protein CICLE_v10000764mg [Citrus clementina]
 gb|ESR48558.1| hypothetical protein CICLE_v10000764mg [Citrus clementina]
Length=548

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 161/216 (75%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + + +  ++QGYG+TE+ G+    ++    R  G+AG+L  ++EA+IV  D  + L   Q
Sbjct  333  QKYPKVRILQGYGLTESTGIGASTDSLEESRKYGTAGMLSPSMEAKIVDPDSGKALLVNQ  392

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W++GP++M+GY+ NP+AT  T+D +GW+ TGDL Y + DG +++VDR+KELIKYKG
Sbjct  393  TGELWLKGPSIMKGYFSNPEATTSTLDSEGWLRTGDLCYIDDDGFIFIVDRLKELIKYKG  452

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP++ DA V+P+PD EAG+ P+AYVVR   S L+E +V  F+A QV
Sbjct  453  YQVPPAELEALLLTHPKVSDAAVVPFPDKEAGQYPMAYVVREAGSRLSENEVMDFVARQV  512

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+R+V F+ S+PK+ SGKILR++LI+   +KL
Sbjct  513  APYKRVRRVAFVASIPKNPSGKILRKDLIKLATSKL  548



>ref|XP_009334310.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Pyrus x bretschneideri]
Length=578

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 158/210 (75%), Gaps = 0/210 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +   T++QGYG+TE+ G+    ++    R  G+AG+L +++EA IV  D    L   +
Sbjct  359  EKYPMVTILQGYGLTESTGIGASTDSLEESRKYGTAGMLSASMEAMIVDPDSGHPLAANK  418

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W++GP +M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYKG
Sbjct  419  TGELWLKGPTIMKGYFSNAEATASTLDSKGWLRTGDLCYIDEDGFIFVVDRLKELIKYKG  478

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HPEI DA VIP+PD + G+ P+AYVVR+  SSLTE  V +F+A QV
Sbjct  479  YQVPPAELEALLLTHPEIADAAVIPFPDEKVGQYPLAYVVRNAGSSLTESGVMEFVAKQV  538

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIE  210
            APYKR+R+V FI+SVPK+ SGKILR++LI+
Sbjct  539  APYKRIRRVAFIDSVPKNPSGKILRKDLIQ  568



>gb|EMT20288.1| 4-coumarate--CoA ligase-like protein 6 [Aegilops tauschii]
Length=227

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 157/217 (72%), Gaps = 6/217 (3%)
 Frame = -3

Query  848  ECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQ  678
            E  + F    ++QGYG+TE+ G V      + P  S   GSAG L S ++A+IV     +
Sbjct  5    EEVRLFPSVQIVQGYGLTESSGAVA---GTVRPEESMKYGSAGKLGSRLQAKIVDPTTGE  61

Query  677  HLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKE  498
             L PGQ GE+W+RGP +M+GY  + +AT  T+D QGW+ TGDL YFN+DG LY+VDR+KE
Sbjct  62   ALGPGQRGELWIRGPLVMKGYVGDDKATAETVDSQGWLKTGDLCYFNEDGFLYIVDRLKE  121

Query  497  LIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKK  318
            LIKYKGYQV PAELE +L SHP I DA VI YPD +AG++P+A++VR P S+LT + V  
Sbjct  122  LIKYKGYQVPPAELEHILQSHPGIADAAVIGYPDEDAGQLPMAFIVRQPGSNLTRQQVID  181

Query  317  FIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            ++A  VAPYK++R+V F+N++PKS +GKILRREL+++
Sbjct  182  YVAKHVAPYKKVRRVAFVNAIPKSPAGKILRRELVQQ  218



>ref|XP_003564855.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Brachypodium distachyon]
Length=554

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 159/215 (74%), Gaps = 6/215 (3%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHL  672
            A  F    ++QGYG+TE+ G V    + +GP  S   GS G L S ++A+IV     + +
Sbjct  334  AAVFPDVQIVQGYGLTESSGSVA---STVGPEESMAYGSVGKLASHLQAKIVDPSTGEAV  390

Query  671  PPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELI  492
             PGQ GE+W+RGP +M+GY  + +AT  T+D +GW+ TGDL YFN+DG LY+VDR+KELI
Sbjct  391  GPGQRGELWIRGPVVMKGYVGDDKATAETVDSEGWLKTGDLCYFNEDGFLYIVDRLKELI  450

Query  491  KYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFI  312
            KYKGYQV PAELE +L SHP I DA VIPYPD + G++P+A++VR P S+LTE+ V  ++
Sbjct  451  KYKGYQVPPAELEHILQSHPGIADAAVIPYPDEDVGQLPMAFIVRQPGSNLTEQQVMDYV  510

Query  311  AGQVAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            A QVAPYK++R+VTF+ S+PKS +GKILRREL+++
Sbjct  511  AKQVAPYKKVRRVTFVTSIPKSPAGKILRRELVQQ  545



>ref|XP_010536451.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Tarenaya hassleriana]
Length=548

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 160/209 (77%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+  +    +T    R  G+AGLL  ++EA+IV     + L   Q GE+W++
Sbjct  340  ILQGYGLTESTAIGASTDTLDESRRYGTAGLLSPSMEAKIVDPGSGRVLGLNQTGELWLK  399

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP++M+GY++N +AT  T+D +GW+ TGDL YF++DG ++VVDR+KELIKYKGYQV PAE
Sbjct  400  GPSIMKGYFRNEEATSSTLDSEGWLRTGDLCYFDEDGFIFVVDRLKELIKYKGYQVPPAE  459

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HPEI DA VIP+PD E G+ P+AYVVR P S+L+  ++ +F++ QVAPYKR+R
Sbjct  460  LEALLLTHPEIVDAAVIPFPDEEVGQFPMAYVVRKPGSNLSGNNLMEFVSKQVAPYKRIR  519

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV F++SVPK+ SGKILR++LI+   +KL
Sbjct  520  KVAFVSSVPKNPSGKILRKDLIKLATSKL  548



>gb|KFK44163.1| hypothetical protein AALP_AA1G223000 [Arabis alpina]
Length=540

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 159/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +    ++QGY +TE+ G     +T    R  GSAGLL S +EA+IV  D  +     Q
Sbjct  325  EKYPTVAILQGYALTESNGAGATMDTVEESRRYGSAGLLSSGLEARIVDRDTSRAKGVNQ  384

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W++GP++ +GY+KN +AT  TI+ +GW+ TGDL Y ++DG L+VVDR+KELIKYKG
Sbjct  385  TGELWLKGPSISKGYFKNEEATNETINVEGWLKTGDLCYIDEDGFLFVVDRLKELIKYKG  444

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP+I DA VIP+PD EAG+ P+AYV R P S+L+E+ V  FI+ QV
Sbjct  445  YQVPPAELEALLITHPDIFDAAVIPFPDKEAGQYPMAYVARKPESNLSEKQVIDFISKQV  504

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYK++RKV FINS+PK+ASGK LR++LI+   +KL
Sbjct  505  APYKKIRKVVFINSIPKNASGKTLRKDLIKLATSKL  540



>ref|XP_001754050.1| predicted protein [Physcomitrella patens]
 gb|EDQ80951.1| predicted protein [Physcomitrella patens]
Length=521

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 158/220 (72%), Gaps = 2/220 (1%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIE--NTRIGPRHSGSAGLLVSAVEAQIVSVDKL  681
            + +CA  F  A ++QGYG+TE+ G+  +   +      H GSAG+L   +EA +V     
Sbjct  297  LEQCAVRFPNAKLLQGYGLTESTGIGSVTPGDGAEFADHFGSAGMLAPTLEAMVVDPLTN  356

Query  680  QHLPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIK  501
            Q + P   GE+W+RGP +M+ Y  NP+AT  TIDK GW+HTGDL YF+ DG LY+VDR+K
Sbjct  357  QAVAPTHQGELWLRGPTIMRAYVGNPKATAETIDKDGWLHTGDLVYFDNDGYLYIVDRLK  416

Query  500  ELIKYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVK  321
            ELIKYK  QV+PAELE LL+SHP + D  VIP+PD +AGE+P+AY+V+ P S +T  ++ 
Sbjct  417  ELIKYKANQVSPAELESLLLSHPAVLDCAVIPFPDDDAGEIPMAYIVKKPESVITGGEIM  476

Query  320  KFIAGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVR  201
            +F+A QVAPYK++RKV FI+S+PKSA+GK+ RR+L+E  R
Sbjct  477  QFVAKQVAPYKKVRKVAFIDSIPKSAAGKMERRKLVELSR  516



>ref|XP_009402705.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Musa acuminata subsp. 
malaccensis]
Length=554

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 152/212 (72%), Gaps = 0/212 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            A  F    ++QGYG+TE+ G V    T    +   S G L S  EA+IV     + L PG
Sbjct  334  AARFPHVEIVQGYGLTESTGGVAGTRTPEESKVFSSTGRLGSNTEAKIVDPTTGEALGPG  393

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP +M+GY  + +AT  T+D +GW+ TGDL YF+ DG L++VDR+KELIKYK
Sbjct  394  QRGELWIRGPTIMKGYVGDAEATAATLDSEGWLKTGDLCYFDDDGFLFIVDRLKELIKYK  453

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE +LVSHP I DA VIPYPD EAG++P+A+VVR P S L++E+V  F+  Q
Sbjct  454  AYQVPPAELEHILVSHPGIADAAVIPYPDEEAGQIPMAFVVRQPGSMLSDEEVMDFVGKQ  513

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            VAPYKR+R++ F++S+PKS +GKILRRELI +
Sbjct  514  VAPYKRIRRIAFVSSIPKSPAGKILRRELINQ  545



>ref|XP_010242836.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Nelumbo nucifera]
Length=560

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 158/209 (76%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TET G+    +T    R  G+AGLL   +EA+I+  +  + LP  + GE+W+R
Sbjct  352  ILQGYGLTETAGIGASTDTVEESRRYGTAGLLSPNMEAKIIDPETGEALPVNRTGELWLR  411

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP++M+GY+ NP+AT  T++ +GW+ TGD+ Y ++DG +++VDR+KELIKYKGYQV PAE
Sbjct  412  GPSVMKGYFSNPEATTSTLNSEGWLRTGDVCYIDEDGYIFIVDRLKELIKYKGYQVPPAE  471

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL+ HPE+ D  VIP+PD E G++P+AYVVR   S L++ +V  F+A QVAPYKR+R
Sbjct  472  LEALLLCHPEVADVAVIPFPDKEVGQIPMAYVVRKAGSDLSDSNVMDFVARQVAPYKRIR  531

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            +V F+N++PK+ SGKILR++LI+   +KL
Sbjct  532  RVAFVNAIPKNPSGKILRKDLIKLATSKL  560



>gb|KCW83188.1| hypothetical protein EUGRSUZ_B00137 [Eucalyptus grandis]
Length=504

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 152/209 (73%), Gaps = 0/209 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + + +  + QGYG+TETCGV    +      H GS G ++  +EA+IV       LPPGQ
Sbjct  285  ERYPRVEIAQGYGLTETCGVATRTSGPDEANHHGSVGRIIPNMEAKIVDPSTGDALPPGQ  344

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP++M+ Y  + +AT  TID  GW+ TGDL Y + +G  ++VDR+KELIKYK 
Sbjct  345  RGELWLRGPSIMKCYVGDEKATAETIDSDGWLRTGDLCYIDSEGFFFIVDRLKELIKYKA  404

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQVAPAELE LL S+P++ DA VIPYPD EAG++PVA+VVR P S++TE  V  FIA QV
Sbjct  405  YQVAPAELEQLLHSNPDVADAAVIPYPDEEAGQIPVAFVVRKPGSNITESQVMDFIAKQV  464

Query  299  APYKRLRKVTFINSVPKSASGKILRRELI  213
            APYK++R+V FI+S+PKS +GKILRREL+
Sbjct  465  APYKKIRRVAFISSIPKSPAGKILRRELL  493



>ref|XP_011041268.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Populus euphratica]
Length=554

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 156/210 (74%), Gaps = 0/210 (0%)
 Frame = -3

Query  821  TVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWV  642
            T++QGYG+TE+ G+    +T    R  G+AGLL    EA+IV  +  + L   Q GE+W+
Sbjct  345  TILQGYGLTESAGIGASTDTLEESRRYGTAGLLSPNTEAKIVDPESGKALLVNQTGELWL  404

Query  641  RGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPA  462
            R P++M+GY+ N +AT  TID +GW+ TGDL Y + DG ++VVDR+KELIKYKGYQV PA
Sbjct  405  RAPSVMKGYFSNAEATSSTIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPA  464

Query  461  ELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRL  282
            ELE LL++HPEI DA VIP+PD + G+ P+AYVVR   S+L+E+ V  FIAGQVAPYKR+
Sbjct  465  ELEALLLTHPEISDAAVIPFPDEQVGQFPMAYVVRKAGSNLSEKAVMDFIAGQVAPYKRI  524

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAKL  192
            R+V ++ ++PK+ SGKILR++LI+   +KL
Sbjct  525  RRVAYVAAIPKNPSGKILRKDLIKLATSKL  554



>gb|EMT05035.1| 4-coumarate--CoA ligase-like protein 4 [Aegilops tauschii]
Length=326

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + + Q  ++QGYG+TE+  +    ++    R  G+AGLL    EA+IV  D  + LP  +
Sbjct  111  EKYPQVEILQGYGLTESTAIGASTDSAEESRRYGTAGLLSPNTEAKIVDPDTGEALPVNR  170

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+ N +AT+ T+   GW+ TGDL Y ++DG L+VVDR+KELIKYKG
Sbjct  171  TGELWIRGPYVMKGYFNNTEATQATVTPDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKG  230

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HPE+ D  VIP+PD + G+ P+AYVVR   S+L+ ++V +F+A QV
Sbjct  231  YQVPPAELEALLLTHPEVSDVAVIPFPDRDVGQFPMAYVVRKKGSNLSAQEVMEFVAKQV  290

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYK++RKV F+  +PK+ASGKILR++LI+   +KL
Sbjct  291  APYKKVRKVAFVTDIPKNASGKILRKDLIKLATSKL  326



>ref|XP_010677916.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Beta vulgaris subsp. 
vulgaris]
Length=556

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 152/216 (70%), Gaps = 6/216 (3%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLPPG  663
            F    + QGYGMTET G V    + +GP      GS G L   ++A+IV       LPPG
Sbjct  340  FPNVEIGQGYGMTETGGGVA---STVGPEECEQYGSVGRLQEHMQAKIVDPSTGDALPPG  396

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP +M+GY  +  AT  T D  GW+ TGDL YF+ DG LY+VDR+KELIKYK
Sbjct  397  QEGELWLRGPTIMKGYVGDKDATAATFDPDGWLKTGDLCYFDSDGYLYIVDRLKELIKYK  456

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE LL+SHPE+ DA VIPYPD EAG++P+AYVVR P SSLT   V  ++A +
Sbjct  457  AYQVPPAELERLLLSHPEVADAAVIPYPDEEAGQIPMAYVVRKPESSLTASQVMDYVAKE  516

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
            V+PYKR+R+V+FIN++PK+ SGKILRREL+ +  A 
Sbjct  517  VSPYKRVRRVSFINAIPKNPSGKILRRELVSQATAN  552



>ref|XP_010094597.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
 gb|EXB56351.1| 4-coumarate--CoA ligase-like 5 [Morus notabilis]
Length=554

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + F    ++QGYG+TE+ G+    ++    R  G+AGLL  ++EA+IV  +  + LP  +
Sbjct  339  EKFPSVKILQGYGLTESTGIGASTDSLEESRRYGTAGLLSPSMEAKIVDPETGEALPVNR  398

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+ N +AT  T+  +GW+ TGDL Y + DG L+VVDR+KELIKYKG
Sbjct  399  TGELWLRGPTIMKGYFSNEEATSSTLHSEGWLRTGDLCYIDDDGFLFVVDRLKELIKYKG  458

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL+SHPEI D+ VIPYPD E G+ PVAYVVR   S L+E +V  FI   V
Sbjct  459  YQVPPAELEALLLSHPEISDSAVIPYPDKEVGQYPVAYVVRKGGSKLSETEVIDFIGKLV  518

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+R+VTF++S+ K+ASGKILR++LI+   +KL
Sbjct  519  APYKRIRRVTFVSSILKNASGKILRKDLIKLATSKL  554



>ref|XP_002307770.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|EEE94766.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=554

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 155/210 (74%), Gaps = 0/210 (0%)
 Frame = -3

Query  821  TVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWV  642
            T++QGYG+TE+ G+    +T    R  G+AGLL    EA+IV  +  + L   Q GE+W+
Sbjct  345  TILQGYGLTESAGIGASTDTLEESRRYGTAGLLSPNTEAKIVDPESGKALLVNQTGELWL  404

Query  641  RGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPA  462
            R P++M+GY+ N +AT  TID +GW+ TGDL Y + DG ++VVDR+KELIKYKGYQV PA
Sbjct  405  RAPSVMKGYFSNAEATSSTIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPA  464

Query  461  ELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRL  282
            ELE LL++HPEI DA VIP+PD + G+ P+AYVVR   S L+E+ V  FIAGQVAPYKR+
Sbjct  465  ELEALLLTHPEISDAAVIPFPDEQVGQFPMAYVVRKAGSKLSEKAVMDFIAGQVAPYKRI  524

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAKL  192
            R+V ++ ++PK+ SGKILR++LI+   +KL
Sbjct  525  RRVAYVAAIPKNPSGKILRKDLIKLATSKL  554



>ref|XP_004499325.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cicer arietinum]
Length=539

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 156/216 (72%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +    ++QGYG+TE+ GV    ++    R  G+AGLL S+ EA IV  +  + LP  +
Sbjct  324  EKYPNVAILQGYGLTESSGVGASTDSLEESRKYGTAGLLSSSTEAMIVDTETAKPLPVNR  383

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+ N +AT  T+   GW+ TGD+ Y + DG +++VDR+KELIKYKG
Sbjct  384  TGELWLRGPTIMKGYFSNEEATTSTLTSDGWLKTGDVCYIDSDGFVFIVDRLKELIKYKG  443

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP I DA VIPYP  EAG++P+AYVVR   S++ E+ V  FIAGQV
Sbjct  444  YQVPPAELEALLLTHPAILDAAVIPYPHKEAGQIPMAYVVRKAESNIAEKQVMDFIAGQV  503

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            A YKR+RKV FI+S+PK+ SGKILR++L++   +KL
Sbjct  504  ASYKRIRKVAFISSIPKNPSGKILRKDLVKLATSKL  539



>gb|KJB08040.1| hypothetical protein B456_001G060700 [Gossypium raimondii]
Length=555

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 156/212 (74%), Gaps = 6/212 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLP  669
            K F    + QGYG+TET G      + IGP  +   GS G L   +E +IV  +  + LP
Sbjct  336  KKFPNVLLTQGYGLTETSGGAT---SVIGPEEAAQYGSVGRLAENMEGKIVDPETGEALP  392

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PG+ GE+W+RGP +M+GY  + +AT  T+D +GW+ TGD+ YF+ +G LYVVDR+KELIK
Sbjct  393  PGRRGELWLRGPTVMKGYVGDEKATAETLDSEGWLKTGDICYFDSEGFLYVVDRLKELIK  452

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YK YQV PAELE LL+SHPEI DA VIPYP+ EAG++P+AYVVR+P S++TE  V  FIA
Sbjct  453  YKAYQVPPAELEHLLLSHPEIVDAAVIPYPNEEAGQIPMAYVVRNPGSNITEAQVMDFIA  512

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
             QVAP+K++R+V FINS+PK+ +GKILRREL+
Sbjct  513  KQVAPHKKIRRVVFINSIPKTPAGKILRRELV  544



>ref|XP_010539806.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X1 [Tarenaya 
hassleriana]
Length=549

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 156/209 (75%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    +T    R  G+AGLL  ++E +IV  D  + L   Q GE+W++
Sbjct  341  ILQGYGLTESTGMGASTDTLEESRRYGTAGLLSPSMEGKIVDPDSGRALGLNQTGELWLK  400

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP +M+GY+ N +AT  T+D +GW+ TGDL YF++DG ++VVDR+KELIKYKGYQV PAE
Sbjct  401  GPAIMKGYFSNEEATSSTLDSEGWLRTGDLCYFDEDGFIFVVDRLKELIKYKGYQVPPAE  460

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL+ H EI DA VIP+PD EAG+ P+AY+VR P S L+E+ V  F++ QVAPYKR+R
Sbjct  461  LEALLLVHQEIVDAAVIPFPDREAGQFPMAYIVRKPGSKLSEKSVMDFVSEQVAPYKRIR  520

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV F+ S+PK+ SGKILR++LI+   +KL
Sbjct  521  KVAFVASIPKNPSGKILRKDLIKLATSKL  549



>gb|AGO89324.1| Ca4CL7 [Salix arbutifolia]
Length=554

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 156/210 (74%), Gaps = 0/210 (0%)
 Frame = -3

Query  821  TVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWV  642
            T++Q YG+TE+ GV    +T    R  G+AGLL    EA+IV  +  + L   Q GE+W+
Sbjct  345  TILQAYGLTESAGVGASMDTLEESRRYGTAGLLSPNTEAKIVDPESGKALLVNQTGELWL  404

Query  641  RGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPA  462
            R P++M+GY++N +AT  TID +GW+ TGDL Y + DG ++VVDR+KELIKYKGYQV PA
Sbjct  405  RAPSVMKGYFRNAEATSSTIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPA  464

Query  461  ELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRL  282
            ELE LL++HPEI DA VIP+PD +AG+ P+AYVVR   S+L+E+ V  FIAG VAPYKR+
Sbjct  465  ELEALLLTHPEISDAAVIPFPDKQAGQFPMAYVVRKAGSNLSEKAVMDFIAGLVAPYKRI  524

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAKL  192
            R+V FI ++P++ SGKILR++LI+   +KL
Sbjct  525  RRVAFIAAIPRNPSGKILRKDLIKLATSKL  554



>gb|AGO89325.1| Ca4CL8 [Salix arbutifolia]
Length=554

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 154/210 (73%), Gaps = 0/210 (0%)
 Frame = -3

Query  821  TVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWV  642
            T++QGYG+TE+  +    +T    R  G+AGLL    EA+IV  +  + L   Q GE+W+
Sbjct  345  TILQGYGLTESTAIGASTDTLEESRRYGTAGLLSPNTEAKIVDPESGKALSVNQTGELWL  404

Query  641  RGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPA  462
            R P++M+GY+ N +AT   ID +GW+ TGDL Y + DG ++VVDR+KELIKYKGYQV PA
Sbjct  405  RAPSVMKGYFSNAEATSSAIDSEGWLRTGDLCYIDDDGFIFVVDRLKELIKYKGYQVPPA  464

Query  461  ELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRL  282
            ELE LL++HPEI DA VIP+PD   G+ P+AYVVR   S+L+E+ V+ FIAGQVAPYKR+
Sbjct  465  ELEALLLAHPEISDAAVIPFPDKNVGQFPMAYVVRKAGSNLSEKAVQDFIAGQVAPYKRI  524

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAKL  192
            R+V FI +VPK+ SGKILR++LI+   +KL
Sbjct  525  RRVAFIAAVPKNPSGKILRKDLIKLATSKL  554



>gb|ERM96392.1| hypothetical protein AMTR_s00001p00238960 [Amborella trichopoda]
Length=1002

 Score =   253 bits (645),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            F +  ++QGYG+TET G+    +T    R  G+AGLL   +EA++V  D  + L P Q G
Sbjct  328  FPKVAIMQGYGLTETSGIGASADTPEESRRYGTAGLLSPNMEAKVVDPDTGEALLPNQRG  387

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            ++W+RGP++M+GY+ N +AT   +D +GW+ TGDL YF++DG L+VVDR+KELIKYKGYQ
Sbjct  388  DLWLRGPSIMKGYFSNAEATAGALDAEGWLKTGDLCYFDEDGFLFVVDRLKELIKYKGYQ  447

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            VAPAELE LL++HP I+DA V+P+PD EAG++P+A+VVR   SSL+E  + +F+A QVAP
Sbjct  448  VAPAELEALLLTHPNIEDAAVVPFPDKEAGQIPMAFVVRKAGSSLSEATLMEFVAAQVAP  507

Query  293  YKRLRKVTFINSVPKSASGKILRRELI  213
            YK++R+V F++++PK+ASGK LR++LI
Sbjct  508  YKKIRRVAFVSAIPKNASGKTLRKDLI  534



>gb|KJB29668.1| hypothetical protein B456_005G113000 [Gossypium raimondii]
Length=549

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 159/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +    ++QGYG+TE+ G+    ++    R  G+AG+L  ++EA++V  D  + L   Q
Sbjct  334  EKYPNVKILQGYGLTESTGIGASTDSLEESRKYGTAGMLSPSMEAKVVDPDSGKALNVNQ  393

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+ +RGP++M+GY+ NP+AT  T+D  GW+ TGDL Y ++DG +++VDR+KELIKYKG
Sbjct  394  TGELRLRGPSVMKGYFSNPEATTSTLDSDGWLRTGDLCYIDEDGFIFIVDRLKELIKYKG  453

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL+SHPEI DA VIP+PD E G++P+AYVVR P S+L+E  V  F+  QV
Sbjct  454  YQVPPAELEALLLSHPEILDAAVIPFPDREVGQLPMAYVVRKPGSNLSETGVMDFVGRQV  513

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+RKV F+ S+PK+ SGKILR++LI+   +KL
Sbjct  514  APYKRIRKVAFVASIPKNPSGKILRKDLIKLATSKL  549



>ref|XP_008387876.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Malus domestica]
Length=556

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 157/210 (75%), Gaps = 0/210 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +   +++QGYG+TE+ GV    ++    R  G+AGLL +++EA IV  D    L   +
Sbjct  336  EKYPMVSILQGYGLTESTGVGASTDSLEESRKYGTAGLLSASMEAMIVDPDSGHPLATNK  395

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W++GP +M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYKG
Sbjct  396  TGELWLKGPTIMKGYFSNAEATASTLDSKGWLRTGDLCYIDEDGFIFVVDRLKELIKYKG  455

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HPEI DA VIP+PD + G+ P+AYVVR+  SSLTE  V +F+  QV
Sbjct  456  YQVPPAELEALLLTHPEIADAAVIPFPDEKVGQYPMAYVVRNAGSSLTESGVMEFVGKQV  515

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIE  210
            APYKR+R+V FI+SVPK+ SGKILR++LI+
Sbjct  516  APYKRIRRVAFIDSVPKNPSGKILRKDLIQ  545



>ref|XP_010926601.1| PREDICTED: 4-coumarate--CoA ligase-like 5 isoform X2 [Elaeis 
guineensis]
Length=552

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  836  NFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQL  657
             F    +IQGYG+TE+ G V         R  GSAG + + +EA+IV     + LPP + 
Sbjct  334  RFPNIEIIQGYGLTESTGGVSGTAGPDESRKYGSAGRIGANLEAKIVDPATGEALPPERQ  393

Query  656  GEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGY  477
            GE+W+RGP +M+GY  + +AT  T+D +GW+ TGDL YF++DG ++VVDR+KELIKYK Y
Sbjct  394  GELWLRGPTIMKGYIGDAEATASTLDSEGWLKTGDLCYFDQDGFVFVVDRLKELIKYKAY  453

Query  476  QVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVA  297
            QV PAELE +L SHPEI DA VIP+PD EAG++P+A++VR P SS++E+ V  F+A QVA
Sbjct  454  QVPPAELEHVLHSHPEIADAAVIPFPDEEAGQIPMAFIVRQPGSSVSEQQVMDFVAKQVA  513

Query  296  PYKRLRKVTFINSVPKSASGKILRRELIEKV  204
            PYK++R+V F++S+PKSA+GKILRRELI  V
Sbjct  514  PYKKVRRVAFVSSIPKSAAGKILRRELINHV  544



>ref|XP_007132313.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04307.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=477

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  854  MXECAKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQH  675
            M EC + F    + QGYGMTETCG+V +EN R G RH+GS G+L S VEAQIV+VD  + 
Sbjct  328  MQECGRRFPHVAICQGYGMTETCGIVSVENPRAGIRHTGSTGMLASGVEAQIVTVDTQKP  387

Query  674  LPPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKEL  495
            LPP Q GEIWVRGPNMM+GY+ NPQAT+LTID++GWVHTGD+GYF++DG LYVVDRIKEL
Sbjct  388  LPPTQSGEIWVRGPNMMKGYHNNPQATRLTIDEKGWVHTGDIGYFDEDGQLYVVDRIKEL  447

Query  494  IKYKGYQVAPAELEGLLVSHPEIQDAVVIP  405
            IKYKG+QVAPAELEGLL+SHPEI DAVV+P
Sbjct  448  IKYKGFQVAPAELEGLLISHPEILDAVVVP  477



>ref|XP_004253129.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Solanum lycopersicum]
Length=552

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 155/209 (74%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    ++    R  G+AG+L  ++E +IV  +  + LP  + GE+W+R
Sbjct  344  ILQGYGLTESTGIGASTDSLEESRRYGTAGMLSPSMEGKIVDPESGKALPVNKTGELWLR  403

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP +M+GY+ N +AT  T+D  GW+ TGDL Y ++DG ++VVDR+KELIKYKGYQV PAE
Sbjct  404  GPTIMKGYFSNEEATASTLDSDGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAE  463

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HPEI DA VIP+PD E G+ P+AYVVR   S+++E  V  FIA QVAPYKR+R
Sbjct  464  LEALLLTHPEISDAAVIPFPDKEVGQFPMAYVVRKTGSTISESAVMDFIAKQVAPYKRIR  523

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            +V F+ S+PK+ SGKILR++LI+   +KL
Sbjct  524  RVAFVASIPKNPSGKILRKDLIKLATSKL  552



>ref|XP_004985831.1| PREDICTED: 4-coumarate--CoA ligase-like 4-like [Setaria italica]
Length=548

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 158/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + + Q  ++QGYG+TE+  +    ++    R  G+AGLL    EA+IV  +  + LP  +
Sbjct  333  EKYPQVEILQGYGLTESTAIGASTDSAEESRRYGTAGLLSPNTEAKIVDPETGEALPVNR  392

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+KNP+AT+ T+   GW+ TGDL Y ++DG L+VVDR+KELIKYKG
Sbjct  393  TGELWIRGPYVMKGYFKNPEATQSTVTPDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKG  452

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HPEI D  VIP+PD E G+ P+AYVVR   S L+E ++ +F+A QV
Sbjct  453  YQVPPAELEALLLTHPEIADVAVIPFPDREVGQFPMAYVVRKKGSKLSEREIMEFVAKQV  512

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYK++RKV F+  +PK+ASGKILR++LI+   +KL
Sbjct  513  APYKKVRKVAFVAEIPKNASGKILRKDLIKLATSKL  548



>ref|XP_010229245.1| PREDICTED: 4-coumarate--CoA ligase-like 4 [Brachypodium distachyon]
Length=551

 Score =   245 bits (625),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 159/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + + Q  ++QGYG+TE+  +    ++    R  G+AGLL    EA+IV  +  + LP  +
Sbjct  336  EKYPQVEILQGYGLTESTAIGASTDSAEESRQYGTAGLLSPNTEAKIVDPETAEALPVNR  395

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W++GP +M+GY+KN +ATK T+  +GW+ TGDL Y ++DG L+VVDR+KELIKYKG
Sbjct  396  TGELWIKGPYVMKGYFKNTEATKATVTPEGWLKTGDLCYIDEDGYLFVVDRLKELIKYKG  455

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HPEI DA VIP+PD E G+ P+AY+VR   S+L+  +V +F+A QV
Sbjct  456  YQVPPAELEALLLTHPEITDAAVIPFPDKEVGQFPMAYIVRKNGSNLSAHEVMEFVAKQV  515

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYK++RKV F+  +PK+ASGKILR++LI+   +KL
Sbjct  516  APYKKVRKVAFVTDIPKNASGKILRKDLIKLATSKL  551



>ref|XP_008239369.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Prunus mume]
Length=558

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 154/211 (73%), Gaps = 4/211 (2%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTET--CGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPP  666
            + F    ++QGYG+TET   G   I++     +   S G L   +EAQIV  +  + LPP
Sbjct  339  ERFPNVEIVQGYGLTETGAAGTRMIDSEE--SKRYASVGRLAENMEAQIVDPETGEALPP  396

Query  665  GQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKY  486
            GQ GE+W+RGP +M+GY  + +AT  T+D  GW+ TGDL +F+ +G LY+VDR+KELIKY
Sbjct  397  GQRGELWLRGPTVMKGYVGDDKATAETLDSAGWLKTGDLCFFDDEGFLYIVDRLKELIKY  456

Query  485  KGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAG  306
            K YQV PAELE +L SHP+I DA VIPYPD EAG++P+AYV R P S++TE +V  F+A 
Sbjct  457  KAYQVPPAELEPILQSHPDIADAAVIPYPDEEAGQIPMAYVFRKPGSNITEAEVMDFVAK  516

Query  305  QVAPYKRLRKVTFINSVPKSASGKILRRELI  213
            QVAPYK++R+V+FINS+PKS +GKILRRELI
Sbjct  517  QVAPYKKIRRVSFINSIPKSPAGKILRRELI  547



>gb|KJB40015.1| hypothetical protein B456_007G042200 [Gossypium raimondii]
Length=491

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 153/212 (72%), Gaps = 6/212 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLP  669
            + F    ++QGYG+TET G         GP  +   G+ G L   +EA+IV  +  Q LP
Sbjct  274  EKFPNVLLLQGYGLTETGGGA---TNVFGPEEAARYGTVGRLAENMEAKIVDPETGQSLP  330

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PGQ GE+W+RGP +M+GY  + +AT  T+D +GW+ TGD+ YF+ +G LY++DR+KELIK
Sbjct  331  PGQRGELWLRGPTVMKGYLGDEKATAETLDSEGWLKTGDICYFDTEGFLYILDRLKELIK  390

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YK YQV PAELE LL SHP+I DA V+PYPD EAG++P+AYVVR+P SSLT      FIA
Sbjct  391  YKAYQVPPAELEHLLHSHPQIADAAVVPYPDEEAGQIPIAYVVRNPGSSLTAAQTMDFIA  450

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
             QVAPYK++R+V FI+S+PK+ +GKILRREL+
Sbjct  451  KQVAPYKKIRRVAFIDSIPKNPAGKILRRELV  482



>ref|XP_011099557.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Sesamum indicum]
Length=554

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            ++ +   T++QGYG+TE+ GV    ++    R  G+AGLL  ++EA+IV  +    L   
Sbjct  338  SEKYPNVTILQGYGLTESTGVGASTDSLEESRKYGTAGLLSPSMEAKIVDPESGVALSVN  397

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W++GP +M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYK
Sbjct  398  QTGELWLKGPTIMKGYFSNEEATASTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYK  457

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
            GYQV PAELE LL++HPEI DA VIP+PD E G+ P+AYVVR   S+++E  V  FIA Q
Sbjct  458  GYQVPPAELEALLLTHPEIADAAVIPFPDKEVGQFPMAYVVRKTASTISENGVMDFIAKQ  517

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            VAPYKR+R+V F+ S+PK+ SGKILR++LI+   +K+
Sbjct  518  VAPYKRIRRVAFVASIPKNPSGKILRKDLIKLAVSKM  554



>ref|XP_006351482.1| PREDICTED: 4-coumarate--CoA ligase-like 9-like [Solanum tuberosum]
Length=552

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 152/210 (72%), Gaps = 6/210 (3%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLPPG  663
            F    ++QGYG+TET G     N   GP  S   GSAG L   VEA+IV  +  + LPPG
Sbjct  335  FPDVEILQGYGLTETTGGATGMN---GPEESNQYGSAGRLGVNVEAKIVDPESGKSLPPG  391

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+R P +M+GY  + QAT  T+D +GW+ TGDL YF+ DG LYVVDR+KELIKYK
Sbjct  392  QRGELWLRAPTIMKGYVGDKQATSATLDPEGWLKTGDLCYFDADGFLYVVDRLKELIKYK  451

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE LL S P++ DA VIPYPD EAGE+P+AY+VR P S+++E  +   IA Q
Sbjct  452  AYQVPPAELEHLLQSIPDVADAAVIPYPDEEAGEIPMAYIVRRPGSTISESQIIDIIAKQ  511

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELI  213
            V+PYK++R+V FIN++PKS +GKILRREL+
Sbjct  512  VSPYKKIRRVAFINAIPKSPAGKILRRELV  541



>ref|XP_008377088.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Malus domestica]
Length=575

 Score =   245 bits (626),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 156/208 (75%), Gaps = 0/208 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            +   T++QGYG+TE+ GV     +    R  G+AGLL +++EA IV  D    LP  + G
Sbjct  360  YPMVTILQGYGLTESAGVGASTESLEESRKYGTAGLLSASMEAMIVDRDSGNPLPANKTG  419

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            E++++GP++M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKY GYQ
Sbjct  420  ELYLKGPSIMKGYFNNAKATASTLDSKGWLRTGDLCYIDEDGFIFVVDRLKELIKYNGYQ  479

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            VAPAELE LL++HPEI DA VIP+PD + G+ P+AYVVR   SSLTE  V +F+  QVAP
Sbjct  480  VAPAELEALLLTHPEIVDAAVIPFPDEKVGQHPMAYVVRKAGSSLTESGVMEFVGKQVAP  539

Query  293  YKRLRKVTFINSVPKSASGKILRRELIE  210
            YKR+R+V FI+SVPK+ SGKILR++LI+
Sbjct  540  YKRIRRVAFIDSVPKNPSGKILRKDLIQ  567



>ref|XP_004236342.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Solanum lycopersicum]
Length=552

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 152/211 (72%), Gaps = 6/211 (3%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLPPG  663
            F    ++QGYG+TET G     N   GP  S   GSAG L   VEA+IV  +  + LPPG
Sbjct  335  FPNVEILQGYGLTETTGGATGMN---GPEESNQYGSAGRLGVNVEAKIVDPESGKTLPPG  391

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+R P +M+GY  + QAT  T+D +GW+ TGDL YF+ DG LYVVDR+KELIKYK
Sbjct  392  QRGELWLRAPTIMKGYVGDKQATSATLDPEGWLKTGDLCYFDADGFLYVVDRLKELIKYK  451

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE LL S P++ DA VIPYPD EAGE+P+AY+VR P S+++E  +   IA Q
Sbjct  452  AYQVPPAELEHLLQSIPDVADAAVIPYPDEEAGEIPMAYIVRRPGSTISESQIIDIIAKQ  511

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            V+PYK++R+V FIN++PKS +GKILRREL+ 
Sbjct  512  VSPYKKIRRVAFINAIPKSPAGKILRRELVN  542



>gb|AHM88424.1| 4CL6 [Fraxinus mandshurica]
Length=552

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 158/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +   T++QGYG+TE+  +    ++    R  G+AG+L  ++EA+IV  +  + LP   
Sbjct  337  EKYPNVTILQGYGLTESTAIGASTDSLEESRRYGTAGMLSPSMEAKIVDPESGEALPVNC  396

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP++M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYKG
Sbjct  397  TGELWLRGPSIMKGYFSNEEATASTLDSEGWLRTGDLCYVDEDGFIFVVDRLKELIKYKG  456

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HPEI DA VIP+PD + G+ P+AYVVR   SS++E  V  FIA QV
Sbjct  457  YQVPPAELEALLLTHPEIADAAVIPFPDEKVGQFPMAYVVRKTGSSISESAVMDFIAKQV  516

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+R+V F  SVPK+ SGKILR++LI+   +KL
Sbjct  517  APYKRIRRVAFTASVPKNPSGKILRKDLIKLAVSKL  552



>ref|NP_001048867.1| Os03g0132000 [Oryza sativa Japonica Group]
 sp|Q10S72.1|4CLL4_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 4 [Oryza sativa Japonica 
Group]
 gb|ABF93822.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10781.1| Os03g0132000 [Oryza sativa Japonica Group]
 dbj|BAG97355.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00460.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58280.1| hypothetical protein OsJ_09299 [Oryza sativa Japonica Group]
Length=552

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 158/216 (73%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + + Q  ++QGYG+TE+  +    ++    R  G+AGLL    EA+IV  D  + LP  +
Sbjct  337  EKYPQVEILQGYGLTESTAIGASTDSAEESRRYGTAGLLSPNTEAKIVDPDSGEALPVNR  396

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+KN +AT+ T+   GW+ TGDL Y ++DG L+VVDR+KELIKYKG
Sbjct  397  TGELWIRGPYVMKGYFKNAEATQSTLTPDGWLKTGDLCYIDEDGYLFVVDRLKELIKYKG  456

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HPE+ D  VIP+PD E G+ P+AY+VR   S+L+E +V +F+A QV
Sbjct  457  YQVPPAELEALLLTHPEVTDVAVIPFPDREVGQFPMAYIVRKKGSNLSEREVMEFVAKQV  516

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYK++RKV F+  +PK+ASGKILR++LI+   +KL
Sbjct  517  APYKKVRKVAFVTDIPKNASGKILRKDLIKLATSKL  552



>gb|KJB08041.1| hypothetical protein B456_001G060700 [Gossypium raimondii]
Length=555

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 157/213 (74%), Gaps = 6/213 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLP  669
            + F    ++QGYG+TET G      + IGP  +   GS G L   +E +IV  +  + LP
Sbjct  336  EKFPGVLLVQGYGLTETSGGA---TSVIGPEEAAQYGSVGRLAENMEGKIVDPETGEALP  392

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PG+ GE+W+RGP +M+GY  + +AT  T+D +GW+ TGD+ YF+ +G LYVVDR+KELIK
Sbjct  393  PGRRGELWLRGPTVMKGYVGDEKATAETLDSEGWLKTGDICYFDSEGFLYVVDRLKELIK  452

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YK YQV PAELE LL+SHPEI DA VIPYP+ EAG++P+AYVVR+P S++TE  V  FIA
Sbjct  453  YKAYQVPPAELEHLLLSHPEIVDAAVIPYPNEEAGQIPMAYVVRNPGSNITEAQVMDFIA  512

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELIE  210
             QVAP+K++R+V FINS+PK+ +GKILRREL+ 
Sbjct  513  KQVAPHKKIRRVVFINSIPKTPAGKILRRELVN  545



>ref|XP_002511221.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF51823.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=549

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGP---RHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            F Q  + QGYG+TET G        I P   +  GS G L   +EA+IV     + LPPG
Sbjct  332  FPQVEISQGYGLTETGGGAA---RMISPEEFKQHGSVGRLAENMEAKIVDPVNGEALPPG  388

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            Q GE+W+RGP +M+GY KN +AT  T+D +GW+ TGD+ YF+  G LY+VDR+KELIKYK
Sbjct  389  QRGELWLRGPTLMKGYVKNEKATAETLDSEGWLKTGDICYFDSQGFLYIVDRLKELIKYK  448

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE LL SH EI DA V+PY D EAG++P+AY+VR P S +TE +V  FIA Q
Sbjct  449  AYQVPPAELEQLLHSHLEIADAAVVPYADEEAGQIPMAYIVRKPGSDITEAEVMDFIAKQ  508

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELIE  210
            VAPYK++R+V FIN++PKS +GKILRREL++
Sbjct  509  VAPYKKIRRVAFINAIPKSPAGKILRRELVD  539



>gb|KJB40011.1| hypothetical protein B456_007G042200 [Gossypium raimondii]
Length=521

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 153/212 (72%), Gaps = 6/212 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLP  669
            + F    ++QGYG+TET G         GP  +   G+ G L   +EA+IV  +  Q LP
Sbjct  304  EKFPNVLLLQGYGLTETGGGA---TNVFGPEEAARYGTVGRLAENMEAKIVDPETGQSLP  360

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PGQ GE+W+RGP +M+GY  + +AT  T+D +GW+ TGD+ YF+ +G LY++DR+KELIK
Sbjct  361  PGQRGELWLRGPTVMKGYLGDEKATAETLDSEGWLKTGDICYFDTEGFLYILDRLKELIK  420

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YK YQV PAELE LL SHP+I DA V+PYPD EAG++P+AYVVR+P SSLT      FIA
Sbjct  421  YKAYQVPPAELEHLLHSHPQIADAAVVPYPDEEAGQIPIAYVVRNPGSSLTAAQTMDFIA  480

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
             QVAPYK++R+V FI+S+PK+ +GKILRREL+
Sbjct  481  KQVAPYKKIRRVAFIDSIPKNPAGKILRRELV  512



>ref|XP_001752801.1| predicted protein [Physcomitrella patens]
 gb|EDQ82305.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 154/219 (70%), Gaps = 2/219 (1%)
 Frame = -3

Query  845  CAKNFXQATVIQGYGMTETCGVVCIENTRIGPR--HSGSAGLLVSAVEAQIVSVDKLQHL  672
            CAK F    + QGYG+TE+ G      T +     H G++G+L+   +  I+     + +
Sbjct  331  CAKRFPNVKLKQGYGLTESTGACSTAPTNVSDMDAHYGASGILLPNTQGMIIDPVTNKPM  390

Query  671  PPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELI  492
            PP + GE W+RGP++++ Y+KNP+AT  TIDK GW+HTGDL   + DG ++V+DR+KELI
Sbjct  391  PPTKQGEFWIRGPSIVKEYFKNPKATSETIDKDGWLHTGDLVMIDNDGYIHVLDRLKELI  450

Query  491  KYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFI  312
            KY  YQVAPAELE LL+SHP I D  VIPYPD  AG++P+AY+V+ P    TE+++  ++
Sbjct  451  KYNAYQVAPAELEALLLSHPSILDCAVIPYPDEVAGQIPMAYIVQKPGKKFTEDEIMDWV  510

Query  311  AGQVAPYKRLRKVTFINSVPKSASGKILRRELIEKVRAK  195
              QVAPYK++RKV FIN++PKSASGKILRREL++   AK
Sbjct  511  GKQVAPYKKVRKVAFINAIPKSASGKILRRELLQSATAK  549



>ref|XP_010041733.1| PREDICTED: 4-coumarate--CoA ligase 1-like, partial [Eucalyptus 
grandis]
Length=518

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 156/211 (74%), Gaps = 7/211 (3%)
 Frame = -3

Query  812  QGYGMTETCGVVCI----ENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIW  645
            Q YG+TETCG   +    E+ +    H GS G L+    A+IV ++    LPP + GE+W
Sbjct  307  QAYGLTETCGAASVFALDEDAK---AHPGSCGSLLPHFSAKIVDIETGSPLPPNKEGELW  363

Query  644  VRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAP  465
            +R P +M+GY +N +AT   +D +GW+ TGDLGYF++DG LY+VDRIKELIK+ GYQVAP
Sbjct  364  LRSPTIMKGYLQNEEATTAMLDPEGWLRTGDLGYFDEDGFLYIVDRIKELIKHNGYQVAP  423

Query  464  AELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKR  285
            AELE LL+SHP+I DA VIP  + EAG+VP+AYVV++  S LTE  V +FIA QVAPYK+
Sbjct  424  AELEALLLSHPQIVDAAVIPLENEEAGQVPMAYVVKASGSELTENQVIRFIADQVAPYKK  483

Query  284  LRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            +R+V FI+++PKSA+GKILR++LI + + +L
Sbjct  484  VRRVGFISTIPKSAAGKILRKQLISQTQQQL  514



>ref|XP_004145532.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Cucumis sativus]
 gb|KGN55484.1| hypothetical protein Csa_4G653450 [Cucumis sativus]
Length=550

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 155/216 (72%), Gaps = 0/216 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + F    ++QGYG+TE+ G+    ++    R  G+AGLL  + E  IV  +  + LP  +
Sbjct  335  EKFPNVAILQGYGLTESTGIGASTDSLEESRRYGTAGLLSPSTEGMIVDPETGEALPVNR  394

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W+RGP +M+GY+ N +AT  T+D  GW+ TGDL Y ++DG ++VVDR+KELIKYKG
Sbjct  395  TGELWLRGPTVMKGYFGNVEATSSTLDSAGWLRTGDLCYIDEDGFIFVVDRLKELIKYKG  454

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP I DA VIPYPD + G+ P+AYVVR   S ++  DV +F+A QV
Sbjct  455  YQVPPAELEALLLTHPNISDAAVIPYPDKDVGQFPMAYVVRKVGSDISHNDVMQFVAKQV  514

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            APYKR+R+V F++S+PK+ SGKILR++LI+   +KL
Sbjct  515  APYKRIRRVAFVDSIPKNPSGKILRKDLIKLATSKL  550



>ref|NP_173474.5| 4-coumarate--CoA ligase-like 4 [Arabidopsis thaliana]
 sp|P0C5B6.1|4CLL4_ARATH RecName: Full=4-coumarate--CoA ligase-like 4 [Arabidopsis thaliana]
 gb|AEE29979.1| 4-coumarate--CoA ligase-like 4 [Arabidopsis thaliana]
Length=550

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 158/209 (76%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGY +TE+ G     N+    R  G+AG L S VEA+IV  +  + +   Q GE+W++
Sbjct  342  ILQGYALTESNGGGAFTNSAEESRRYGTAGTLTSDVEARIVDPNTGRFMGINQTGELWLK  401

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP++ +GY+KN +AT  TI+ +GW+ TGDL Y ++DG L+VVDR+KELIKYKGYQV PAE
Sbjct  402  GPSISKGYFKNQEATNETINLEGWLKTGDLCYIDEDGFLFVVDRLKELIKYKGYQVPPAE  461

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HP+I DA VIP+PD EAG+ P+AYVVR   S+L+E+ V  FI+ QVAPYK++R
Sbjct  462  LEALLITHPDILDAAVIPFPDKEAGQYPMAYVVRKHESNLSEKQVIDFISKQVAPYKKIR  521

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV+FINS+PK+ASGK LR++LI+   +KL
Sbjct  522  KVSFINSIPKTASGKTLRKDLIKLATSKL  550



>gb|KFK44167.1| hypothetical protein AALP_AA1G223400 [Arabis alpina]
Length=552

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 155/208 (75%), Gaps = 0/208 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    +T    R  G+AG L +++E +IV     Q L P   GE+W++
Sbjct  342  ILQGYGLTESTGIGASTDTVEEGRRYGTAGKLSASMEGRIVDPVTGQILGPKHTGELWLK  401

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP +M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYKGYQV PAE
Sbjct  402  GPTIMKGYFSNEEATSSTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVPPAE  461

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HPEI DA VIP+PD E G+ P+AYVVR   SSL+E+ + +F+A QVAPYKR+R
Sbjct  462  LEALLLTHPEIADAAVIPFPDREVGQFPMAYVVRKTGSSLSEKSIMEFVAKQVAPYKRIR  521

Query  278  KVTFINSVPKSASGKILRRELIEKVRAK  195
            KV FI+SVPK+ SGKILR++LI+   A 
Sbjct  522  KVAFISSVPKNPSGKILRKDLIKLATAN  549



>ref|XP_008392841.1| PREDICTED: 4-coumarate--CoA ligase-like 9 [Malus domestica]
Length=559

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 157/210 (75%), Gaps = 2/210 (1%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCG-VVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPG  663
            + F    V+QGYG+TET G    + +     RH+ S G L   +EA+IV  +  + LPPG
Sbjct  340  ERFPNVEVVQGYGLTETGGGATRMIDPEECARHA-SVGRLAENMEAKIVDPETGEALPPG  398

Query  662  QLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYK  483
            + GE+W+RGP +M+GY ++ +AT  T+D+ GW+ TGDL YF+ +G LY+VDR+KELIKYK
Sbjct  399  KRGELWLRGPTIMKGYVRDDKATTETLDEDGWLKTGDLCYFDDEGFLYIVDRLKELIKYK  458

Query  482  GYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQ  303
             YQV PAELE +L SHP+++DA VIPYPD +AG++P+AYVVR P S++TE  V  F+A Q
Sbjct  459  AYQVPPAELEHILQSHPDVEDAAVIPYPDEDAGQIPMAYVVRKPGSNITEALVMDFVAKQ  518

Query  302  VAPYKRLRKVTFINSVPKSASGKILRRELI  213
            VAPYK++R+V FINS+PKS +GKILRREL+
Sbjct  519  VAPYKKIRRVAFINSIPKSPAGKILRRELV  548



>gb|KFK44162.1| hypothetical protein AALP_AA1G222900 [Arabis alpina]
Length=545

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 153/209 (73%), Gaps = 0/209 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGY +TE+ G      +    R  G+ GLL S ++A+IV  D  + +   Q+GE+W+R
Sbjct  337  ILQGYALTESNGAGAATESVEESRRYGAVGLLTSGLKARIVDPDTGRVMGVNQMGELWLR  396

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAE  459
            GP + +GY++N +AT  TI+ +GW+ TGDL Y + DG L+VVDR+KELIKYKGYQV PAE
Sbjct  397  GPTIAKGYFRNEEATNETINLEGWLKTGDLCYIDDDGFLFVVDRLKELIKYKGYQVPPAE  456

Query  458  LEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRLR  279
            LE LL++HP+I DA VIP+PD EAG+ P+AYV R P S L+E  V  FI+ QVAPYK++R
Sbjct  457  LEALLITHPDILDAAVIPFPDKEAGQCPMAYVARKPESKLSENQVIDFISKQVAPYKKIR  516

Query  278  KVTFINSVPKSASGKILRRELIEKVRAKL  192
            KV FINS+PK+ASGK LR++LI+   +KL
Sbjct  517  KVAFINSIPKTASGKTLRKDLIKLATSKL  545



>ref|XP_002991507.1| hypothetical protein SELMODRAFT_133629 [Selaginella moellendorffii]
 gb|EFJ07429.1| hypothetical protein SELMODRAFT_133629 [Selaginella moellendorffii]
Length=551

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 154/209 (74%), Gaps = 8/209 (4%)
 Frame = -3

Query  812  QGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVRGP  633
            Q YGMTET G+        G    GSAGLL +  EA++ +VD  + LPP   GE+W+RGP
Sbjct  345  QAYGMTETTGL-----GASGEAPFGSAGLLTANHEAKVTNVDTGKPLPPHSRGELWLRGP  399

Query  632  NMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQVAPAELE  453
             +MQ Y  NP AT  TID +GW+HTGD+GYF+ DG L++VDR+KELIKYKG+QVAPAELE
Sbjct  400  CIMQSYLNNPAATAATIDPEGWLHTGDIGYFDDDGFLFIVDRLKELIKYKGFQVAPAELE  459

Query  452  GLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNS---SLTEEDVKKFIAGQVAPYKRL  282
             LL++HP I DA VIPYPD +AGE+P+A VVR       SL++++V  FIA QVA +KR+
Sbjct  460  ALLLAHPGIADAAVIPYPDDDAGEIPLACVVRGSGEAGKSLSKDEVMDFIARQVASHKRI  519

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAK  195
            R VTF+ S+PKSA+GKILR++L++  R++
Sbjct  520  RAVTFVPSIPKSATGKILRKDLLQVTRSR  548



>gb|KJB40012.1| hypothetical protein B456_007G042200 [Gossypium raimondii]
Length=550

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 153/212 (72%), Gaps = 6/212 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLP  669
            + F    ++QGYG+TET G         GP  +   G+ G L   +EA+IV  +  Q LP
Sbjct  333  EKFPNVLLLQGYGLTETGGGA---TNVFGPEEAARYGTVGRLAENMEAKIVDPETGQSLP  389

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PGQ GE+W+RGP +M+GY  + +AT  T+D +GW+ TGD+ YF+ +G LY++DR+KELIK
Sbjct  390  PGQRGELWLRGPTVMKGYLGDEKATAETLDSEGWLKTGDICYFDTEGFLYILDRLKELIK  449

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YK YQV PAELE LL SHP+I DA V+PYPD EAG++P+AYVVR+P SSLT      FIA
Sbjct  450  YKAYQVPPAELEHLLHSHPQIADAAVVPYPDEEAGQIPIAYVVRNPGSSLTAAQTMDFIA  509

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
             QVAPYK++R+V FI+S+PK+ +GKILRREL+
Sbjct  510  KQVAPYKKIRRVAFIDSIPKNPAGKILRRELV  541



>ref|XP_007017973.1| OPC-8:0 CoA ligase1 isoform 2 [Theobroma cacao]
 gb|EOY15198.1| OPC-8:0 CoA ligase1 isoform 2 [Theobroma cacao]
Length=550

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 157/210 (75%), Gaps = 1/210 (0%)
 Frame = -3

Query  818  VIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLGEIWVR  639
            ++QGYG+TE+ G+    ++    R  G+AG+L  ++EA+IV  D  + L   Q GE+W+R
Sbjct  341  ILQGYGLTESTGIGASTDSLEESRKYGTAGMLSPSMEAKIVDPDSGKALTVNQTGELWLR  400

Query  638  GPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGY-QVAPA  462
            GP++M+GY+ NP+AT  T+D +GW+ TGD+ Y + DG ++VVDR+KELIKYKGY QV PA
Sbjct  401  GPSIMKGYFSNPEATASTLDSEGWLKTGDICYIDDDGFIFVVDRLKELIKYKGYQQVPPA  460

Query  461  ELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAPYKRL  282
            ELE LL++HPEI DA VIP+PD E G+ P+AYVVR    +L+E  V  F+A QVAPYKR+
Sbjct  461  ELEALLLTHPEIFDAAVIPFPDKEVGQFPMAYVVRKTGCNLSETAVMDFVARQVAPYKRI  520

Query  281  RKVTFINSVPKSASGKILRRELIEKVRAKL  192
            RKV F++S+PK+ SGKILR++LI+   +KL
Sbjct  521  RKVAFVSSIPKNPSGKILRKDLIKLATSKL  550



>ref|XP_004970939.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Setaria italica]
Length=555

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 158/215 (73%), Gaps = 6/215 (3%)
 Frame = -3

Query  842  AKNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHL  672
            A  F    ++QGYG+TE+ G V      +GP  S   GS G L S +EA+IV     + L
Sbjct  335  AAIFPDIELVQGYGLTESSGSVA---ATVGPEESKAYGSVGKLSSHMEAKIVDPTTGEAL  391

Query  671  PPGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELI  492
             PGQ GE+WVRGP +M+GY  + +AT  T+D +GW+ TGDL YFN+DG LY+VDR+KELI
Sbjct  392  GPGQRGELWVRGPVIMKGYVGDDEATAATMDSEGWLKTGDLCYFNEDGFLYIVDRLKELI  451

Query  491  KYKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFI  312
            KYKGYQV PAELE +L SH +I DA VIPYPD + G++P+A++VR P S+LTE+ V  ++
Sbjct  452  KYKGYQVPPAELEHILNSHSDIMDAAVIPYPDEDVGQLPMAFIVRKPGSNLTEQQVMDYV  511

Query  311  AGQVAPYKRLRKVTFINSVPKSASGKILRRELIEK  207
            A QVAPYK++R+V F++++PKS +GKILRREL+++
Sbjct  512  AKQVAPYKKVRRVAFVSAIPKSPAGKILRRELVQQ  546



>ref|XP_008221158.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Prunus mume]
Length=568

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 157/210 (75%), Gaps = 0/210 (0%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQ  660
            + +   T++QGYG+TE+ GV    +     R  G+AGLL +++EA+IV  D  + L   Q
Sbjct  348  EKYPSVTILQGYGLTESTGVGASTDNLEESRRYGTAGLLSASMEAKIVDPDSGKALAVNQ  407

Query  659  LGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKG  480
             GE+W++GP +M+ Y+ N +AT  T+D QGW+ TGDL Y ++DG ++VVDR+KELIKYKG
Sbjct  408  TGELWLKGPTIMKEYFSNAEATAATLDAQGWLRTGDLCYIDEDGFIFVVDRLKELIKYKG  467

Query  479  YQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQV  300
            YQV PAELE LL++HP+I DA VIP+PD + G+ P+AYVVR   S+L+E+DV +F+  QV
Sbjct  468  YQVPPAELEALLLTHPQIVDAAVIPFPDDKVGQYPMAYVVRKAGSNLSEKDVMEFVGKQV  527

Query  299  APYKRLRKVTFINSVPKSASGKILRRELIE  210
            APYK++R+V FI SVPK+ SGKILR++LI+
Sbjct  528  APYKKIRRVAFIASVPKNPSGKILRKDLIQ  557



>emb|CDP07314.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            F + T++QGY +TE+ G     +T    R  G+AGLL  +VE +IV  D  + LP  + G
Sbjct  341  FPKVTIMQGYALTESTGGGASTDTMEESRRYGTAGLLSPSVEGRIVDSDSGRALPVNRTG  400

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            E+W+RGP +M+GY+ N +AT  T+   GW+ TGDL Y ++DG L++VDR+KELIKYKGYQ
Sbjct  401  ELWLRGPTIMKGYFNNEEATASTLYSDGWLRTGDLCYIDEDGFLFIVDRLKELIKYKGYQ  460

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            VAPAELE LL+ HPE+ DA VIP+PD E G+ P+AYVVR   S+++   V  FIA QVAP
Sbjct  461  VAPAELEALLLCHPEVADAAVIPFPDEEVGQFPMAYVVRKAGSTISGVAVIDFIAKQVAP  520

Query  293  YKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            YKR+R+V FI S+PK+ SGKILR++LI+   +KL
Sbjct  521  YKRIRRVAFIASIPKNPSGKILRKDLIQLAASKL  554



>gb|KHG15506.1| 4-coumarate--CoA ligase-like 9 [Gossypium arboreum]
Length=550

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 154/212 (73%), Gaps = 6/212 (3%)
 Frame = -3

Query  839  KNFXQATVIQGYGMTETCGVVCIENTRIGPRHS---GSAGLLVSAVEAQIVSVDKLQHLP  669
            + F    ++QGYG+TET G        +GP  +   G+ G L   +EA+IV  +  + LP
Sbjct  333  EKFPNVLLLQGYGLTETGGGA---TNVLGPEEAARYGTVGRLAENMEAKIVDPETGELLP  389

Query  668  PGQLGEIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIK  489
            PGQ GE+W+RGP +M+GY  + +AT  T+D +GW+ TGD+ YF+ +G LY+VDR+KELIK
Sbjct  390  PGQRGELWLRGPTVMKGYLGDEKATAGTLDSEGWLKTGDICYFDTEGFLYIVDRLKELIK  449

Query  488  YKGYQVAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIA  309
            YK YQV PAELE LL SHPEI DA VIPYPD EAG++P+AY+VR+P SSLT      FIA
Sbjct  450  YKAYQVPPAELEHLLHSHPEIADAAVIPYPDEEAGQIPMAYIVRNPGSSLTAAQTMDFIA  509

Query  308  GQVAPYKRLRKVTFINSVPKSASGKILRRELI  213
             QVAPYK++R+V FI+S+PK+ +GKILRREL+
Sbjct  510  KQVAPYKKIRRVAFIDSIPKNPAGKILRRELV  541



>ref|XP_009613176.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana tomentosiformis]
Length=556

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 157/214 (73%), Gaps = 0/214 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            +    ++QGYG+TE+ G+    ++    R  G+AG+L  ++ A+IV  +  + LP  + G
Sbjct  343  YPSVAILQGYGLTESTGIGASTDSLEESRRYGTAGMLSPSMSAKIVDPESGKALPVNKTG  402

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            E+W+RGP +M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYKGYQ
Sbjct  403  ELWLRGPTIMKGYFSNEEATASTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQ  462

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            V PAELE LL++HP+I DA VIP+PD + G+ P+AYVVR   S+++E  V  FIA QVAP
Sbjct  463  VPPAELEALLLNHPQISDAAVIPFPDKDVGQFPMAYVVRKSGSTMSESAVMDFIAKQVAP  522

Query  293  YKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            YKR+R+V F+ S+PK+ SGKILR++LI+   +KL
Sbjct  523  YKRIRRVAFVASIPKNPSGKILRKDLIKLATSKL  556



>ref|XP_009774473.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Nicotiana sylvestris]
Length=556

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 155/214 (72%), Gaps = 0/214 (0%)
 Frame = -3

Query  833  FXQATVIQGYGMTETCGVVCIENTRIGPRHSGSAGLLVSAVEAQIVSVDKLQHLPPGQLG  654
            +    ++QGYG+TE+  +    ++    R  G+AG+L  ++ A+IV  +  +  P  + G
Sbjct  343  YPSVAILQGYGLTESTAIGASTDSLEESRRYGTAGMLSPSMSAKIVDPESGKAFPVNKTG  402

Query  653  EIWVRGPNMMQGYYKNPQATKLTIDKQGWVHTGDLGYFNKDGMLYVVDRIKELIKYKGYQ  474
            E+W+RGP +M+GY+ N +AT  T+D +GW+ TGDL Y ++DG ++VVDR+KELIKYKGYQ
Sbjct  403  ELWLRGPTIMKGYFSNEEATASTLDSEGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQ  462

Query  473  VAPAELEGLLVSHPEIQDAVVIPYPDAEAGEVPVAYVVRSPNSSLTEEDVKKFIAGQVAP  294
            V PAELE LL++HPEI DA VIP+PD + G+ P+AYVVR   SSL+E  V  FIA QVAP
Sbjct  463  VPPAELEALLLTHPEISDAAVIPFPDKDVGQFPMAYVVRKSGSSLSESAVMDFIAKQVAP  522

Query  293  YKRLRKVTFINSVPKSASGKILRRELIEKVRAKL  192
            YKR+R+V F+ S+PK+ SGKILR++LI+   +KL
Sbjct  523  YKRIRRVAFVASIPKNPSGKILRKDLIKLATSKL  556



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1881220847521