BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12852

Length=1479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFU34347.1|  70-kDa heat shock protein                               726   0.0     Ipomoea batatas [batate]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       717   0.0     Glycine soja [wild soybean]
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     717   0.0     Glycine max [soybeans]
gb|AEO13403.1|  heat shock 70                                           713   0.0     Glycine max [soybeans]
gb|KJB16979.1|  hypothetical protein B456_002G258500                    716   0.0     Gossypium raimondii
gb|ACJ11741.1|  heat shock protein 70                                   716   0.0     Gossypium hirsutum [American cotton]
gb|KJB46580.1|  hypothetical protein B456_007G375600                    716   0.0     Gossypium raimondii
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         715   0.0     Jatropha curcas
gb|AAR17080.1|  heat shock protein 70-3                                 715   0.0     Nicotiana tabacum [American tobacco]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    714   0.0     Nicotiana tomentosiformis
ref|XP_012089411.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    715   0.0     
ref|XP_002527736.1|  heat shock protein, putative                       714   0.0     Ricinus communis
gb|ACJ11740.1|  heat shock protein 70                                   714   0.0     Gossypium hirsutum [American cotton]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    713   0.0     Nelumbo nucifera [Indian lotus]
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    709   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     713   0.0     Nicotiana sylvestris
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     712   0.0     
gb|AAP42157.1|AF509339_1  heat shock protein 70                         704   0.0     Saussurea medusa
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    712   0.0     Nicotiana sylvestris
gb|AAP04522.1|  heat shock protein 70                                   712   0.0     Nicotiana tabacum [American tobacco]
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     712   0.0     Nicotiana tomentosiformis
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     712   0.0     
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     711   0.0     
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       711   0.0     Cucurbita maxima [Boston marrow]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    711   0.0     Cicer arietinum [garbanzo]
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    711   0.0     Nicotiana tomentosiformis
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    711   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    711   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     711   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     711   0.0     Nelumbo nucifera [Indian lotus]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    710   0.0     Solanum lycopersicum
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    710   0.0     Fragaria vesca subsp. vesca
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    710   0.0     Solanum tuberosum [potatoes]
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    708   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|NP_195870.1|  heat shock cognate protein 70-1                       710   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          710   0.0     
emb|CAA52684.1|  heat shock protein 70 cognate                          710   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ACJ11745.1|  heat shock protein 70                                   709   0.0     Gossypium hirsutum [American cotton]
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    709   0.0     Camelina sativa [gold-of-pleasure]
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       709   0.0     Medicago truncatula
ref|XP_012089450.1|  PREDICTED: probable mediator of RNA polymera...    709   0.0     Jatropha curcas
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             709   0.0     Capsella rubella
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             709   0.0     Eutrema salsugineum [saltwater cress]
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    707   0.0     Glycine max [soybeans]
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       707   0.0     Glycine soja [wild soybean]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     709   0.0     Sesamum indicum [beniseed]
emb|CCA29121.1|  heat shock protein 70 isoform 2                        709   0.0     Solanum lycopersicum
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    709   0.0     Oryza brachyantha
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    708   0.0     Populus euphratica
ref|XP_006378714.1|  heat shock protein 70 cognate                      708   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002311161.1|  heat shock protein 70                              708   0.0     Populus trichocarpa [western balsam poplar]
emb|CDP09040.1|  unnamed protein product                                708   0.0     Coffea canephora [robusta coffee]
ref|XP_007009369.1|  Heat shock protein 70                              708   0.0     
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    708   0.0     Pyrus x bretschneideri [bai li]
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          707   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    708   0.0     Arabis alpina [alpine rockcress]
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    704   0.0     
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    708   0.0     Nicotiana tomentosiformis
ref|XP_012074911.1|  PREDICTED: probable mediator of RNA polymera...    708   0.0     Jatropha curcas
gb|AAB97316.1|  cytosolic heat shock 70 protein                         708   0.0     Spinacia oleracea
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     707   0.0     Prunus mume [ume]
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    707   0.0     Phoenix dactylifera
dbj|BAA34919.1|  heat shock protein 70 cognate                          698   0.0     Salix gilgiana
ref|NP_001068540.1|  Os11g0703900                                       707   0.0     
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    707   0.0     Sesamum indicum [beniseed]
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    707   0.0     Solanum lycopersicum
gb|ACJ11742.1|  heat shock protein 70                                   707   0.0     Gossypium hirsutum [American cotton]
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           707   0.0     Cucurbita maxima [Boston marrow]
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       704   0.0     Gossypium arboreum [tree cotton]
ref|XP_004142076.1|  PREDICTED: heat shock cognate 70 kDa protein 2     707   0.0     
gb|AAM48131.1|AF509336_1  heat shock protein 70                         707   0.0     Saussurea medusa
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    707   0.0     
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     707   0.0     
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    707   0.0     
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                707   0.0     Erythranthe guttata [common monkey flower]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     707   0.0     Cucumis melo [Oriental melon]
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             707   0.0     Citrus clementina [clementine]
emb|CAA54419.1|  heat shock cognate 70-1                                706   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873056.1|  HSC70-1                                            707   0.0     Arabidopsis lyrata subsp. lyrata
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    707   0.0     Prunus mume [ume]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     707   0.0     Triticum urartu
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             707   0.0     Phaseolus vulgaris [French bean]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             707   0.0     Prunus persica
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     707   0.0     Glycine soja [wild soybean]
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             706   0.0     Phaseolus vulgaris [French bean]
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             706   0.0     
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    706   0.0     Eucalyptus grandis [rose gum]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    706   0.0     Populus euphratica
ref|XP_002312090.1|  heat shock protein 70 cognate                      706   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    706   0.0     Solanum lycopersicum
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             706   0.0     Prunus persica
ref|XP_002532297.1|  heat shock protein, putative                       706   0.0     Ricinus communis
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    706   0.0     Nicotiana sylvestris
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     706   0.0     Vigna radiata [mung bean]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    706   0.0     Glycine max [soybeans]
emb|CDP00073.1|  unnamed protein product                                705   0.0     Coffea canephora [robusta coffee]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             706   0.0     Citrus clementina [clementine]
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    705   0.0     Glycine max [soybeans]
gb|AAV98051.1|  heat shock protein 70                                   706   0.0     Medicago sativa [alfalfa]
gb|AAV97978.1|  heat shock protein hsp70                                705   0.0     Saussurea medusa
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    706   0.0     Tarenaya hassleriana [spider flower]
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     705   0.0     Brachypodium distachyon [annual false brome]
emb|CAA47948.2|  heat shock protein 70                                  705   0.0     Oryza sativa Indica Group [Indian rice]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    705   0.0     Gossypium raimondii
emb|CAB72130.1|  heat shock protein 70                                  705   0.0     Cucumis sativus [cucumbers]
gb|KJB20110.1|  hypothetical protein B456_003G133400                    705   0.0     Gossypium raimondii
ref|XP_002312089.1|  heat shock protein 70 cognate                      705   0.0     
dbj|BAJ91305.1|  predicted protein                                      705   0.0     Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     705   0.0     
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    705   0.0     Nicotiana sylvestris
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     705   0.0     Populus euphratica
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             705   0.0     Citrus clementina [clementine]
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    705   0.0     Fragaria vesca subsp. vesca
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    705   0.0     Nicotiana tomentosiformis
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    705   0.0     Solanum tuberosum [potatoes]
ref|WP_039310754.1|  molecular chaperone DnaK                           704   0.0     Paenibacillus sp. IHB B 3415
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     704   0.0     Vigna radiata [mung bean]
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    704   0.0     Prunus mume [ume]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    704   0.0     Elaeis guineensis
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    695   0.0     Eucalyptus grandis [rose gum]
ref|NP_001292565.1|  heat shock cognate 70 kDa protein 2-like           704   0.0     Malus domestica [apple tree]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    704   0.0     Tarenaya hassleriana [spider flower]
ref|XP_002316294.1|  heat shock protein 70                              704   0.0     Populus trichocarpa [western balsam poplar]
gb|ADZ46371.1|  HSP70                                                   704   0.0     Malus hupehensis
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       704   0.0     Medicago truncatula
gb|ADD71975.1|  heat shock protein 70                                   704   0.0     Rhododendron calophytum
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    704   0.0     Populus euphratica
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        704   0.0     Morus notabilis
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     703   0.0     Eucalyptus grandis [rose gum]
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    703   0.0     
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    703   0.0     Solanum tuberosum [potatoes]
dbj|BAP90755.1|  heat shock protein 70                                  703   0.0     Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIU34470.1|  putative heat shock protein                             703   0.0     Taraxacum brevicorniculatum
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    703   0.0     Populus euphratica
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     703   0.0     
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    703   0.0     Populus euphratica
ref|XP_003621886.1|  Heat shock protein                                 703   0.0     Medicago truncatula
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     703   0.0     Glycine soja [wild soybean]
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    703   0.0     
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    703   0.0     Citrus sinensis [apfelsine]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     702   0.0     Elaeis guineensis
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             702   0.0     Arabidopsis lyrata subsp. lyrata
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    702   0.0     Phoenix dactylifera
gb|ACD93209.1|  heat shock protein 70                                   704   0.0     Camellia sinensis [black tea]
gb|AHW48175.1|  heat shock protein 70                                   698   0.0     Triticum aestivum [Canadian hard winter wheat]
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             702   0.0     Phaseolus vulgaris [French bean]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    702   0.0     Gossypium raimondii
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             702   0.0     Citrus clementina [clementine]
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     702   0.0     Vitis vinifera
gb|AEO22185.1|  CytHSP70                                                698   0.0     Triticum aestivum [Canadian hard winter wheat]
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    702   0.0     Phoenix dactylifera
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein       702   0.0     Cucumis sativus [cucumbers]
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    703   0.0     
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    702   0.0     Pyrus x bretschneideri [bai li]
ref|XP_002528432.1|  heat shock protein, putative                       701   0.0     Ricinus communis
ref|XP_006833219.1|  PREDICTED: heat shock cognate 70 kDa protein 2     702   0.0     Amborella trichopoda
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    701   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ85522.1|  unknown                                                 701   0.0     Medicago truncatula
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    701   0.0     
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    701   0.0     Cicer arietinum [garbanzo]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     701   0.0     Vitis vinifera
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             701   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    701   0.0     Setaria italica
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     701   0.0     Vitis vinifera
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          701   0.0     Sorghum bicolor [broomcorn]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    701   0.0     
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             701   0.0     Capsella rubella
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             701   0.0     Phaseolus vulgaris [French bean]
ref|XP_003621869.1|  Heat shock protein                                 701   0.0     Medicago truncatula
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    701   0.0     Zea mays [maize]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    701   0.0     Setaria italica
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    701   0.0     Pyrus x bretschneideri [bai li]
gb|AIZ68155.1|  heat shock protein 70                                   701   0.0     Ornithogalum longebracteatum [sea-onion]
gb|AAA62445.1|  heat shock protein                                      700   0.0     Spinacia oleracea
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    701   0.0     Pyrus x bretschneideri [bai li]
ref|NP_187864.1|  heat shock protein 70-4                               700   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    700   0.0     Phoenix dactylifera
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    700   0.0     Oryza brachyantha
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    700   0.0     Sesamum indicum [beniseed]
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    700   0.0     Elaeis guineensis
emb|CDY50531.1|  BnaA01g30490D                                          700   0.0     Brassica napus [oilseed rape]
emb|CDY52661.1|  BnaC01g38510D                                          700   0.0     Brassica napus [oilseed rape]
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    700   0.0     Solanum tuberosum [potatoes]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     703   0.0     Eucalyptus grandis [rose gum]
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       697   0.0     Phytolacca acinosa [food pokeberry]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    700   0.0     Tarenaya hassleriana [spider flower]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       699   0.0     Cucumis melo [Oriental melon]
gb|ABX76301.1|  heat shock protein 70                                   699   0.0     Ageratina adenophora
gb|ABD32895.1|  Heat shock protein Hsp70                                699   0.0     Medicago truncatula
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    699   0.0     Brassica rapa
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    699   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    699   0.0     Brassica rapa
emb|CDX73815.1|  BnaA03g32320D                                          699   0.0     
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    699   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     702   0.0     Eucalyptus grandis [rose gum]
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    699   0.0     Tarenaya hassleriana [spider flower]
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     702   0.0     Triticum urartu
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    699   0.0     
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     698   0.0     Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             698   0.0     Eutrema salsugineum [saltwater cress]
gb|ABP35942.1|  heat shock protein 70                                   698   0.0     Cyclamen persicum
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    698   0.0     
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    698   0.0     Glycine max [soybeans]
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    698   0.0     Tarenaya hassleriana [spider flower]
ref|NP_001051724.1|  Os03g0821100                                       698   0.0     
gb|AGR45355.1|  HSP70                                                   698   0.0     Dendrobium officinale
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    698   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    698   0.0     Camelina sativa [gold-of-pleasure]
ref|NP_001055754.1|  Os05g0460000                                       697   0.0     
emb|CAA05547.1|  heat shock protein 70                                  697   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    697   0.0     Cucumis melo [Oriental melon]
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    697   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             697   0.0     Phaseolus vulgaris [French bean]
emb|CDY00784.1|  BnaC03g37680D                                          697   0.0     
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        697   0.0     Morus notabilis
dbj|BAJ86014.1|  predicted protein                                      697   0.0     Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACB70177.1|  70 kDa heat shock protein                               697   0.0     Capparis spinosa [caper]
gb|AIA22210.1|  heat shock protein 70                                   697   0.0     Chrysanthemum indicum
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     696   0.0     Fragaria vesca subsp. vesca
emb|CAB72129.1|  heat shock protein 70                                  696   0.0     Cucumis sativus [cucumbers]
gb|AEK70336.1|  heat shock protein 70                                   696   0.0     Paeonia lactiflora [common garden peony]
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    696   0.0     Solanum lycopersicum
ref|NP_001044757.1|  Os01g0840100                                       696   0.0     
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                696   0.0     Erythranthe guttata [common monkey flower]
gb|AII99890.1|  heat shock protein                                      703   0.0     Cicer arietinum [garbanzo]
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     696   0.0     Phoenix dactylifera
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    696   0.0     Solanum lycopersicum
emb|CCA29120.1|  heat shock protein 70 isoform 1                        696   0.0     Solanum lycopersicum
gb|AAB42159.1|  Hsc70                                                   696   0.0     Solanum lycopersicum
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                696   0.0     Erythranthe guttata [common monkey flower]
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     695   0.0     Vigna radiata [mung bean]
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    695   0.0     Brachypodium distachyon [annual false brome]
gb|ACM42161.1|  heat shock protein 70.58                                695   0.0     Ageratina adenophora
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    694   0.0     Brachypodium distachyon [annual false brome]
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          694   0.0     Sorghum bicolor [broomcorn]
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       694   0.0     Cucurbita maxima [Boston marrow]
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    694   0.0     Cicer arietinum [garbanzo]
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    694   0.0     Fragaria vesca subsp. vesca
gb|AGL07711.1|  heat shock protein 70                                   694   0.0     Ziziphus jujuba [Chinese jujube]
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     694   0.0     Triticum urartu
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     693   0.0     Petunia x hybrida [garden petunia]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                693   0.0     Erythranthe guttata [common monkey flower]
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    693   0.0     Petunia x hybrida [garden petunia]
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       693   0.0     Glycine soja [wild soybean]
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    693   0.0     Brachypodium distachyon [annual false brome]
ref|XP_003625487.1|  Heat shock protein                                 696   0.0     
ref|NP_001049712.1|  Os03g0276500                                       693   0.0     
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  693   0.0     Morus notabilis
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    693   0.0     
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             692   0.0     
dbj|BAK00257.1|  predicted protein                                      692   0.0     Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA83548.1|  PsHSC71.0                                              692   0.0     Pisum sativum [garden pea]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    692   0.0     Solanum tuberosum [potatoes]
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    692   0.0     Setaria italica
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    692   0.0     
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       692   0.0     
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       694   0.0     Triticum urartu
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    692   0.0     Fragaria vesca subsp. vesca
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             692   0.0     Selaginella moellendorffii
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             692   0.0     Selaginella moellendorffii
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    694   0.0     
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    692   0.0     Brassica rapa
gb|AAB99745.1|  HSP70                                                   692   0.0     Triticum aestivum [Canadian hard winter wheat]
gb|KJB36734.1|  hypothetical protein B456_006G174000                    691   0.0     Gossypium raimondii
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             688   0.0     
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    691   0.0     Brassica rapa
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    705   0.0     
gb|EPS60056.1|  heat shock protein 70                                   691   0.0     Genlisea aurea
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    691   0.0     Phoenix dactylifera
gb|AFA51946.1|  heat shock protein 70                                   690   0.0     Paeonia suffruticosa [moutan peony]
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             690   0.0     Selaginella moellendorffii
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    690   0.0     
tpg|DAA44672.1|  TPA: hsp70 protein                                     685   0.0     
ref|XP_002873055.1|  predicted protein                                  689   0.0     Arabidopsis lyrata subsp. lyrata
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    688   0.0     Arabis alpina [alpine rockcress]
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    688   0.0     
dbj|BAJ34054.1|  unnamed protein product                                688   0.0     Eutrema halophilum
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             688   0.0     Eutrema salsugineum [saltwater cress]
gb|AAB88009.1|  heat shock cognate protein HSC70                        687   0.0     Brassica napus [oilseed rape]
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    687   0.0     
ref|XP_001783048.1|  predicted protein                                  687   0.0     
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             687   0.0     
emb|CDP09035.1|  unnamed protein product                                687   0.0     
gb|EPS68565.1|  hypothetical protein M569_06198                         686   0.0     
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       686   0.0     
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    686   0.0     
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    686   0.0     
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        686   0.0     
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       686   0.0     
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                686   0.0     
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          685   0.0     
ref|NP_001183165.1|  uncharacterized protein LOC100501536               685   0.0     
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             685   0.0     
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       685   0.0     
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                684   0.0     
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     688   0.0     
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          684   0.0     
dbj|BAK02194.1|  predicted protein                                      684   0.0     
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                684   0.0     
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       684   0.0     
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       684   0.0     
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        683   0.0     
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          682   0.0     
ref|XP_001767839.1|  predicted protein                                  682   0.0     
ref|NP_001140835.1|  uncharacterized protein LOC100272911               679   0.0     
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    682   0.0     
gb|ACR38891.1|  heat shock protein 70                                   681   0.0     
ref|NP_187555.1|  heat shock protein 70-3                               681   0.0     
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    681   0.0     
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       681   0.0     
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    681   0.0     
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                681   0.0     
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    681   0.0     
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    680   0.0     
ref|XP_001751923.1|  predicted protein                                  680   0.0     
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    679   0.0     
ref|NP_195869.1|  heat shock protein 70                                 680   0.0     
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       679   0.0     
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          676   0.0     
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    679   0.0     
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       679   0.0     
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    678   0.0     
gb|ACD45076.1|  heat-shock protein 70                                   678   0.0     
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    706   0.0     
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     703   0.0     
gb|ACJ54890.1|  heat shock protein 70                                   677   0.0     
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    677   0.0     
ref|XP_001785822.1|  predicted protein                                  677   0.0     
gb|AIU40169.1|  heat shock protein 70                                   676   0.0     
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    676   0.0     
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    675   0.0     
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    676   0.0     
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          675   0.0     
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             675   0.0     
ref|XP_001759874.1|  predicted protein                                  674   0.0     
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    674   0.0     
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    674   0.0     
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    674   0.0     
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    673   0.0     
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    678   0.0     
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    673   0.0     
gb|AAS09825.1|  heat shock cognate protein 70                           672   0.0     
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    671   0.0     
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    672   0.0     
gb|EPS64948.1|  hypothetical protein M569_09829                         671   0.0     
gb|KHN17505.1|  Heat shock 70 kDa protein                               666   0.0     
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    668   0.0     
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    667   0.0     
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    665   0.0     
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     662   0.0     
gb|ABR18415.1|  unknown                                                 662   0.0     
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             662   0.0     
ref|XP_003610287.1|  Heat-shock protein                                 661   0.0     
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        660   0.0     
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          661   0.0     
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               660   0.0     
gb|KHN14134.1|  Heat shock 70 kDa protein                               659   0.0     
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           648   0.0     
gb|AAA82975.1|  PsHSP71.2                                               656   0.0     
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    655   0.0     
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             655   0.0     
emb|CAA27330.1|  heat shock protein 70                                  651   0.0     
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          654   0.0     
ref|XP_002502667.1|  heat shock 70 kDa protein                          653   0.0     
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             652   0.0     
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    652   0.0     
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          652   0.0     
ref|XP_012067472.1|  PREDICTED: heat shock cognate 70 kDa protein...    651   0.0     
ref|XP_003064239.1|  heat shock protein 70kDa                           651   0.0     
prf||1205208A  heat shock protein hsp70                                 650   0.0  
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               650   0.0     
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        650   0.0     
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               650   0.0     
emb|CEG00633.1|  Heat shock protein 70 family                           649   0.0     
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               649   0.0     
tpg|DAA55190.1|  TPA: heat shock protein70-4                            644   0.0     
gb|KJB83911.1|  hypothetical protein B456_013G270600                    648   0.0     
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               648   0.0     
emb|CAA44820.1|  heat shock protein 70                                  645   0.0     
gb|ABK25453.1|  unknown                                                 647   0.0     
ref|XP_006368489.1|  heat shock protein 70 cognate                      648   0.0     
gb|KJB20862.1|  hypothetical protein B456_003G169700                    647   0.0     
emb|CDO98244.1|  unnamed protein product                                647   0.0     
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    647   0.0     
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             647   0.0     
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             647   0.0     
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               647   0.0     
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    646   0.0     
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          646   0.0     
gb|AGT97046.1|  heat shock protein 70                                   645   0.0     
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     650   0.0     
ref|XP_002512742.1|  heat shock protein, putative                       645   0.0     
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          645   0.0     
ref|XP_010094065.1|  Heat shock 70 kDa protein                          645   0.0     
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               644   0.0     
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   644   0.0     
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               644   0.0     
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               644   0.0     
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             643   0.0     
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     643   0.0     
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          642   0.0     
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          642   0.0     
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          642   0.0     
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  641   0.0     
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               641   0.0     
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          641   0.0     
ref|NP_173055.1|  heat shock protein 70B                                641   0.0     
emb|CCD74508.1|  early-responsive to dehydration 2                      639   0.0     
ref|XP_001767221.1|  predicted protein                                  639   0.0     
ref|XP_005643450.1|  heat shock protein 70                              639   0.0     
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    639   0.0     
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     643   0.0     
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          639   0.0     
ref|XP_002512741.1|  heat shock protein, putative                       639   0.0     
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          638   0.0     
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          639   0.0     
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          639   0.0     
ref|XP_001781229.1|  predicted protein                                  638   0.0     
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    638   0.0     
ref|XP_007023492.1|  Heat shock protein 70B                             637   0.0     
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    637   0.0     
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    637   0.0     
ref|XP_012067473.1|  PREDICTED: heat shock 70 kDa protein 5-like        637   0.0     
emb|CDY33359.1|  BnaC05g12240D                                          632   0.0     
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             636   0.0     
ref|XP_007512662.1|  Heat Shock Protein 70, cytosolic                   637   0.0     
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    634   0.0     
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        635   0.0     
ref|XP_007013854.1|  Heat shock protein 70B                             635   0.0     
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          635   0.0     
emb|CDY35063.1|  BnaA06g10730D                                          629   0.0     
emb|CDX96825.1|  BnaA08g23680D                                          634   0.0     
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          634   0.0     
emb|CDX83960.1|  BnaC08g16850D                                          634   0.0     
ref|XP_002892893.1|  HSP70B                                             633   0.0     
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             632   0.0     
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          634   0.0     
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          633   0.0     
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             632   0.0     
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               632   0.0     
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     631   0.0     
dbj|BAJ34597.1|  unnamed protein product                                632   0.0     
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   632   0.0     
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             632   0.0     
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          632   0.0     
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        631   0.0     
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein               630   0.0     
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        630   0.0     
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     633   0.0     
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               630   0.0     
ref|XP_010091163.1|  Heat shock 70 kDa protein                          630   0.0     
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    640   0.0     
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             629   0.0     
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                629   0.0     
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             628   0.0     
emb|CDY40362.1|  BnaA10g27060D                                          620   0.0     
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             628   0.0     
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          628   0.0     
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg                628   0.0     
dbj|BAA04848.1|  HSP70                                                  627   0.0     
gb|AAX07349.1|  heat shock protein 70                                   616   0.0     
gb|EPS69582.1|  heat shock protein hsp70                                624   0.0     
ref|NP_001049719.2|  Os03g0277300                                       615   0.0     
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like          625   0.0     
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    624   0.0     
ref|XP_006826662.1|  PREDICTED: heat shock 70 kDa protein 5             622   0.0     
ref|XP_002891955.1|  early-responsive to dehydration 2                  620   0.0     
emb|CDP02832.1|  unnamed protein product                                622   0.0     
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         620   0.0     
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          619   0.0     
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          617   0.0     
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    616   0.0     
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    616   0.0     
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       613   0.0     
gb|ACC93947.1|  heat-shock protein 70                                   614   0.0     
ref|XP_006368490.1|  heat shock protein 70 cognate                      613   0.0     
ref|NP_176036.1|  heat shock protein ERD2                               612   0.0     
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          613   0.0     
ref|XP_001701326.1|  heat shock protein 70A                             612   0.0     
gb|AEX55235.1|  heat shock protein 70                                   601   0.0     
ref|XP_002947129.1|  heat-shock inducible Hsp70                         611   0.0     
gb|ABR01232.1|  heat shock protein 70                                   610   0.0     
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like          610   0.0     
dbj|BAE48223.1|  heat shock protein 70                                  608   0.0     
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   605   0.0     
gb|ABR01238.1|  heat shock protein 70                                   605   0.0     
ref|XP_010678398.1|  PREDICTED: heat shock 70 kDa protein-like          606   0.0     
gb|AEY80026.1|  heat shock protein 70                                   605   0.0     
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427             605   0.0     
sp|P25840.2|HSP70_CHLRE  RecName: Full=Heat shock 70 kDa protein        604   0.0     
ref|XP_002279097.1|  PREDICTED: heat shock cognate 70 kDa protein       604   0.0     
emb|CAN66715.1|  hypothetical protein VITISV_041184                     603   0.0     
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126             603   0.0     
gb|KIY98980.1|  heat shock 70kDa protein 1/8                            603   0.0     
gb|ACX42438.1|  70 kDa heat shock protein                               600   0.0     
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       595   0.0     
gb|KDD74618.1|  heat shock protein Hsp70                                594   0.0     
gb|KDP44978.1|  hypothetical protein JCGZ_01478                         593   0.0     
gb|KDP44977.1|  hypothetical protein JCGZ_01477                         593   0.0     
ref|XP_012089365.1|  PREDICTED: heat shock cognate 70 kDa protein...    593   0.0     



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/415 (97%), Positives = 406/415 (98%), Gaps = 1/415 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPR+LRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL E+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDa-phaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGDMGGAMDEDA       +GA AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDMGGAMDEDAPHAGGSSAGASAGPKIEEVD  652



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/414 (95%), Positives = 405/414 (98%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GN RALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  235   DFDNRMVNHFVQEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  294

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  295   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  354

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  355   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSTGLETAGGVMT  414

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  415   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  474

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  475   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  534

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLSSDDKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  535   HKKKVEAKNALENYAYNMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADE  594

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  595   FEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  646



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/414 (95%), Positives = 405/414 (98%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GN RALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSTGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLSSDDKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  649



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/414 (95%), Positives = 405/414 (98%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GN RALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  149   DFDNRMVNHFVQEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  208

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  209   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  268

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  269   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  328

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  329   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  388

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  389   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  448

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  449   HKKKVEAKNTLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADE  508

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  509   FEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  560



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/414 (95%), Positives = 405/414 (98%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNTVKDEKIGSKLS DDKKKIEDAIE+AIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTVKDEKIGSKLSPDDKKKIEDAIEEAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAGGDMGG+MDED   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESVCNPIIAKMYQGAGGDMGGSMDED---APPSGGSGAGPKIEEVD  648



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/414 (95%), Positives = 405/414 (98%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKLS DDKK+IEDAIE+AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSPDDKKRIEDAIEEAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAGGDMGG+MDED   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESVCNPIIAKMYQGAGGDMGGSMDED---APPSGGSGAGPKIEEVD  648



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/414 (95%), Positives = 402/414 (97%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG+KL + DKKKIEDAIEQAIQWL+ NQLAESDE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGDMGG MDED        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDMGGGMDED----VTAGGSGAGPKIEEVD  647



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/414 (94%), Positives = 404/414 (98%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKISSKLATDDKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG D+GG+MD+D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADVGGSMDDD---VPPAGGSGAGPKIEEVD  648



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKLSSDDKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSSAGPKIEEVD  648



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/414 (94%), Positives = 400/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKLSSDDKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSGAGPKIEEVD  648



>ref|XP_012089411.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate 70 kDa protein 
2-like [Jatropha curcas]
Length=661

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/414 (94%), Positives = 404/414 (98%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKISSKLATDDKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG D+GG+MD+D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADVGGSMDDD---VPPAGGSGAGPKIEEVD  648



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/414 (95%), Positives = 401/414 (97%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG+KLS  DKKKIEDAIE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGAKLSPADKKKIEDAIESAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+MG  MDED    A   G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEMGAGMDED----APAGGSGAGPKIEEVD  647



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/414 (94%), Positives = 400/414 (97%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVA GAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVACGAAVQAAILSGEGNEKVQDLLLLDVTPLSSGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG+KL + DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGDMGG MDED        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDMGGGMDED----VPAGGSGAGPKIEEVD  647



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 395/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSSGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNTVKDEKIG+KL+  DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG D G  MDED        G GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGPDAGAGMDED---GPSVGGTGAGPKIEEVD  648



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/414 (93%), Positives = 400/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  133   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  192

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  193   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  252

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  253   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  312

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  313   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  372

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  373   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  432

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  433   HKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADE  492

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  493   FDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  544



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/381 (97%), Positives = 379/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRKSKKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNTVKDEKI SKLS++DKKKIEDAIE+AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYSYNMRNTVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE ICNPIIAKMYQ
Sbjct  598   FEDKMKELEGICNPIIAKMYQ  618



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/414 (95%), Positives = 405/414 (98%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GN RALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNTLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  649



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 396/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  18    DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  77

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIPKVQQLLQ
Sbjct  78    DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQ  137

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  138   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  197

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  198   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  257

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  258   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  317

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQLAE+DE
Sbjct  318   HKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADE  377

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQG  GD  G MDED    A  SG GAGPKIEEVD
Sbjct  378   FEDKMKELENVCNPIIAKMYQGGAGDAAGGMDED----AAPSGGGAGPKIEEVD  427



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSGAGPKIEEVD  648



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 398/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTR NNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRANNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKLSSDDKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSSAGPKIEEVD  648



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/381 (97%), Positives = 379/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRKSKKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNTVKDEKI SKLS++DKKKIEDAIE+AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYSYNMRNTVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE +CNPIIAKMYQ
Sbjct  598   FEDKMKELEGLCNPIIAKMYQ  618



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/381 (97%), Positives = 379/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKLS+DD+ KIEDAIEQAIQWL+GNQLAE++E
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/414 (94%), Positives = 401/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIG+KL+  DKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGAKLTPADKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGG M++D       SG+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGPDMGGPMEDD---VPPASGSGAGPKIEEVD  648



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/381 (97%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV DEKIG+KLS  DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVNDEKIGAKLSQADKKKIEDAIEQAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/414 (94%), Positives = 405/414 (98%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLSTDDKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIA+MYQGAGGD GGAMDED      GSG+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIARMYQGAGGDAGGAMDED--GPTTGSGSGAGPKIEEVD  649



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 395/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKLS DDKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSVDDKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAGGD G  MD+D         + AGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGAGGDAGAPMDDD---VPPAGASSAGPKIEEVD  648



>ref|XP_010452093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Camelina sativa]
 ref|XP_010452094.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Camelina sativa]
 ref|XP_010490701.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGGPGAAGMDDDAPPASGGAGPKIEEVD  651



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 400/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL++ D+KKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLAAADRKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DM G MD+D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADMAGEMDDD---VPAAGGSGAGPKIEEVD  648



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 401/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+ D+KI SKL++ DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTINDDKIASKLAAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELESICNPIIAKMYQGAG DM G MD+D   A    G+GAGPKIEEVD
Sbjct  598   FDDKMKELESICNPIIAKMYQGAGADMAGGMDDD---APPAGGSGAGPKIEEVD  648



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/414 (94%), Positives = 400/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNTVKDEKIG+KL+  DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELESICNPIIAKMYQGAG DMGG MD++        G+GAGPKIEEVD
Sbjct  598   FDDKMKELESICNPIIAKMYQGAGPDMGGGMDDE---GPSVGGSGAGPKIEEVD  648



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 378/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANG LNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGTLNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKLS+DD+ KIEDAIEQAIQWL+GNQLAE++E
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 394/414 (95%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIG KL   DKKKIEDAIE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGEKLPGADKKKIEDAIEAAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG+G D  G +D+D          GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGSGPDGAGPVDDD----VPAGSGGAGPKIEEVD  647



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 378/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDV PLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVAPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKLS+DDK KI+DAIEQAIQWL+GNQLAE++E
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDKTKIDDAIEQAIQWLDGNQLAEAEE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/414 (93%), Positives = 400/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  191   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  250

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  251   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  310

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  311   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  370

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  371   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  430

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  431   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  490

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  491   HKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADE  550

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  551   FDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  602



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  651



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 397/414 (96%), Gaps = 5/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG+KL   DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGG  ++         G GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADMGGMDED-----VPAGGNGAGPKIEEVD  646



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  651



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/414 (94%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKL   DKKKIEDAI+ AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGG MDED   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADMGGGMDED---APPTGGSSAGPKIEEVD  648



>ref|XP_010423853.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 393/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL   DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPVADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGGPGAAGMDDDAPPASGGAGPKIEEVD  651



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/414 (94%), Positives = 403/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIE AIQWL+GNQL E+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIA+MYQGAGGD GGAMDED      GSG+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIARMYQGAGGDAGGAMDED--GPTAGSGSGAGPKIEEVD  649



>ref|XP_012089450.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Jatropha curcas]
 gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 398/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNTVKDEKI SKL++DDKKKIEDAIEQAI WL+ NQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTVKDEKISSKLAADDKKKIEDAIEQAIHWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG+G DM G MDED   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGSGPDMAGGMDED---APPAGGSSAGPKIEEVD  648



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGGPGAGGMDDDAPPASGGAGPKIEEVD  651



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG         A  S  GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGGPGAAGMDDDAPPSSGGAGPKIEEVD  651



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 390/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  175   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  234

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  235   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  294

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  295   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  354

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  355   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  414

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  415   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  474

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQLAE+DE
Sbjct  475   HKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADE  534

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES CNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  535   FEDKMKELESTCNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  586



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 392/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  175   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  234

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK TVHDVVLVGGSTRIPKVQQLLQ
Sbjct  235   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKRTVHDVVLVGGSTRIPKVQQLLQ  294

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  295   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  354

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  355   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  414

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  415   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  474

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNT+KDEKIG KL   DKKKIEDAIEQAIQWL+ NQL E+DE
Sbjct  475   HKKKVEAKNALENYSYNMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLGEADE  534

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G   G   +D       +G+GAGPKIEEVD
Sbjct  535   FEDKMKELESICNPIIAKMYQGGAGPDVGGAMDD---DVPAAGSGAGPKIEEVD  585



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/381 (97%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKI SKL + DKKKIEDAIE +IQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 378/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKI ITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKIPITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKLS+DD+ KIEDAIEQAIQWL+GNQLAE++E
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 400/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  598   FDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  649



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 403/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KN+LENYAYNMRNTVKDEKI SKL++DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNSLENYAYNMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELESICNPIIAKMYQGAG DMGG MD+D   A    G+GAGPKIEEVD
Sbjct  598   FDDKMKELESICNPIIAKMYQGAGPDMGGGMDDD---APPAGGSGAGPKIEEVD  648



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 403/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KN+LENYAYNMRNTVKDEKI SKL++DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNSLENYAYNMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELESICNPIIAKMYQGAG DMGG MD+D   A    G+GAGPKIEEVD
Sbjct  598   FDDKMKELESICNPIIAKMYQGAGPDMGGGMDDD---APPSGGSGAGPKIEEVD  648



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 400/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS+ITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSSITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKL+  DKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLNPADKKKIEDAIDQAIHWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG G DMGG MDED   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGDGADMGGRMDED---APSTGGSGAGPKIEEVD  648



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/381 (97%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKLS  DKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSPADKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/414 (93%), Positives = 398/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKK EAKN+LENYAYNMRNTVKDEKIGSKLS DDKKKIEDAI+ A+QWL+GNQLAE+DE
Sbjct  538   HKKKAEAKNSLENYAYNMRNTVKDEKIGSKLSPDDKKKIEDAIDGAVQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGGA   D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGPDMGGAGMAD--DIPPAGGSGAGPKIEEVD  649



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 397/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGD  G +D+D    A  S +G GPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDGAGPVDDD----APPSASGPGPKIEEVD  647



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/414 (93%), Positives = 400/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  221   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  280

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  281   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  340

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  341   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  400

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  401   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  460

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  461   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  520

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  521   HKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADE  580

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  581   FDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  632



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_004492129.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=542

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  133   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  192

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  193   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  252

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  253   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  312

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  313   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  372

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  373   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  432

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KD+KI SKLS  DKK IEDAIEQAIQWL+ NQLAE+DE
Sbjct  433   HKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADE  492

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE+ICNPIIAKMYQ
Sbjct  493   FEDKMKELETICNPIIAKMYQ  513



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 397/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHD+VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDIVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI++AI WL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDEAISWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DM G MDED         +GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGPDMAGGMDED---GPSAGASGAGPKIEEVD  648



>ref|XP_012074911.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Jatropha curcas]
 gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/381 (97%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNTVKDEKIG+KLS  DKKKIEDAIE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYSYNMRNTVKDEKIGAKLSPADKKKIEDAIEAAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 396/414 (96%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNTVKDEKI SK+S  DKKKIE++I+ AI WLE NQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTVKDEKISSKISEADKKKIEESIDNAINWLESNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG   +D    + G+ +G GPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGEAGGVPMDDDEVPSAGASSGPGPKIEEVD  651



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRD+KMDKS+VH+VVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDSKMDKSSVHEVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAIEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAG DM   M++D   A    G+G+GPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGAGPDMADGMNDD---APAAGGSGSGPKIEEVD  648



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/411 (92%), Positives = 397/411 (97%), Gaps = 3/411 (1%)
 Frame = +3

Query  12    NRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFY  191
             NRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFY
Sbjct  1     NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY  60

Query  192   STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF  371
             STITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHD VLVGGSTRIPKVQQLLQDFF
Sbjct  61    STITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSSVHDAVLVGGSTRIPKVQQLLQDFF  120

Query  372   NGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMTVLI  551
             NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
Sbjct  121   NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI  180

Query  552   PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI  731
             PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
Sbjct  181   PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI  240

Query  732   TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKK  911
             TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+HKK
Sbjct  241   TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKK  300

Query  912   KVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDEFED  1091
             KVE+KN+LENYAYNMRNTVKDEKI SKL +DDKKKIEDAI+QAIQWL+ NQLAE+DEFED
Sbjct  301   KVESKNSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQLAEADEFED  360

Query  1092  KMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             KMKELESICNPIIAKMYQGAG DMGG M++D   A     +GAGPKIEEVD
Sbjct  361   KMKELESICNPIIAKMYQGAGADMGGGMEDD---APPSGSSGAGPKIEEVD  408



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/414 (93%), Positives = 400/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  598   FDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  649



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIE +IQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 399/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK+++HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL   D+KKIE+AIEQAIQWL+ NQLAESDE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGDMG  M +D    A   G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDMGADMGDD--GPAPSGGSGAGPKIEEVD  649



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 400/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KDEKIGSKL   DKKKIEDAI+ AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGG MDED   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADMGGGMDED---APPTGGSGAGPKIEEVD  648



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/381 (97%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV DEKIG+KLS  DKKKIEDAIEQ+IQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIEDAIEQSIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 398/414 (96%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  158   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  217

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  218   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  277

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  278   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  337

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  338   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  397

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  398   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  457

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNT+KDEKI SKL + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  458   HKKKVEAKNGLENYAYNMRNTIKDEKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADE  517

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAGGDMG    +D    + G G+GAGPKIEEVD
Sbjct  518   FEDKMKELEGICNPIIAKMYQGAGGDMGAGPMDD-DGPSVGGGSGAGPKIEEVD  570



>ref|XP_004142076.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV DEKIG+KLS  DKKKI+DAIEQ+IQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 396/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQG  GD  G MDED    A  SG GAGPKIEEVD
Sbjct  598   FEDKMKELENVCNPIIAKMYQGGAGDAAGGMDED----AAPSGGGAGPKIEEVD  647



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 395/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  239   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  298

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  299   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  358

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  359   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  418

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  419   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  478

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDED
Sbjct  479   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDED  538

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AI WL+GNQLAE+DE
Sbjct  539   HKKKVEAKNALENYAYNMRNTIKDEKIAAKLPAADKKKIEDAIEKAISWLDGNQLAEADE  598

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAG DM G MDED        G+ AGPKIEEVD
Sbjct  599   FEDKMKELEGICNPIIAKMYQGAGADMAGGMDED---GPTTGGSSAGPKIEEVD  649



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 397/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAG DM G MD+D       +  G GPKIEEVD
Sbjct  598   FEDKMKELEALCNPIIAKMYQGAGADMEGGMDDD----TPAASGGPGPKIEEVD  647



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 397/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG   G +D+D    A  S +G GPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGXGAGPVDDD---DAPPSASGPGPKIEEVD  648



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/414 (92%), Positives = 393/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIE +IQWL+ NQLAESDE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIEASIQWLDANQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQ   G  G A  +D   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQ---GAGGEAPMDDDEAAPSHGGSTAGPKIEEVD  648



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV DEKIG+KLS  DKKKI+DAIEQ+IQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKL+  DKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLAPADKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>emb|CAA54419.1| heat shock cognate 70-1 [Arabidopsis thaliana]
Length=637

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 392/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  224   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  283

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  284   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  343

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINP EAV YGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  344   DFFNGKELCKSINPVEAVVYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  403

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  404   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  463

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNK+TITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  464   PQITVCFDIDANGILNVSAEDKTTGQKNKVTITNDKGRLSKDEIEKMVQEAEKYKSEDEE  523

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  524   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  583

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  584   FEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  637



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 395/414 (95%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG D  G +D++    A    +G GPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADGAGPVDDE----APAGASGPGPKIEEVD  647



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 398/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAG DM G MD+D       +  GAGPKIEEVD
Sbjct  598   FEDKMKELEALCNPIIAKMYQGAGADMEGGMDDD----TPAASGGAGPKIEEVD  647



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 390/414 (94%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK TVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKRTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL   DKKKIEDA+EQ IQWL+ NQL E+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDTNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQG  G   G   +D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGGAGPDMGGAMDD---DVPAGGSGAGPKIEEVD  648



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 396/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG   G   ++        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGPDVGGGMDE--DVPPAGGSGAGPKIEEVD  649



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 390/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES CNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  598   FEDKMKELESTCNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGK+LCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKDLCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLSS+DK KI++AIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKISSKLSSEDKTKIDNAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE ICNPIIAKMYQ
Sbjct  598   FEDKMKELEGICNPIIAKMYQ  618



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 395/414 (95%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  226   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  285

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  286   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  345

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  346   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  405

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  406   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  465

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  466   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  525

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQLAE+DE
Sbjct  526   HKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADE  585

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG D  G +D++    A    +G GPKIEEVD
Sbjct  586   FEDKMKELESICNPIIAKMYQGAGADGAGPVDDE----APAGASGPGPKIEEVD  635



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI +KLS  DKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKISAKLSDGDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGS+LS  DKKKIEDAI+QAIQWL+ NQLAE DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGG+MDED        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGPDMGGSMDED---IPSTGGSGAGPKIEEVD  648



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPR+LRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KN+LENYAYNMRNTVKDEKI SKL +DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDTNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGG M+ED   A      GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADMGGGMEED---APPAGSGGAGPKIEEVD  648



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 397/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKISSKLSADDKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAGG+ G  MD+D   A      GAGPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGAGGEAGAPMDDD--DAPPAGSTGAGPKIEEVD  649



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 396/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+ NPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISNNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV+DEKIGSKL+  DKKKIED++E AIQWL+GNQLAE DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQLAECDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAG + GG   +D   A   + +GAGPKIEEVD
Sbjct  598   FEDKMKELENLCNPIIAKMYQGAGAEAGGGGVDD--DAPPPAASGAGPKIEEVD  649



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKI SKL + DKK+IEDAI+ AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKISSKLDAADKKRIEDAIDGAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESVCNPIIAKMYQ  618



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKI SKL   DKKKIEDAIE AIQWL+ NQLAESDE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIASKLPEADKKKIEDAIEAAIQWLDANQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESVCNPIIAKMYQ  618



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 402/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GN RALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDV+PLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVSPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQINVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KDEKI SKL +DDKKKIEDAI+QAIQWL+GNQL E+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDEKIASKLPADDKKKIEDAIDQAIQWLDGNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A  SG+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAPASGSGAGPKIEEVD  649



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 390/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIE AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKISSKLPAADKKKIEDAIEGAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 400/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQG G D G +MDED    + G+G+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGGGADAGASMDED--GPSAGAGSGAGPKIEEVD  649



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 394/414 (95%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGK+LCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKDLCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE KNALENYAYNMRNT+KDEKI SKLSS+DK KI++AIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEGKNALENYAYNMRNTIKDEKISSKLSSEDKTKIDNAIEQAIQWLDTNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQG  G  G   D+    A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGGAGTGGDVDDD----APPAGGSGAGPKIEEVD  647



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 390/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KDEKI SKLS  DKK+IEDAIE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE+ICNPIIAKMYQ  GG   G   +D          GAGPKIEEVD
Sbjct  598   FEDKMKELETICNPIIAKMYQ--GGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 396/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVC+DIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCYDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQG  GD  G MDED    A  SG GAGPKIEEVD
Sbjct  598   FEDKMKELENVCNPIIAKMYQGGAGDAAGGMDED----AAPSGGGAGPKIEEVD  647



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 392/414 (95%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYST TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTFTRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIGSKLS DDKKKIED I++AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIRDEKIGSKLSPDDKKKIEDTIDEAIQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG+     G  D D   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGSAASTEGNADVD-ADAPPSGGSTAGPKIEEVD  650



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/414 (92%), Positives = 396/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAG DM G+  ++       +  G GPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGAGADMEGSGMDE---DTPAASGGPGPKIEEVD  648



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 399/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  297   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ AEKYKSEDE+
Sbjct  477   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQGAEKYKSEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  537   HKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  597   FDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  648



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 398/414 (96%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKINSKLPAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAGGDMG    +D    + G G+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGAGGDMGAGPMDD-DGPSVGGGSGAGPKIEEVD  650



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQ+FKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQKFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV DEKIG+KLS  DKKKI+DAIEQ+IQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|KJB20110.1| hypothetical protein B456_003G133400 [Gossypium raimondii]
Length=648

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 395/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG+KL+  DKK+IEDA+EQ I WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGAKLNPADKKRIEDAVEQTINWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAGG+       +   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELENMCNPIIAKMYQGAGGEPAAGKAGE---APPAGGSGAGPKIEEVD  648



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 378/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYSYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 397/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIE+AI+ AIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAG DM G MD+D       +  G GPKIEEVD
Sbjct  598   FEDKMKELEALCNPIIAKMYQGAGADMEGGMDDD----TPAASGGPGPKIEEVD  647



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 394/414 (95%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIED I+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDTIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAGG   G   +D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGAGGPDVGGXMDD--DVPXAGGSGAGPKIEEVD  649



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 389/414 (94%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHD+VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDIVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPP+PRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPSPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQ  G     A   D         +GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQDGGAGPDMAGGMD-EDGPSAGASGAGPKIEEVD  650



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 378/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSSVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/381 (96%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKL   DKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 389/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SK+   DKKKIEDAIE+AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKIDPSDKKKIEDAIEEAIHWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQG          +         G+GAGPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGGAAPDMSGGAD--ADVPPSGGSGAGPKIEEVD  649



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKI SKL   DKKKIE+AIE AIQWL+ NQLAESDE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIASKLPEADKKKIEEAIESAIQWLDANQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/414 (93%), Positives = 398/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMV HFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVTHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK+++HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL   D+KKIE+AIEQAIQWL+ NQLAESDE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGGDMG  M +D    A   G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGDMGADMGDD--GPAPSGGSGAGPKIEEVD  649



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNTVKDEKIG KL + DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNTLENYAYNMRNTVKDEKIGEKLPAADKKKIEDAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 390/414 (94%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK TVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKRTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL   DKKKIEDA+EQ IQWL+ NQL E+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDSNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G   G   +D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGPDMGGGMDD---DVPAGGSGAGPKIEEVD  648



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 395/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+ NPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISNNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCL DAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLTDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV+DEKIGSKL+  DKKKIED++E AIQWL+GNQLAE DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQLAECDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAG + GG   +D    A  + +GAGPKIEEVD
Sbjct  598   FEDKMKELENLCNPIIAKMYQGAGAEAGGGGVDD---DAPPAASGAGPKIEEVD  648



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 397/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIA+MYQGAG D+ G M +D   +    G+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIARMYQGAGADVAGGMGDD---SPPAGGSGAGPKIEEVD  648



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 396/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  5     DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  64

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  65    DFYTTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  124

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  125   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  184

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTT+PTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  185   VLIPRNTTVPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  244

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  245   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  304

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AI WL+GNQLAE+DE
Sbjct  305   HKKKVDAKNALENYAYNMRNTIKDEKISAKLPAADKKKIEDAIEEAIHWLDGNQLAEADE  364

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAG DMGG MDED        G+GAGPKIEEVD
Sbjct  365   FEDKMKELEGICNPIIAKMYQGAGPDMGGGMDED---VPPAGGSGAGPKIEEVD  415



>ref|NP_001292565.1| heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 390/414 (94%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+ +PRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISSSPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTT+PTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTVPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G        D        G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGGPDVGGGMD-EDVPPAGGSSAGPKIEEVD  650



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPK QQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKFQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNTVKDEKIG KL + DKKKIEDAIEQAIQWLEGNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTVKDEKIGEKLPAADKKKIEDAIEQAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/414 (93%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+G+PRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGSPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGS+LS  DKKKIEDAI+QAIQWL+ NQLAE DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMGG+MDED        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGPDMGGSMDED---IPSTGGSGAGPKIEEVD  648



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 390/414 (94%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+ +PRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISSSPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTT+PTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTVPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G        D        G+ AGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGGPDVGGGMD-EDVPPAGGSSAGPKIEEVD  650



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/414 (93%), Positives = 403/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HK+KVEAKNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIE AIQWL+GNQL E+DE
Sbjct  538   HKRKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIA+MYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIARMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  649



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPR+LRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HK+KVEAKNALENYAYNMRNTVKDEKIGSKL   DKKKIEDAI+ AI WL+ NQLAE+DE
Sbjct  538   HKRKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDGAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG   G    D   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGADMGGAGMDDDDAPPAGGSGAGPKIEEVD  651



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 378/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKD+KI SKL++DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 391/414 (94%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDV+PLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVSPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNTVKDEKI SKLS  DKKKIEDAI+ AIQWL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTVKDEKISSKLSPSDKKKIEDAIDGAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAGG   G    D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGGPDVGGAGMDEDDVPPAGGSGAGPKIEEVD  651



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI +KLS  DKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKISAKLSEGDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KD+KI SKLS  DKK IEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE+ICNPIIAKMYQ
Sbjct  598   FEDKMKELETICNPIIAKMYQ  618



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/414 (93%), Positives = 396/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
              KKKVEAKN+LENYAYNMRNTVKDEKIGSKLSSDDKKKIEDA++QAI WLE NQLAE DE
Sbjct  538   LKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAGGD G  MD+D   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGAGGDAGVPMDDD---APPSGGSSAGPKIEEVD  648



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 395/414 (95%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQG  GD  G MDE+       SG GAGPKIEEVD
Sbjct  598   FEDKMKELENVCNPIIAKMYQGGAGDAAGGMDEE----PAPSGGGAGPKIEEVD  647



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/414 (92%), Positives = 393/414 (95%), Gaps = 5/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPADKKKIEDAIDEAIAWLDTNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQG  G+  G  +E        SG GAGPKIEEVD
Sbjct  598   FEDKMKELENVCNPIIAKMYQGGAGEAAGMDEE-----PAPSGGGAGPKIEEVD  646



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSSVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE KNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVETKNALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 397/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDDKIASKLAADDKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE +CNPIIAKMYQGAG +M G MDED    A G       KIEEVD
Sbjct  598   FDDKMKELEGLCNPIIAKMYQGAGANMAGGMDEDDAPPAAGGAGP---KIEEVD  648



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/414 (93%), Positives = 399/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSSVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIGSKL+  +KKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLNPAEKKKIEDAIDQAIHWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKE+ESICNPIIAK+YQG G DMGG MDED   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKEVESICNPIIAKIYQGDGADMGGRMDED---APSTGGSGAGPKIEEVD  648



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/414 (91%), Positives = 389/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMV HFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  238   DFDNRMVTHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KDEKI SKLS  DKK+IEDAIE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE+ICNPIIAKMYQ  GG   G   +D          GAGPKIEEVD
Sbjct  598   FEDKMKELETICNPIIAKMYQ--GGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 389/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELN DLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNRDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPR+LRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 397/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
              FFNGKELCKSINPDEAVA GAAV AAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   GFFNGKELCKSINPDEAVACGAAVHAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED++
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQG G D G +MDED    + G+G+GAGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGGGADAGASMDED--GPSAGAGSGAGPKIEEVD  649



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 400/414 (97%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDITGN RALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKHKKDITGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRD+KMDKS+VH+VVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDSKMDKSSVHEVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKD+KI SKL+++DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDDKISSKLTAEDKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG DMG  M++D   A    G+G+GPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGADMGAGMNDD---APSAGGSGSGPKIEEVD  648



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 397/414 (96%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIA+MYQGAG DMGGA   D   A      GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIARMYQGAGPDMGGAAGMD-DDAPASGSGGAGPKIEEVD  650



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/414 (92%), Positives = 396/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNE+VQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  477   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKI +KL   DKKKIEDAIEQAI WL+GNQLAE+DE
Sbjct  537   HKKKVEAKNALENYAYNMRNTIRDEKIAAKLPQADKKKIEDAIEQAINWLDGNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG  M G MDED    A G  +GAGPKIEEVD
Sbjct  597   FEDKMKELESICNPIIAKMYQGAGAGMAGGMDED--IPAAGGSSGAGPKIEEVD  648



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/381 (96%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRKSKKDI+GNPRALRRLRT+CERAKRTLSSTAQT IEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKSKKDISGNPRALRRLRTACERAKRTLSSTAQTIIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNTVKDEKIG KL + DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNTLENYAYNMRNTVKDEKIGEKLPAADKKKIEDAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 396/414 (96%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  126   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  185

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  186   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  245

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  246   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  305

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  306   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  365

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+
Sbjct  366   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEE  425

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV++KNALENYAYNMRNT+KD+KI SKL   DKKKIEDAIE AI WL+ NQLAE+DE
Sbjct  426   HKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADE  485

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG +M G MDEDAP +A G  +G GPKIEEVD
Sbjct  486   FDDKMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  539



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/414 (91%), Positives = 389/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+ NQL E+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDTNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQ LLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQSLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI+ AI WL+ NQ AE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDAAINWLDANQSAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNP+IAKMYQ
Sbjct  598   FEDKMKELESLCNPVIAKMYQ  618



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD++IGSKLS+ DKK+IED IE+A+QWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDQIGSKLSAADKKRIEDTIEEAMQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGN+KVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNDKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFST+SDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTFSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNTVKDEKIG+KL   DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 396/414 (96%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  127   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  186

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  187   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  246

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  247   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  306

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  307   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  366

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+
Sbjct  367   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEE  426

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV++KNALENYAYNMRNT+KD+KI SKL   DKKKIEDAIE AI WL+ NQLAE+DE
Sbjct  427   HKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADE  486

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG +M G MDEDAP +A G  +G GPKIEEVD
Sbjct  487   FDDKMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  540



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/414 (92%), Positives = 396/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE  CNPIIAKMYQGAG  M G M +D   +  G  +GAGPKIEEVD
Sbjct  598   FEDKMKELEGTCNPIIAKMYQGAGAGMAGGMGDD---SPSGGDSGAGPKIEEVD  648



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 396/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT++DEKIG KL+  DKKKIEDA+EQAIQWL+ NQLAESDE
Sbjct  538   HKKKVESKNALENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG     G AM++D   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGADMGGAAMNDD---APPSGGSGAGPKIEEVD  648



>ref|XP_007016452.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34071.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=677

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/381 (96%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LEN+AYNMRNTV+DEKIG+KL+  DKK IEDA+EQAI WL+ NQ+AE+DE
Sbjct  538   HKKKVEAKNELENFAYNMRNTVRDEKIGAKLNPADKKNIEDAVEQAINWLDSNQMAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 395/414 (95%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+ NPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISNNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDED
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDED  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTV+DEKIGSKL+  DKKKIEDA+E AIQWL+GNQL + DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVRDEKIGSKLNPADKKKIEDAVEDAIQWLDGNQLGDCDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAG D+GG   ++   A   +  GAGPKIEEVD
Sbjct  598   FEDKMKELENLCNPIIAKMYQGAGADVGGGAPDE--DAPPAASGGAGPKIEEVD  649



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKK++AKNALENYAYNMRNTVKDEKI SKLS DDKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKIDAKNALENYAYNMRNTVKDEKISSKLSPDDKKKIEDAIEQAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006833219.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK+T+HDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNTIHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKK+VEAKNALENYAYNMRNT+KD+KI +KL + DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKRVEAKNALENYAYNMRNTIKDDKIAAKLDAADKKKIEDAIEQAIQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE+ICNPIIAKMYQ
Sbjct  598   FEDKMKELETICNPIIAKMYQ  618



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 399/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGI+NVSAEDKTTGQKNKIT+TNDKGRLSK EIEKMVQEAEKYK EDE+
Sbjct  478   PQITVCFDIDANGIINVSAEDKTTGQKNKITVTNDKGRLSKGEIEKMVQEAEKYKGEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKK+EAKNALENY+YNMRNT++DEKI +KL ++DKKKIEDA+EQAI WL+GNQLAE+DE
Sbjct  538   HKKKIEAKNALENYSYNMRNTIRDEKIAAKLPAEDKKKIEDAVEQAISWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FED+MKELESICNPIIAKMYQGAGG MGG MDED    + G  +GAGPKIEEVD
Sbjct  598   FEDRMKELESICNPIIAKMYQGAGGGMGGGMDED--IPSTGGSSGAGPKIEEVD  649



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/414 (90%), Positives = 388/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMV HFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  238   DFDNRMVTHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KDEKI SKLS  DKK+IEDAIE A QWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAFQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE+ICNPIIAKMYQ  GG   G   +D          GAGPKIEEVD
Sbjct  598   FEDKMKELETICNPIIAKMYQ--GGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 395/414 (95%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAISWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAG DMGGA   D    A     G GPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGAGEDMGGAGGMD--EDAPAGSGGPGPKIEEVD  649



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/414 (90%), Positives = 389/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKIGSKLS +DKKKI+DAIE +IQWL+ NQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIGSKLSPEDKKKIDDAIEASIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE +CNPIIAKMYQG G         D         +GAGPKIEEVD
Sbjct  598   FEDKMKELEGLCNPIIAKMYQGGGAPDMAGGMND--DVPPSGSSGAGPKIEEVD  649



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/381 (96%), Positives = 373/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGN R+LRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNARSLRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKI +KL   DKKKIEDA+EQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKISAKLPPADKKKIEDAVEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKD+KI SKL++DDKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_004981251.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Setaria 
italica]
Length=648

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK+KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  239   DFDNRLVNHFVQEFKRKNKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  298

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  299   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  358

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  359   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  418

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  419   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  478

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQ+AEKYKSEDE+
Sbjct  479   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEE  538

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT++DEKI SKL +DDKKKIEDA+EQAIQWL+ NQLAE +E
Sbjct  539   HKKKVEAKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDSNQLAEVEE  598

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE +CNPIIAKMYQ
Sbjct  599   FEDKMKELEGLCNPIIAKMYQ  619



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+G+PRALRRLRT+CERAKRTLSSTAQTTIEIDSLF+GI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGSPRALRRLRTACERAKRTLSSTAQTTIEIDSLFDGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIG+KL  +DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPEDKKKIEDAIEQAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>ref|XP_002442353.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|EES16191.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|AHV91025.1| Hsp70 [Saccharum hybrid cultivar]
Length=649

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KDEKI SKL+ DDKKKIEDAI+ AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDEKIASKLAGDDKKKIEDAIDAAISWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/381 (96%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNTVKDEKIGSKL   DKKKIEDAI+ AIQWL+ NQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTVKDEKIGSKLDPTDKKKIEDAIDGAIQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 378/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL +DDKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDADDKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 402/414 (97%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GN RALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDV+PLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVSPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQINVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KDEKI SKL ++DKKKIEDAI+QAIQWL+GNQL E+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTIKDEKIASKLPAEDKKKIEDAIDQAIQWLDGNQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAGG+ GGAMDED    A GSG+ AGPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGAGGEAGGAMDED--GPASGSGSTAGPKIEEVD  649



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/414 (90%), Positives = 393/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKIGSKLS +DKKKI+DAI+ AIQWL+ NQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIGSKLSPEDKKKIDDAIDAAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQG G    G   +D       +  GAGPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGGGAPDMGGGMDD---EVPPAAGGAGPKIEEVD  648



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 396/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KN+LENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+ AI WL+ NQLAE+DE
Sbjct  538   HKKKVESKNSLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDAAISWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELES+CNPIIAKMYQGAG DMGG+   D    A     G GPKIEEVD
Sbjct  598   FDDKMKELESLCNPIIAKMYQGAGADMGGSGGMD--EDAPAGSGGPGPKIEEVD  649



>ref|XP_004962705.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KN+LENYAYNMRNT++DEKI SKL++DDKKKIEDAI+ AI WL+ NQLAE+DE
Sbjct  538   HKKKVESKNSLENYAYNMRNTIRDEKIASKLAADDKKKIEDAIDAAISWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/414 (91%), Positives = 390/414 (94%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+ +PRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISSSPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTT+PTKKE VFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTVPTKKEHVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G        D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGGPDVGGGMD-EDVPPAGGSGAGPKIEEVD  650



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 398/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VH+VVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHEVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KD+KI SKL++ DKKKIEDAI++AIQWL+ NQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDDKIASKLAAADKKKIEDAIDEAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELESICNPIIAKMYQGAGGDMG  MDED P A G        KIEEVD
Sbjct  598   FDDKMKELESICNPIIAKMYQGAGGDMGAGMDEDGPSAGGSGAGP---KIEEVD  648



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNTVKDEKIG+KLS  DKKKIE+AI+ +IQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTVKDEKIGAKLSEADKKKIEEAIDASIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             F+DKMKELESICNPIIAKMYQ
Sbjct  598   FDDKMKELESICNPIIAKMYQ  618



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/422 (90%), Positives = 391/422 (93%), Gaps = 11/422 (3%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDl--------llldvtplslgl  518
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDL               LSLGL
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSXXXXXXLSLGL  417

Query  519   ETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSG  698
             ETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSG
Sbjct  418   ETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSG  477

Query  699   IPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE  878
             IPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE
Sbjct  478   IPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE  537

Query  879   KYKSEDEDHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEG  1058
             KYKSEDE+HKKKVE+KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ 
Sbjct  538   KYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDS  597

Query  1059  NQLAESDEFEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEE  1238
             NQLAE+DEFEDKMKELESICNPIIAKMYQGAGGD  G +D+D    A  S +G GPKIEE
Sbjct  598   NQLAEADEFEDKMKELESICNPIIAKMYQGAGGDGAGPVDDD---DAPPSASGPGPKIEE  654

Query  1239  VD  1244
             VD
Sbjct  655   VD  656



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>ref|XP_008776656.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=649

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 392/414 (95%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS +HDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGIHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNV+AEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  477   PQINVCFDIDANGILNVTAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKK+EAKNALENYAYNMRNT+KDEKI +KL   DKKKIEDAIEQAI WL+GNQLAE+DE
Sbjct  537   HKKKIEAKNALENYAYNMRNTIKDEKIAAKLPPADKKKIEDAIEQAINWLDGNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG  M   MDEDAP A G S      KIEEVD
Sbjct  597   FEDKMKELESICNPIIAKMYQGAGAGMDAGMDEDAPAAGGSSSGAGP-KIEEVD  649



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KN+LENYAYNMRNT+KDEKI SKL + DKKKIEDA+E AIQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNSLENYAYNMRNTIKDEKIASKLPAADKKKIEDAVEAAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             F+DKMKELES+CNPIIAKMYQ
Sbjct  598   FDDKMKELESLCNPIIAKMYQ  618



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 373/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFEL+GIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL   DKKKIEDAI+ AI WL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLPPADKKKIEDAIDSAIHWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 394/414 (95%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEF+RK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFRRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNV+AEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  477   PQINVCFDIDANGILNVTAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKK+EAKNALENYAYNMRNT++DEKI +KL   DKKKIED+IE+AI WL+GNQLAE+DE
Sbjct  537   HKKKIEAKNALENYAYNMRNTIRDEKIAAKLPPADKKKIEDSIEEAINWLDGNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQGAG  M   MDED    A GS  GAGPKIEEVD
Sbjct  597   FEDKMKELESICNPIIAKMYQGAGAGMADGMDED-VPTAAGSSGGAGPKIEEVD  649



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WLEGNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>emb|CDY52661.1| BnaC01g38510D [Brassica napus]
Length=647

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WLEGNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 396/414 (96%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDIIGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAERYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNT+KD+KI SKLS++DKKKIEDAI+QAI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYSYNMRNTIKDDKISSKLSAEDKKKIEDAIDQAISWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAGG+ G  MD+D   A      GAGPKIEEVD
Sbjct  598   FEDKMKELESLCNPIIAKMYQGAGGEAGAPMDDD--DAPPAGSTGAGPKIEEVD  649



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  331   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  390

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  391   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  450

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  451   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  510

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  511   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  570

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  571   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  630

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI +KLS  DKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  631   HKKKVDAKNALENYAYNMRNTIKDEKISAKLSEGDKKKIEDAIDQAIQWLDSNQLAEADE  690

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  691   FEDKMKELESICNPIIAKMYQ  711



>gb|ADN03965.1| heat shock cognate 70 kDa protein [Phytolacca acinosa]
Length=588

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/414 (90%), Positives = 389/414 (94%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  175   DFDNRLVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  234

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  235   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  294

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             D FNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  295   DLFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  354

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  355   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  414

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YKSEDE+
Sbjct  415   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAERYKSEDEE  474

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNT+KD+KI +KL +D+KKKIEDAI+QAIQWL+GNQLAE DE
Sbjct  475   HKKKVEAKNGLENYAYNMRNTIKDDKISAKLPADEKKKIEDAIDQAIQWLDGNQLAEVDE  534

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQG  G        D    + G   GAGPKIEEVD
Sbjct  535   FEDKMKELESVCNPIIAKMYQGGAGGGDMGGHMDDDGPSAGGANGAGPKIEEVD  588



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/416 (90%), Positives = 393/416 (94%), Gaps = 2/416 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPR+LRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIGSKL  +DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIRDEKIGSKLKPEDKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmg--gamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIA+MYQG  G         +D    + G G GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAQMYQGGAGADMDGAGGMDDDCAPSAGGGRGAGPKIEEVD  653



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/414 (90%), Positives = 394/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT++DEKI  KL+  DKKKIEDA+EQAIQWL+ NQLAESDE
Sbjct  538   HKKKVESKNALENYAYNMRNTIRDEKISGKLAPADKKKIEDAVEQAIQWLDSNQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG       AM++D   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGADMGSAAMNDD---APPSGGSGAGPKIEEVD  648



>gb|ABX76301.1| heat shock protein 70 [Ageratina adenophora]
Length=649

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 392/414 (95%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGST IPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSTIIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQG  GD  GA   D       SG GAGPKIEEVD
Sbjct  598   FEDKMKELENVCNPIIAKMYQGGAGDAAGAGGMD--EEPAPSGGGAGPKIEEVD  649



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/414 (91%), Positives = 388/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDK +VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKKSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI  KL SDDKKKIED IE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE +CNPIIAKMYQG  G   GA   D    A     GAGPKIEEVD
Sbjct  598   FEDKMKELEGVCNPIIAKMYQGGAGPDMGAAPGD--DDAPSHAGGAGPKIEEVD  649



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESVCNPIIARMYQ  618



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCM+PVEKCLRDAKMDKS+V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMDPVEKCLRDAKMDKSSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNT+KD+KI SKL++ DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYSYNMRNTIKDDKIASKLAAADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WLEGNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESVCNPIIARMYQ  618



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/414 (92%), Positives = 395/414 (95%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLI RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKD+KI SKL + DKKKIEDA++QAIQWL+ NQLAE DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDDKIASKLPAADKKKIEDAVDQAIQWLDANQLAEVDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPIIAKMYQGAGG M G MDE+        G GAGPKIEEVD
Sbjct  598   FEDKMKELENLCNPIIAKMYQGAGGGMAGGMDEE--EGPSNGGGGAGPKIEEVD  649



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  331   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  390

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQ
Sbjct  391   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQ  450

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  451   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  510

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  511   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  570

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  571   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  630

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI +KLS  DKKKIEDAI+QAIQWL+ NQLAE+DE
Sbjct  631   HKKKVDAKNALENYAYNMRNTIKDEKISAKLSEGDKKKIEDAIDQAIQWLDSNQLAEADE  690

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  691   FEDKMKELESICNPIIAKMYQ  711



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIG+KL   DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGAKLDPADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE ICNPIIA+MYQ
Sbjct  598   FEDKMKELEGICNPIIARMYQ  618



>gb|EMS50129.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=736

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/414 (92%), Positives = 398/414 (96%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  326   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  385

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  386   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  445

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  446   DFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  505

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  506   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  565

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  566   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  625

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  626   HKKKVESKNALENYAYNMRNTIKDDKIASKLAADDKKKIEDAIDQAIQWLDGNQLAEADE  685

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE +CNPIIAKMYQGAG DM GAMDED    A G       KIEEVD
Sbjct  686   FDDKMKELEGLCNPIIAKMYQGAGADMAGAMDEDDAPPAAGGAGP---KIEEVD  736



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/415 (91%), Positives = 392/415 (94%), Gaps = 1/415 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNTV+DEK  SKL   DKKKIEDAIEQA+QWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ-gaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPI+AKMYQ   G  MGG   +D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIVAKMYQGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  652



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/414 (90%), Positives = 391/414 (94%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFEL+GIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKLS  DKKKIEDAIEQA+QWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDEKISSKLSEADKKKIEDAIEQAVQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQG+    G     D    A G  +GAGPKIEEVD
Sbjct  598   FDDKMKELEGICNPIIAKMYQGSADMGGQM---DEDGPAPGGASGAGPKIEEVD  648



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/381 (95%), Positives = 373/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQ LLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQSLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVY GERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYGGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENY+YNMRNT+KD+KI SKL + DKKKIEDAI+ AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYSYNMRNTIKDDKISSKLDAADKKKIEDAIDGAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/415 (92%), Positives = 398/415 (96%), Gaps = 3/415 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK-MVQEAEKYKSEDE  899
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK MVQEAEKYKSEDE
Sbjct  477   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMMVQEAEKYKSEDE  536

Query  900   DHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESD  1079
             +HKKKV+AKN+LENYAYNMRNT+KD+KI SKLS+DDKKKIEDAI+ AI WL+GNQLAE+D
Sbjct  537   EHKKKVDAKNSLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDGNQLAEAD  596

Query  1080  EFEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             EFEDKMKELESICNPIIAKMYQGAG DMGGA   D        G+GAGPKIEEVD
Sbjct  597   EFEDKMKELESICNPIIAKMYQGAGPDMGGATGMD--EDVPAGGSGAGPKIEEVD  649



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/416 (91%), Positives = 391/416 (94%), Gaps = 2/416 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYST+TRARFEELNMDLFRKCMEPVEKCLRDAKMDK +V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTVTRARFEELNMDLFRKCMEPVEKCLRDAKMDKRSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKD+KIG KL   DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDDKIGEKLDPADKKKIEDAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgagg--dmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G    G    ED   A    G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGPDVGGAGAAEDEYAAPPSGGSGAGPKIEEVD  653



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT++DEKIG KL + DKKKIEDAIE+AIQWLEGNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIRDEKIGEKLQAADKKKIEDAIEEAIQWLEGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|NP_001051724.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|AAO65876.1| heat shock protein cognate 70 [Oryza sativa Japonica Group]
 gb|ABF99592.1| Heat shock cognate 70 kDa protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13638.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|EAZ29089.1| hypothetical protein OsJ_13143 [Oryza sativa Japonica Group]
 dbj|BAG91581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEG+
Sbjct  239   DFDNRLVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGV  298

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  299   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  358

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  359   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  418

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  419   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  478

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  479   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  538

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKN+LENYAYNMRNT++DEKI SKL +DDKKKIEDA+EQAIQWL+ NQLAE +E
Sbjct  539   HKKKVDAKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDNNQLAEVEE  598

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE +CNPIIAKMYQ
Sbjct  599   FEDKMKELEGLCNPIIAKMYQ  619



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+ DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIRDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFE SGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFEXSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KN LENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+QAIQWLE NQLAE+DE
Sbjct  538   HKKKVESKNTLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDQAIQWLESNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             F+DKMKELE ICNPIIAKMYQ
Sbjct  598   FDDKMKELEGICNPIIAKMYQ  618



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESLCNPIIAKMYQ  618



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/381 (94%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             F+DKMKELES+CNPIIA+MYQ
Sbjct  598   FDDKMKELESLCNPIIARMYQ  618



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 396/414 (96%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  477   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL++DDKK+IEDAI+ AI WL+ NQLAE+DE
Sbjct  537   HKKKVDAKNALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQG G DM G MDED    A   G+GAGPKIEEVD
Sbjct  597   FEDKMKELEGICNPIIAKMYQGPGADMAGGMDED----APAGGSGAGPKIEEVD  646



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/381 (94%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVV+VGGSTRIPKVQQL+Q
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVVVGGSTRIPKVQQLVQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/415 (91%), Positives = 392/415 (94%), Gaps = 1/415 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNTV+DEK  SKL   DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAIQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ-gaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPI+AKMYQ   G  MGG   +D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIVAKMYQGAGGPGMGGGAMDDDDVPPPSGGSGAGPKIEEVD  652



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 377/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDK++VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKNSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKITSKLDAADKKKIEDAIDQAIEWLDGNQLAETDE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 388/414 (94%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK +V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKKSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL   DKKKIEDAIEQ+IQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G   G             G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGPDMGGAPPADTEYTPSGGSGAGPKIEEVD  651



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAK+DKS VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSNVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIA+MYQ
Sbjct  598   FEDKMKELESLCNPIIARMYQ  618



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNTVKDEKI SKL + DKKKIEDAI+ AIQWL+GNQLAESDE
Sbjct  538   HKKKVDAKNALENYAYNMRNTVKDEKIASKLDAADKKKIEDAIDAAIQWLDGNQLAESDE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESVCNPIIAKMYQ  618



>dbj|BAJ86014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 396/414 (96%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV++KNALENYAYNMRNT+KD+KI SKL   DKKKIEDAIE AI WL+ NQLAE+DE
Sbjct  538   HKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG +M G MDEDAP +A G  +G GPKIEEVD
Sbjct  598   FDDKMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  651



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+K+DI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKRDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHD+VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDIVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKIGSKL   DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIGSKLDPADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             F+DKMKELESICNPIIA+MYQ
Sbjct  598   FKDKMKELESICNPIIARMYQ  618



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/414 (91%), Positives = 392/414 (95%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS++HDVVLVGGS RIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSIHDVVLVGGSARIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
              FFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   GFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAED+TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDRTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE++CNPII KMYQG  GD  G MDE+       SG GAGPKIEEVD
Sbjct  598   FEDKMKELENVCNPIIVKMYQGGAGDAAGGMDEE----PAPSGGGAGPKIEEVD  647



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/414 (90%), Positives = 389/414 (94%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
              KKKVE+KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQLAE++E
Sbjct  538   VKKKVESKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEAEE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             ++DK+KELE ICNPIIAKMYQG      G             G+GAGPKIEEVD
Sbjct  598   YDDKVKELEGICNPIIAKMYQGGAAPDMGMGGGMDEDVPPAGGSGAGPKIEEVD  651



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/415 (90%), Positives = 392/415 (94%), Gaps = 1/415 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFF+GKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFDGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNTV+DEK  SKL   DKKKIEDAIEQA+QWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ-gaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPI+AKMYQ   G  MGG   +D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIVAKMYQGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  652



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYST+TRARFEELNMDLFRKCM+PVEKCLRDAKMDKSTVH+VVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTVTRARFEELNMDLFRKCMDPVEKCLRDAKMDKSTVHEVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLI RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKK E+KNALENYAYNMRNT++D+KIG+KL   DKKKIED+I+QAIQWL+ NQLAE+DE
Sbjct  538   HKKKAESKNALENYAYNMRNTIRDDKIGAKLDPADKKKIEDSIDQAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMYQ
Sbjct  598   FEDKMKELESVCNPIIAKMYQ  618



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/414 (90%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAK+DKS VHD+VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSGVHDIVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNG+ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGRELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLS D+KKKIED++EQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G       ++   +AG S AGAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGPDMAGGMDEDGPSAGASSAGAGPKIEEVD  651



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFV EFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVLEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  477   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAI+ AI WL+ NQLAE+DE
Sbjct  537   HKKKVDAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  597   FEDKMKELESICNPIIAKMYQ  617



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 372/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDIGGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRD+KMDKS+V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDSKMDKSSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDLDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI SKL  DDKKK+EDAIE AIQWL+ NQL E+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIASKLGVDDKKKVEDAIEGAIQWLDANQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE ICNPIIAKMYQ
Sbjct  598   FEDKMKELEGICNPIIAKMYQ  618



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 376/381 (99%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  438   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  497

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  498   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  557

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  558   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  617

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  618   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  677

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED
Sbjct  678   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  737

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNT+KD+KI SKLS  DKK IEDAIEQAIQWL+ NQLAE+DE
Sbjct  738   HKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADE  797

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE+ICNPIIAKMYQ
Sbjct  798   FEDKMKELETICNPIIAKMYQ  818


 Score =   306 bits (783),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/176 (97%), Positives = 176/176 (100%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
            DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  160  DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  219

Query  183  DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
            DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  220  DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  279

Query  363  DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAG  530
            DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAG
Sbjct  280  DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAG  335



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VH+VVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHEVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             D FNGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DLFNGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDE+
Sbjct  478   PQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNTLENYAYNMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELES+CNPIIAKMY+
Sbjct  598   FEDKMKELESVCNPIIAKMYE  618



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/381 (94%), Positives = 375/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAK+DKS VHD+VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSGVHDIVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNG+ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGRELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLS D+KKKIED++EQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/414 (92%), Positives = 392/414 (95%), Gaps = 3/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRA RRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDITGNPRAPRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQ AILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQTAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVC DIDANGILNVSAEDKTTGQKNKITITN KGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCSDIDANGILNVSAEDKTTGQKNKITITNGKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
              KKKVEAKN+LENYAYNMRNTVKDEKIGSKLSSDDKKKIEDA++QAI WLE NQLAE DE
Sbjct  538   LKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGAGGD G  MD+D   A    G+ AGPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGAGGDAGVPMDDD---APPSGGSSAGPKIEEVD  648



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/414 (90%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAK+DKS VHD+VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSGVHDIVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNG+ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGRELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFEL+GIPPAPRGV
Sbjct  418   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI SKLS D+KKKIED++EQAIQWL+GNQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G       ++   +AG S AGAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGRAGPDMAGGMDEDGPSAGASSAGAGPKIEEVD  651



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/415 (91%), Positives = 397/415 (96%), Gaps = 1/415 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRD+KMDKS++ DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDSKMDKSSIDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDLDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT+KDEKI SKL +DDKKK+EDAIE AIQWL+ NQL E+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIKDEKIASKLGADDKKKVEDAIEGAIQWLDANQLGEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggd-mggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQG+GG  M G MDED P +A G  +G GPKIEEVD
Sbjct  598   FEDKMKELEGICNPIIAKMYQGSGGPDMAGGMDEDGPPSAAGGSSGPGPKIEEVD  652



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/414 (90%), Positives = 387/414 (93%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMD FRKCMEPVEKCLRDAKMDK +V DVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYSTITRARFEELNMDFFRKCMEPVEKCLRDAKMDKRSVDDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  477   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKD+KIG KL   DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  537   HKKKVEAKNALENYAYNMRNTVKDDKIGGKLDPADKKKIEDAIEQAIQWLDSNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQG  G   G             G+GAGPKIEEVD
Sbjct  597   FEDKMKELESVCNPIIAKMYQGGAGPDMGGAPPADDEYTPSGGSGAGPKIEEVD  650



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/414 (90%), Positives = 394/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKN+LENYAYNMRNT+KD+KI SKL   DKKKIEDAI+ AI WL+ NQLAE+DE
Sbjct  538   HKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAITWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQGAG +M G MDED P +  G  +G GPKIEEVD
Sbjct  598   FDDKMKELEGICNPIIAKMYQGAGAEMPGGMDEDTPASTAGGSSGPGPKIEEVD  651



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/381 (94%), Positives = 373/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DF NRMVNHFVQEFKRK KKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFGNRMVNHFVQEFKRKHKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYST+TRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTVTRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNTVKDEKIG KLS +DKKKIEDAI+ A+ WL+ NQLAE+ E
Sbjct  538   HKKKVDAKNALENYAYNMRNTVKDEKIGEKLSPEDKKKIEDAIDGAVSWLDNNQLAEAGE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE++CNPIIAKMYQ
Sbjct  598   FEDKMKELENVCNPIIAKMYQ  618



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/414 (91%), Positives = 393/414 (95%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  237   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  417   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  477   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKL +DDKKK+EDAI+ AI WL+ NQLAE+DE
Sbjct  537   HKKKVDAKNALENYAYNMRNTIKDEKIASKLGADDKKKVEDAIDGAISWLDTNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGA  DMGG M  D   A  G  +GAGPKIEEVD
Sbjct  597   FEDKMKELEGICNPIIAKMYQGAAPDMGGGMGMD-EDAPAGGSSGAGPKIEEVD  649



>ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
 gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
Length=649

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/381 (94%), Positives = 374/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  237   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  417   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  477   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKN+LENYAYNMRNT+KD+KI SKL +DDKK+IEDAI+ AI WL+ NQLAE+DE
Sbjct  537   HKKKVDAKNSLENYAYNMRNTIKDDKIASKLGADDKKRIEDAIDGAISWLDSNQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  597   FEDKMKELESICNPIIAKMYQ  617



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/415 (91%), Positives = 392/415 (94%), Gaps = 1/415 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRLVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK++DE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN+LENYAYNMRNTV+DEK  SKL   DKKKIEDAIE A+QWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEGAVQWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ-gaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPI+AKMYQ   G  MGGA  +D        G+GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIVAKMYQGAGGPGMGGAAMDDDDVPPPSGGSGAGPKIEEVD  652



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/414 (90%), Positives = 390/414 (94%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDK +VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKKSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLI RNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFEL+GIPPAPRGV
Sbjct  418   VLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELTGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KD+KI  KL S DKKKIED+IEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQG  G   G    D    A   G+GAGPKIEEVD
Sbjct  598   FEDKMKELESVCNPIIAKMYQGGAGPDMGGAAAD-EEYAPSGGSGAGPKIEEVD  650



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/414 (90%), Positives = 391/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS+ITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSSITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
              KKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIEQAIQWL+GNQLAE++E
Sbjct  538   VKKKVESKNALENYAYNMRNTIKDEKIASKLDAGDKKKIEDAIEQAIQWLDGNQLAEAEE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             ++DK+KELE ICNPIIAKMYQG      G   ++        G+GAGPKIEEVD
Sbjct  598   YDDKVKELEGICNPIIAKMYQGGAAPDMGGGMDE--DVPPAGGSGAGPKIEEVD  649



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/417 (89%), Positives = 383/417 (92%), Gaps = 3/417 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHF QEFKRK KKDI+G+PRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFAQEFKRKHKKDISGSPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVH VVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHYVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSTGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPG LIQVYEGER RTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGALIQVYEGERARTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNT+KDEKI SKLS  DKKKIEDAI+QAIQWL+GNQLAE+DE
Sbjct  538   HKKKVDAKNALENYAYNMRNTIKDEKISSKLSDADKKKIEDAIDQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ---gaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             F DKMKELESICNP+IAK YQ      G        D        G+ AGPKIEEVD
Sbjct  598   FGDKMKELESICNPVIAKTYQGAGAGAGGPDVGGGSDDDVPPPSGGSSAGPKIEEVD  654



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/414 (90%), Positives = 389/414 (94%), Gaps = 2/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  237   DFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  296

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  297   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  356

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGA+VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  357   DFFNGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  416

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  417   TLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  476

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+
Sbjct  477   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEE  536

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKNALENYAYNMRNTVKD+KI SKL +DDKKK+E+AIE  I WL+ NQLAE+DE
Sbjct  537   HKKKVDAKNALENYAYNMRNTVKDDKIASKLGADDKKKVEEAIEGTISWLDANQLAEADE  596

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE ICNPIIAKMYQGA  DMGG M  D          GAGPKIEEVD
Sbjct  597   FEDKMKELEGICNPIIAKMYQGAAPDMGGGMGMD--EDMPAGAGGAGPKIEEVD  648



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/414 (90%), Positives = 392/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  233   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  292

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  293   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  352

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGG MT
Sbjct  353   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGGMT  412

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  413   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  472

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+
Sbjct  473   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEE  532

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
              KKKVEAKNALENYAYNMRNT+KD+KI S+LS+ DKK+IEDAI++AI+WL+ NQLAE+DE
Sbjct  533   LKKKVEAKNALENYAYNMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADE  592

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G      D  +   + GS  GAGPKIEEVD
Sbjct  593   FEDKMKELESICNPIIAKMYQGGAGGATMDEDGPSVGGSAGSQTGAGPKIEEVD  646



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/416 (89%), Positives = 396/416 (95%), Gaps = 2/416 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLF+KCMEPVEKCLRDAK+DKS+VH++VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFKKCMEPVEKCLRDAKIDKSSVHEIVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER+RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERSRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAERYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVE+KNALENYAYNMRNT++DEKI SKL++D+KK+IEDAIE AIQWL+GNQLAE+DE
Sbjct  538   HKKKVESKNALENYAYNMRNTIRDEKIASKLAADEKKRIEDAIESAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamd--EDaphaaggsgagagPKIEEVD  1244
             F+DKMKELE ICNPIIAKMYQ  G   G A    ED P   GG G GAGPKIEEVD
Sbjct  598   FDDKMKELEGICNPIIAKMYQAGGAGGGMAGGMDEDGPSVGGGGGGGAGPKIEEVD  653



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/414 (90%), Positives = 392/414 (95%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGG MT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGGMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
              KKKVEAKNALENYAYNMRNT+KD+KI S+LS+ DKK+IEDAI++AI+WL+ NQLAE+DE
Sbjct  538   LKKKVEAKNALENYAYNMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELESICNPIIAKMYQG  G      D  +   + GS  GAGPKIEEVD
Sbjct  598   FEDKMKELESICNPIIAKMYQGGAGGATMDEDGPSVGGSAGSQTGAGPKIEEVD  651



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 373/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYST+TRARFEELNMDLFRKCMEPVEKCLRDAKMDK +V DVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSTVTRARFEELNMDLFRKCMEPVEKCLRDAKMDKRSVDDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNTVKD+KIG KL   DKKKIEDAIEQAIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTVKDDKIGEKLDPTDKKKIEDAIEQAIQWLDSNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELESICNPIIAKMYQ
Sbjct  598   FEDKMKELESICNPIIAKMYQ  618



>ref|XP_003563611.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=648

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/414 (91%), Positives = 394/414 (95%), Gaps = 4/414 (1%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNR+VNHFVQEFKRK KKDI+GNPR+LRRLRTSCERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  239   DFDNRLVNHFVQEFKRKHKKDISGNPRSLRRLRTSCERAKRTLSSTAQTTIEIDSLYEGV  298

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIP+VQQLLQ
Sbjct  299   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPRVQQLLQ  358

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  359   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  418

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLI RNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  419   VLITRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGV  478

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKMVQ+AEKYKSEDE+
Sbjct  479   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQDAEKYKSEDEE  538

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKN LENYAYNMRNT+ DEKI SKL +DDKKKIEDA++QAIQWL+ NQLAE DE
Sbjct  539   HKKKVEAKNTLENYAYNMRNTISDEKIASKLPADDKKKIEDAVDQAIQWLDNNQLAEVDE  598

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE +CNPIIAKMYQGAG DM G MDED    A  +  GAGPKIEEVD
Sbjct  599   FEDKMKELEGLCNPIIAKMYQGAGADMPGGMDED----APAASGGAGPKIEEVD  648



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/381 (95%), Positives = 372/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDK +VHDVVLVGGSTRIPKVQQLLQ
Sbjct  298   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKKSVHDVVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQV+EGERTRTRDNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKSEDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT+KDEKI  KL SDDKKKIED IE AIQWL+ NQLAE+DE
Sbjct  538   HKKKVEAKNALENYAYNMRNTIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE +CNPIIAKMYQ
Sbjct  598   FEDKMKELEGVCNPIIAKMYQ  618



>ref|NP_001049712.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|ABF95258.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11626.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|EAZ26443.1| hypothetical protein OsJ_10329 [Oryza sativa Japonica Group]
 dbj|BAG93163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADR66978.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=650

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/414 (91%), Positives = 395/414 (95%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  238   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDE+
Sbjct  478   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKN+LENYAYNMRNT+KD+KI SKL   DKKKIEDAI+ AI WL+ NQLAE++E
Sbjct  538   HKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEE  597

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE +CNPIIAKMYQGAG DM G MDED   AA G  +G GPKIEEVD
Sbjct  598   FEDKMKELEGVCNPIIAKMYQGAGADMAGGMDED-APAAAGGSSGPGPKIEEVD  650



>ref|XP_010106444.1| Heat shock cognate 70 kDa protein [Morus notabilis]
 gb|EXC10620.1| Heat shock cognate 70 kDa protein [Morus notabilis]
Length=652

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/381 (93%), Positives = 372/381 (98%), Gaps = 0/381 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK KKDI GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EG+
Sbjct  238   DFDNRMVNHFVQEFKRKHKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGV  297

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHD VLVGGSTRIPKVQQLLQ
Sbjct  298   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDAVLVGGSTRIPKVQQLLQ  357

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  358   DFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  417

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGV
Sbjct  418   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGV  477

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQI+VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAE+YK+EDE+
Sbjct  478   PQISVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAERYKAEDEE  537

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKK EAKNALENYAYNMRNT+KDEKI SK+ + DKKKIEDAIEQAIQWL+GNQLAE+DE
Sbjct  538   HKKKAEAKNALENYAYNMRNTIKDEKIASKVPAADKKKIEDAIEQAIQWLDGNQLAEADE  597

Query  1083  FEDKMKELESICNPIIAKMYQ  1145
             FEDKMKELE IC+PIIAKMYQ
Sbjct  598   FEDKMKELEDICSPIIAKMYQ  618



>ref|XP_006649850.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=655

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/414 (90%), Positives = 393/414 (95%), Gaps = 1/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDITGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGI
Sbjct  243   DFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGI  302

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFY+TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQ
Sbjct  303   DFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQ  362

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFFNGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMT
Sbjct  363   DFFNGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMT  422

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
             VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  423   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  482

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDE+
Sbjct  483   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEE  542

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKV+AKN+LENYAYNMRNT+KD+KI SKL   DKKKIEDAI+ AI WL+ NQLAE++E
Sbjct  543   HKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEE  602

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELE +CNPIIAKMYQGAG DM G MDED    A G  +G GPKIEEVD
Sbjct  603   FEDKMKELEGVCNPIIAKMYQGAGADMAGGMDED-APPAAGGSSGPGPKIEEVD  655



>ref|XP_006392363.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
 gb|ESQ29649.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
Length=633

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/414 (91%), Positives = 391/414 (94%), Gaps = 0/414 (0%)
 Frame = +3

Query  3     DFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGI  182
             DFDNRMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEGI
Sbjct  220   DFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGI  279

Query  183   DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  362
             DFYS ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ
Sbjct  280   DFYSPITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQ  339

Query  363   DFFNGKELCKSINPDEavaygaavqaaILSGEGNEKVQDlllldvtplslglETAGGVMT  542
             DFF GKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT
Sbjct  340   DFFKGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT  399

Query  543   VLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGV  722
              LI RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGV
Sbjct  400   TLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGV  459

Query  723   PQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDED  902
             PQIT+CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYKSEDE+
Sbjct  460   PQITICFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEE  519

Query  903   HKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAESDE  1082
             HKKKVEAKNALENYAYNMRNT++DEKIG KL + DKKKIED+IE+ IQWL+GNQLAE+DE
Sbjct  520   HKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKIEDSIEEVIQWLDGNQLAEADE  579

Query  1083  FEDKMKELESICNPIIAKMYQgaggdmggamdEDaphaaggsgagagPKIEEVD  1244
             FEDKMKELES+CNPIIAKMYQGAGG+ GG         A  S  GAGPKIEEVD
Sbjct  580   FEDKMKELESVCNPIIAKMYQGAGGEPGGPAAGMDDDEAPPSSGGAGPKIEEVD  633



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4522170370773