BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12766

Length=793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603675.1|  PREDICTED: probable polygalacturonase              308   6e-99   
gb|KDO76503.1|  hypothetical protein CISIN_1g0134022mg                  295   4e-96   Citrus sinensis [apfelsine]
gb|KDO76502.1|  hypothetical protein CISIN_1g0134022mg                  295   2e-95   Citrus sinensis [apfelsine]
emb|CDP12145.1|  unnamed protein product                                299   2e-95   Coffea canephora [robusta coffee]
ref|XP_009767931.1|  PREDICTED: probable polygalacturonase              298   7e-95   Nicotiana sylvestris
gb|KDO76501.1|  hypothetical protein CISIN_1g0134022mg                  294   1e-94   Citrus sinensis [apfelsine]
ref|XP_011101030.1|  PREDICTED: probable polygalacturonase              297   1e-94   Sesamum indicum [beniseed]
ref|XP_006439367.1|  hypothetical protein CICLE_v10020162mg             296   5e-94   Citrus clementina [clementine]
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         294   2e-93   
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         294   3e-93   Solanum tuberosum [potatoes]
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    294   5e-93   Solanum lycopersicum
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    293   8e-93   Solanum lycopersicum
ref|XP_010266478.1|  PREDICTED: probable polygalacturonase              291   2e-92   Nelumbo nucifera [Indian lotus]
ref|XP_002304552.2|  glycoside hydrolase family 28 family protein       287   1e-90   Populus trichocarpa [western balsam poplar]
gb|AIU50439.1|  pectin lyase-like superfamily protein                   283   9e-90   Solanum lycopersicum
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              284   2e-89   Vitis vinifera
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              283   3e-89   Sesamum indicum [beniseed]
ref|XP_012086739.1|  PREDICTED: probable polygalacturonase              283   5e-89   Jatropha curcas
gb|AIU50429.1|  pectin lyase-like superfamily protein                   281   1e-88   Solanum tuberosum [potatoes]
gb|AIU50408.1|  pectin lyase-like superfamily protein                   280   3e-88   Citrus clementina [clementine]
ref|XP_011022514.1|  PREDICTED: probable polygalacturonase              281   4e-88   Populus euphratica
ref|XP_002509949.1|  Polygalacturonase precursor, putative              280   5e-88   Ricinus communis
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              280   8e-88   Nelumbo nucifera [Indian lotus]
gb|AIU50426.1|  pectin lyase-like superfamily protein                   278   2e-87   Manihot esculenta [manioc]
ref|XP_003545367.1|  PREDICTED: probable polygalacturonase              278   3e-87   Glycine max [soybeans]
gb|KHN12010.1|  Putative polygalacturonase                              278   5e-87   Glycine soja [wild soybean]
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         277   1e-86   Glycine max [soybeans]
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         276   1e-86   Glycine max [soybeans]
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             276   2e-86   Phaseolus vulgaris [French bean]
gb|KHN28527.1|  Putative polygalacturonase                              277   2e-86   Glycine soja [wild soybean]
gb|KHM99685.1|  Putative polygalacturonase                              276   2e-86   Glycine soja [wild soybean]
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         276   3e-86   Cicer arietinum [garbanzo]
ref|XP_008239046.1|  PREDICTED: probable polygalacturonase              273   2e-85   Prunus mume [ume]
gb|AIU50442.1|  pectin lyase-like superfamily protein                   272   2e-85   Vitis vinifera
gb|AIU50430.1|  pectin lyase-like superfamily protein                   272   2e-85   Populus trichocarpa [western balsam poplar]
gb|KJB39696.1|  hypothetical protein B456_007G026000                    267   6e-85   Gossypium raimondii
gb|AIU50410.1|  pectin lyase-like superfamily protein                   270   2e-84   Carica papaya [mamon]
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             271   2e-84   Prunus persica
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              270   6e-84   Theobroma cacao [chocolate]
gb|AIU50416.1|  pectin lyase-like superfamily protein                   268   9e-84   Buxus sinica
gb|KHG27846.1|  putative polygalacturonase                              268   1e-83   Gossypium arboreum [tree cotton]
gb|KJB39695.1|  hypothetical protein B456_007G026000                    265   2e-83   Gossypium raimondii
ref|XP_008437386.1|  PREDICTED: probable polygalacturonase              268   2e-83   Cucumis melo [Oriental melon]
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    268   4e-83   Medicago truncatula
gb|AIU50446.1|  pectin lyase-like superfamily protein                   266   8e-83   Platanus x hispanica [London plane tree]
gb|AIU50435.1|  pectin lyase-like superfamily protein                   265   1e-82   Ricinus communis
gb|AIU50414.1|  pectin lyase-like superfamily protein                   265   2e-82   Glycine max [soybeans]
gb|KJB39697.1|  hypothetical protein B456_007G026000                    266   2e-82   Gossypium raimondii
gb|EPS61079.1|  hypothetical protein M569_13719                         263   8e-82   Genlisea aurea
ref|XP_004143871.1|  PREDICTED: probable polygalacturonase              264   8e-82   Cucumis sativus [cucumbers]
gb|AIU50433.1|  pectin lyase-like superfamily protein                   263   9e-82   Phaseolus vulgaris [French bean]
ref|XP_003617307.1|  Glycoside hydrolase family 28 protein              264   1e-81   Medicago truncatula
ref|XP_004298894.1|  PREDICTED: probable polygalacturonase              263   1e-81   Fragaria vesca subsp. vesca
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             263   4e-81   Phaseolus vulgaris [French bean]
gb|AIU50443.1|  pectin lyase-like superfamily protein                   261   6e-81   Lactuca sativa [cultivated lettuce]
gb|AIU50407.1|  pectin lyase-like superfamily protein                   261   7e-81   Sarcandra glabra
gb|AIU50418.1|  pectin lyase-like superfamily protein                   260   1e-80   Chloranthus japonicus
gb|AIU50431.1|  pectin lyase-like superfamily protein                   259   4e-80   Prunus persica
gb|AIU50397.1|  pectin lyase-like superfamily protein                   257   2e-79   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU50405.1|  pectin lyase-like superfamily protein                   256   3e-79   Theobroma cacao [chocolate]
gb|AIU50424.1|  pectin lyase-like superfamily protein                   256   5e-79   Medicago truncatula
ref|XP_010676306.1|  PREDICTED: probable polygalacturonase              257   5e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010053124.1|  PREDICTED: probable polygalacturonase              256   9e-79   
ref|XP_004491304.1|  PREDICTED: probable polygalacturonase-like         256   1e-78   Cicer arietinum [garbanzo]
gb|EYU40022.1|  hypothetical protein MIMGU_mgv1a006305mg                254   6e-78   Erythranthe guttata [common monkey flower]
gb|KHG21610.1|  putative polygalacturonase                              254   6e-78   Gossypium arboreum [tree cotton]
ref|XP_010055855.1|  PREDICTED: probable polygalacturonase              254   9e-78   Eucalyptus grandis [rose gum]
gb|KJB24230.1|  hypothetical protein B456_004G134000                    253   3e-77   Gossypium raimondii
ref|XP_006413510.1|  hypothetical protein EUTSA_v10025189mg             252   5e-77   Eutrema salsugineum [saltwater cress]
gb|AIU50409.1|  pectin lyase-like superfamily protein                   250   1e-76   Gossypium raimondii
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              249   9e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU50420.1|  pectin lyase-like superfamily protein                   248   9e-76   Chimonanthus praecox [wintersweet]
emb|CDY47619.1|  BnaA01g13460D                                          248   9e-76   Brassica napus [oilseed rape]
gb|AIU50434.1|  pectin lyase-like superfamily protein                   243   1e-75   Artemisia annua [sweet Annie]
ref|XP_009380525.1|  PREDICTED: probable polygalacturonase              248   1e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU50441.1|  pectin lyase-like superfamily protein                   247   1e-75   Schrenkiella parvula
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    248   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_010541551.1|  PREDICTED: probable polygalacturonase isofor...    248   2e-75   Tarenaya hassleriana [spider flower]
gb|AIU50402.1|  pectin lyase-like superfamily protein                   246   3e-75   Magnolia denudata [haku-mokuren]
gb|KJB39694.1|  hypothetical protein B456_007G026000                    246   4e-75   Gossypium raimondii
gb|AIU50448.1|  pectin lyase-like superfamily protein                   245   5e-75   Houttuynia cordata [chameleon-plant]
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              246   6e-75   Brassica rapa
emb|CDY03516.1|  BnaC01g15660D                                          246   7e-75   
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              246   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   245   2e-74   Arabidopsis halleri
ref|XP_010925748.1|  PREDICTED: probable polygalacturonase              245   2e-74   
ref|XP_010913844.1|  PREDICTED: probable polygalacturonase isofor...    242   2e-74   
gb|AIU50404.1|  pectin lyase-like superfamily protein                   243   3e-74   Pinellia ternata
ref|XP_008790157.1|  PREDICTED: probable polygalacturonase              244   4e-74   Phoenix dactylifera
ref|NP_199002.1|  pectin lyase-like superfamily protein                 244   5e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AIU50413.1|  pectin lyase-like superfamily protein                   243   6e-74   Eucalyptus grandis [rose gum]
emb|CDY10970.1|  BnaA03g46290D                                          244   6e-74   Brassica napus [oilseed rape]
emb|CDX94222.1|  BnaC07g38560D                                          244   7e-74   
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              244   7e-74   Brassica rapa
ref|XP_010441363.1|  PREDICTED: probable polygalacturonase              244   8e-74   Camelina sativa [gold-of-pleasure]
gb|AIU50423.1|  pectin lyase-like superfamily protein                   242   9e-74   Aristolochia tagala
ref|XP_010448059.1|  PREDICTED: probable polygalacturonase              243   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              243   1e-73   
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    243   2e-73   Arabis alpina [alpine rockcress]
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    243   2e-73   Elaeis guineensis
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    242   3e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AIU50421.1|  pectin lyase-like superfamily protein                   240   5e-73   Pandanus utilis
gb|AIU50427.1|  pectin lyase-like superfamily protein                   240   9e-73   Erythranthe guttata [common monkey flower]
ref|XP_002868572.1|  glycoside hydrolase family 28 protein              240   2e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_006283738.1|  hypothetical protein CARUB_v10004811mg             240   2e-72   Capsella rubella
ref|XP_006283728.1|  hypothetical protein CARUB_v10004799mg             240   3e-72   Capsella rubella
ref|XP_006405300.1|  hypothetical protein EUTSA_v10027765mg             239   3e-72   Eutrema salsugineum [saltwater cress]
gb|AIU50399.1|  pectin lyase-like superfamily protein                   238   4e-72   Arabidopsis lyrata [lyrate rockcress]
gb|AIU50403.1|  pectin lyase-like superfamily protein                   238   5e-72   Musa acuminata [banana]
gb|AIU50437.1|  pectin lyase-like superfamily protein                   238   7e-72   Yucca filamentosa [Adam's-needle]
gb|AIU50400.1|  pectin lyase-like superfamily protein                   237   8e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAO62947.1|  putative polygalacturonase-like protein                 230   1e-71   Lactuca sativa [cultivated lettuce]
gb|AIU50411.1|  pectin lyase-like superfamily protein                   237   1e-71   Capsella rubella
gb|AIN44009.1|  polygalacturonase-like protein                          238   2e-71   Brassica juncea var. tumida [zha cai]
gb|AIU50415.1|  pectin lyase-like superfamily protein                   236   2e-71   Illicium henryi
gb|AIU50401.1|  pectin lyase-like superfamily protein                   236   3e-71   Lilium brownii [Hong Kong lily]
gb|KFK32989.1|  hypothetical protein AALP_AA6G314900                    236   4e-71   Arabis alpina [alpine rockcress]
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              236   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              236   9e-71   Camelina sativa [gold-of-pleasure]
gb|AIU50450.1|  pectin lyase-like superfamily protein                   234   2e-70   Alisma plantago-aquatica
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              235   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009395761.1|  PREDICTED: probable polygalacturonase              235   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961056.1|  PREDICTED: probable polygalacturonase-like         234   3e-70   Setaria italica
gb|AIU50422.1|  pectin lyase-like superfamily protein                   233   4e-70   Asparagus officinalis
gb|EAY85246.1|  hypothetical protein OsI_06620                          234   6e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              234   6e-70   Phoenix dactylifera
gb|AIU50425.1|  pectin lyase-like superfamily protein                   231   1e-69   Canna indica [canna]
gb|AIU50445.1|  pectin lyase-like superfamily protein                   231   1e-69   Cinnamomum camphora
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              233   2e-69   Elaeis guineensis
emb|CDY13383.1|  BnaC06g13740D                                          232   3e-69   Brassica napus [oilseed rape]
dbj|BAD61522.1|  polygalacturonase-like                                 226   4e-69   Oryza sativa Japonica Group [Japonica rice]
emb|CDX67513.1|  BnaA07g15530D                                          231   4e-69   
gb|AIU50438.1|  pectin lyase-like superfamily protein                   230   4e-69   Setaria italica
ref|XP_009125202.1|  PREDICTED: probable polygalacturonase              231   6e-69   Brassica rapa
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              231   7e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654851.1|  PREDICTED: probable polygalacturonase-like         226   1e-68   
ref|NP_001046468.1|  Os02g0256100                                       230   1e-68   
ref|XP_004951285.1|  PREDICTED: probable polygalacturonase-like         229   2e-68   Setaria italica
ref|NP_001043594.2|  Os01g0618900                                       225   3e-68   
ref|XP_010527633.1|  PREDICTED: probable polygalacturonase              221   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_002441600.1|  hypothetical protein SORBIDRAFT_09g030140          228   1e-67   Sorghum bicolor [broomcorn]
gb|AIU50432.1|  pectin lyase-like superfamily protein                   226   1e-67   Panicum virgatum
emb|CDM83426.1|  unnamed protein product                                228   1e-67   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ94644.1|  predicted protein                                      226   5e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89948.1|  predicted protein                                      226   5e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ12715.1|  hypothetical protein OsJ_02632                          224   8e-67   Oryza sativa Japonica Group [Japonica rice]
gb|EAY74990.1|  hypothetical protein OsI_02888                          224   2e-66   Oryza sativa Indica Group [Indian rice]
gb|AIU50444.1|  pectin lyase-like superfamily protein                   223   3e-66   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU50440.1|  pectin lyase-like superfamily protein                   221   2e-65   Sorghum bicolor [broomcorn]
ref|NP_001149385.1|  LOC100283011 precursor                             222   2e-65   
gb|EAY99223.1|  hypothetical protein OsI_21181                          222   2e-65   Oryza sativa Indica Group [Indian rice]
ref|NP_001056466.1|  Os05g0587000                                       221   3e-65   
gb|AAT44156.1|  putative polygalacturonase                              222   3e-65   Oryza sativa Japonica Group [Japonica rice]
gb|ACN36471.1|  unknown                                                 218   4e-65   Zea mays [maize]
gb|AFW81284.1|  hypothetical protein ZEAMMB73_960645                    221   4e-65   
gb|AIU50436.1|  pectin lyase-like superfamily protein                   219   8e-65   Dioscorea oppositifolia
ref|XP_006646109.1|  PREDICTED: probable polygalacturonase-like         219   2e-64   
ref|XP_003569374.1|  PREDICTED: probable polygalacturonase              219   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_004969187.1|  PREDICTED: probable polygalacturonase-like         219   2e-64   Setaria italica
ref|NP_001170283.1|  uncharacterized protein LOC100384246 precursor     219   2e-64   Zea mays [maize]
ref|XP_002455965.1|  hypothetical protein SORBIDRAFT_03g028140          218   4e-64   Sorghum bicolor [broomcorn]
gb|AIU50449.1|  pectin lyase-like superfamily protein                   217   5e-64   Zea mays [maize]
ref|XP_006837459.1|  PREDICTED: probable polygalacturonase              217   1e-63   Amborella trichopoda
gb|AIU50451.1|  pectin lyase-like superfamily protein                   216   1e-63   Cabomba caroliniana
ref|NP_001141464.1|  uncharacterized protein LOC100273574 precursor     217   2e-63   Zea mays [maize]
ref|XP_002451891.1|  hypothetical protein SORBIDRAFT_04g009310          216   3e-63   Sorghum bicolor [broomcorn]
gb|AIU50417.1|  pectin lyase-like superfamily protein                   207   5e-60   Iris japonica
gb|AIU50447.1|  pectin lyase-like superfamily protein                   205   2e-59   Ginkgo biloba [ginkgo]
gb|EMT32528.1|  Putative polygalacturonase                              204   1e-58   
gb|AIU50428.1|  pectin lyase-like superfamily protein                   191   9e-57   Persea americana
gb|AIU50419.1|  pectin lyase-like superfamily protein                   195   7e-56   Ceratophyllum demersum [hornwort]
gb|KHN38363.1|  Putative polygalacturonase                              187   3e-53   Glycine soja [wild soybean]
ref|XP_009387922.1|  PREDICTED: probable polygalacturonase              167   1e-44   
ref|XP_006584015.1|  PREDICTED: probable polygalacturonase-like i...    165   2e-44   Glycine max [soybeans]
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              167   2e-44   Populus euphratica
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    166   3e-44   Glycine max [soybeans]
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     166   3e-44   Glycine max [soybeans]
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    166   3e-44   Glycine max [soybeans]
ref|XP_003626072.1|  Polygalacturonase                                  166   5e-44   Medicago truncatula
gb|KHN02933.1|  Putative polygalacturonase                              165   5e-44   Glycine soja [wild soybean]
ref|XP_003528627.1|  PREDICTED: probable polygalacturonase-like i...    165   6e-44   Glycine max [soybeans]
gb|KHN14175.1|  Putative polygalacturonase                              166   6e-44   Glycine soja [wild soybean]
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    165   6e-44   Medicago truncatula
ref|XP_011079616.1|  PREDICTED: probable polygalacturonase isofor...    165   8e-44   Sesamum indicum [beniseed]
ref|XP_011079615.1|  PREDICTED: probable polygalacturonase isofor...    165   8e-44   Sesamum indicum [beniseed]
gb|EYU46764.1|  hypothetical protein MIMGU_mgv1a0060621mg               161   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              164   2e-43   Populus euphratica
ref|XP_009412155.1|  PREDICTED: probable polygalacturonase              164   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN69072.1|  hypothetical protein VITISV_012807                     154   2e-43   Vitis vinifera
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    164   3e-43   Glycine max [soybeans]
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    164   3e-43   Glycine max [soybeans]
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase              163   3e-43   Nicotiana sylvestris
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              163   4e-43   
ref|XP_009784607.1|  PREDICTED: probable polygalacturonase isofor...    162   6e-43   Nicotiana sylvestris
ref|XP_009784614.1|  PREDICTED: probable polygalacturonase isofor...    162   7e-43   Nicotiana sylvestris
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    162   7e-43   
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             162   7e-43   Prunus persica
ref|XP_012083013.1|  PREDICTED: probable polygalacturonase              162   7e-43   Jatropha curcas
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             162   8e-43   
ref|XP_003550546.2|  PREDICTED: probable polygalacturonase-like         162   9e-43   Glycine max [soybeans]
ref|XP_009624281.1|  PREDICTED: probable polygalacturonase              162   9e-43   Nicotiana tomentosiformis
gb|KEH43186.1|  polygalacturonase/glycoside hydrolase family protein    161   9e-43   Medicago truncatula
gb|KHN03332.1|  Putative polygalacturonase                              162   1e-42   Glycine soja [wild soybean]
gb|KHN43408.1|  Putative polygalacturonase                              163   1e-42   Glycine soja [wild soybean]
gb|KEH37171.1|  polygalacturonase/glycoside hydrolase family protein    160   1e-42   Medicago truncatula
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    162   1e-42   Elaeis guineensis
ref|XP_007223360.1|  hypothetical protein PRUPE_ppa005599mg             162   1e-42   Prunus persica
ref|XP_008223260.1|  PREDICTED: probable polygalacturonase              161   1e-42   Prunus mume [ume]
ref|XP_004487815.1|  PREDICTED: probable polygalacturonase-like         161   1e-42   Cicer arietinum [garbanzo]
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              161   2e-42   Phoenix dactylifera
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase isofor...    161   2e-42   Fragaria vesca subsp. vesca
ref|XP_010544930.1|  PREDICTED: probable polygalacturonase              156   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_011467185.1|  PREDICTED: probable polygalacturonase isofor...    161   2e-42   Fragaria vesca subsp. vesca
ref|XP_006355845.1|  PREDICTED: probable polygalacturonase-like         161   3e-42   Solanum tuberosum [potatoes]
gb|KEH37170.1|  polygalacturonase/glycoside hydrolase family protein    160   3e-42   Medicago truncatula
ref|XP_010649560.1|  PREDICTED: probable polygalacturonase              157   3e-42   
ref|XP_009624502.1|  PREDICTED: probable polygalacturonase              162   3e-42   Nicotiana tomentosiformis
ref|XP_007138953.1|  hypothetical protein PHAVU_009G252200g             160   3e-42   Phaseolus vulgaris [French bean]
gb|KHN14635.1|  Putative polygalacturonase                              159   3e-42   Glycine soja [wild soybean]
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    161   4e-42   Medicago truncatula
ref|XP_010094123.1|  putative polygalacturonase                         160   4e-42   
gb|ABG34277.1|  polygalacturonase                                       155   5e-42   Eucalyptus globulus subsp. globulus
ref|XP_011463918.1|  PREDICTED: probable polygalacturonase isofor...    160   6e-42   Fragaria vesca subsp. vesca
ref|XP_003591306.1|  Polygalacturonase-like protein                     161   7e-42   
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             159   7e-42   
ref|XP_004298828.1|  PREDICTED: probable polygalacturonase isofor...    160   8e-42   Fragaria vesca subsp. vesca
ref|XP_010241442.1|  PREDICTED: probable polygalacturonase isofor...    158   8e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010652214.1|  PREDICTED: probable polygalacturonase              159   9e-42   Vitis vinifera
ref|XP_008780530.1|  PREDICTED: probable polygalacturonase              154   9e-42   
ref|XP_006597720.1|  PREDICTED: probable polygalacturonase-like i...    159   9e-42   Glycine max [soybeans]
ref|XP_007154320.1|  hypothetical protein PHAVU_003G108700g             159   1e-41   Phaseolus vulgaris [French bean]
ref|XP_004240577.1|  PREDICTED: probable polygalacturonase              159   1e-41   Solanum lycopersicum
ref|XP_003535296.2|  PREDICTED: probable polygalacturonase-like         159   1e-41   Glycine max [soybeans]
ref|XP_002535132.1|  Polygalacturonase precursor, putative              159   1e-41   
ref|XP_006597719.1|  PREDICTED: probable polygalacturonase-like i...    159   1e-41   Glycine max [soybeans]
gb|ERN03187.1|  hypothetical protein AMTR_s00003p00141260               159   1e-41   Amborella trichopoda
emb|CBI36899.3|  unnamed protein product                                159   1e-41   Vitis vinifera
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    159   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    159   2e-41   Cicer arietinum [garbanzo]
gb|ABG34278.1|  polygalacturonase                                       155   2e-41   Eucalyptus globulus subsp. globulus
gb|ABG34275.1|  polygalacturonase                                       153   2e-41   Eucalyptus globulus subsp. globulus
ref|XP_009607671.1|  PREDICTED: probable polygalacturonase              158   3e-41   Nicotiana tomentosiformis
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    158   3e-41   Cicer arietinum [garbanzo]
gb|KHN00242.1|  Putative polygalacturonase                              158   3e-41   Glycine soja [wild soybean]
ref|XP_003533248.1|  PREDICTED: probable polygalacturonase isofor...    158   3e-41   Glycine max [soybeans]
ref|XP_003519731.2|  PREDICTED: probable polygalacturonase-like i...    158   3e-41   Glycine max [soybeans]
ref|XP_004134229.1|  PREDICTED: probable polygalacturonase isofor...    158   3e-41   Cucumis sativus [cucumbers]
ref|XP_011651065.1|  PREDICTED: probable polygalacturonase isofor...    158   4e-41   Cucumis sativus [cucumbers]
gb|KHN26517.1|  Putative polygalacturonase                              158   4e-41   Glycine soja [wild soybean]
emb|CDP17099.1|  unnamed protein product                                157   5e-41   Coffea canephora [robusta coffee]
ref|XP_006586911.1|  PREDICTED: probable polygalacturonase isofor...    157   5e-41   Glycine max [soybeans]
ref|XP_011622358.1|  PREDICTED: probable polygalacturonase              159   6e-41   
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g             157   8e-41   Phaseolus vulgaris [French bean]
gb|KJB34666.1|  hypothetical protein B456_006G077400                    154   8e-41   Gossypium raimondii
ref|XP_011458753.1|  PREDICTED: probable polygalacturonase isofor...    157   8e-41   Fragaria vesca subsp. vesca
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              157   9e-41   Malus domestica [apple tree]
gb|KJB34667.1|  hypothetical protein B456_006G077400                    154   9e-41   Gossypium raimondii
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    157   9e-41   Pyrus x bretschneideri [bai li]
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              157   1e-40   Vitis vinifera
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    157   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_011458751.1|  PREDICTED: probable polygalacturonase isofor...    156   1e-40   Fragaria vesca subsp. vesca
ref|XP_008438914.1|  PREDICTED: probable polygalacturonase isofor...    156   1e-40   Cucumis melo [Oriental melon]
gb|ABR18040.1|  unknown                                                 156   1e-40   Picea sitchensis
ref|XP_008438913.1|  PREDICTED: probable polygalacturonase isofor...    156   2e-40   Cucumis melo [Oriental melon]
ref|XP_002273305.1|  PREDICTED: probable polygalacturonase              156   2e-40   
ref|XP_007145093.1|  hypothetical protein PHAVU_007G209200g             156   2e-40   Phaseolus vulgaris [French bean]
gb|KHN16795.1|  Putative polygalacturonase                              155   2e-40   Glycine soja [wild soybean]
ref|XP_003609706.1|  hypothetical protein MTR_4g120730                  156   2e-40   Medicago truncatula
ref|XP_010679489.1|  PREDICTED: probable polygalacturonase isofor...    156   2e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|KHM99951.1|  Putative polygalacturonase                              155   2e-40   Glycine soja [wild soybean]
ref|XP_010679488.1|  PREDICTED: probable polygalacturonase isofor...    155   2e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS62381.1|  putative polygalacturonase                              152   2e-40   Triticum urartu
gb|KHG12205.1|  putative polygalacturonase                              155   2e-40   Gossypium arboreum [tree cotton]
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              156   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010091430.1|  putative polygalacturonase                         155   2e-40   
gb|KHG14610.1|  putative polygalacturonase                              155   3e-40   Gossypium arboreum [tree cotton]
gb|ABG34276.1|  polygalacturonase                                       150   3e-40   Eucalyptus globulus subsp. globulus
gb|KJB72747.1|  hypothetical protein B456_011G194200                    155   3e-40   Gossypium raimondii
emb|CBI22951.3|  unnamed protein product                                155   3e-40   Vitis vinifera
emb|CDX67875.1|  BnaA07g19150D                                          155   3e-40   
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              155   3e-40   
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...    155   3e-40   
ref|XP_003633958.1|  PREDICTED: probable polygalacturonase              155   3e-40   
ref|XP_009772512.1|  PREDICTED: probable polygalacturonase              155   3e-40   
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...    155   3e-40   
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              155   3e-40   
ref|XP_010276919.1|  PREDICTED: probable polygalacturonase              156   4e-40   
emb|CDY25090.1|  BnaC06g18320D                                          155   4e-40   
sp|A7PZL3.1|PGLR_VITVI  RecName: Full=Probable polygalacturonase;...    155   4e-40   
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...    155   4e-40   
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    155   4e-40   
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...    155   4e-40   
ref|XP_008351179.1|  PREDICTED: probable polygalacturonase              150   4e-40   
gb|AFK37962.1|  unknown                                                 155   4e-40   
ref|XP_010914786.1|  PREDICTED: probable polygalacturonase              155   5e-40   
ref|XP_012066566.1|  PREDICTED: probable polygalacturonase              155   6e-40   
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    155   6e-40   
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    155   6e-40   
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     154   6e-40   
gb|KDO86269.1|  hypothetical protein CISIN_1g0090751mg                  150   7e-40   
ref|XP_010465709.1|  PREDICTED: probable polygalacturonase              154   7e-40   
ref|XP_010259446.1|  PREDICTED: probable polygalacturonase              154   7e-40   
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             154   8e-40   
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...    154   8e-40   
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              154   9e-40   
ref|XP_004503678.1|  PREDICTED: probable polygalacturonase-like i...    154   1e-39   
ref|XP_010487555.1|  PREDICTED: probable polygalacturonase              154   1e-39   
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg                154   1e-39   
emb|CDY11403.1|  BnaA09g39690D                                          154   1e-39   
gb|KJB34665.1|  hypothetical protein B456_006G077400                    154   1e-39   
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    154   1e-39   
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase              154   1e-39   
gb|KHG15709.1|  hypothetical protein F383_10492                         154   2e-39   
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              153   2e-39   
gb|AFK44529.1|  unknown                                                 153   2e-39   
gb|KHG15710.1|  hypothetical protein F383_10492                         154   2e-39   
ref|XP_004508182.1|  PREDICTED: probable polygalacturonase-like         153   2e-39   
ref|XP_010089056.1|  putative polygalacturonase                         153   2e-39   
gb|KJB41375.1|  hypothetical protein B456_007G102200                    151   2e-39   
ref|XP_011007067.1|  PREDICTED: probable polygalacturonase              153   2e-39   
ref|XP_009346202.1|  PREDICTED: probable polygalacturonase              153   2e-39   
gb|KJB52729.1|  hypothetical protein B456_008G274700                    153   3e-39   
ref|XP_011011881.1|  PREDICTED: probable polygalacturonase isofor...    152   3e-39   
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             152   3e-39   
gb|EPS72197.1|  hypothetical protein M569_02558                         152   3e-39   
ref|XP_002986281.1|  hypothetical protein SELMODRAFT_124011             152   4e-39   
ref|XP_011011880.1|  PREDICTED: probable polygalacturonase isofor...    152   4e-39   
ref|XP_002962842.1|  hypothetical protein SELMODRAFT_78556              152   4e-39   
ref|XP_006439488.1|  hypothetical protein CICLE_v10019941mg             152   4e-39   
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...    152   4e-39   
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...    152   4e-39   
ref|XP_002511903.1|  polygalacturonase, putative                        152   4e-39   
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                   152   4e-39   
ref|XP_009395434.1|  PREDICTED: probable polygalacturonase isofor...    152   4e-39   
ref|XP_008361956.1|  PREDICTED: probable polygalacturonase              150   5e-39   
ref|XP_002307030.2|  hypothetical protein POPTR_0005s06430g             152   5e-39   
ref|XP_002526639.1|  polygalacturonase, putative                        152   5e-39   
ref|XP_009395433.1|  PREDICTED: probable polygalacturonase isofor...    152   5e-39   
ref|XP_002314352.2|  hypothetical protein POPTR_0010s00770g             152   6e-39   
ref|XP_002988771.1|  hypothetical protein SELMODRAFT_128450             152   6e-39   
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         152   6e-39   
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase              152   7e-39   
ref|XP_007201026.1|  hypothetical protein PRUPE_ppa006130mg             151   7e-39   
gb|KHG19694.1|  putative polygalacturonase                              152   7e-39   
ref|XP_010941157.1|  PREDICTED: probable polygalacturonase              152   8e-39   
gb|KJB41374.1|  hypothetical protein B456_007G102200                    152   8e-39   
ref|XP_009378738.1|  PREDICTED: probable polygalacturonase isofor...    151   8e-39   
ref|XP_008386709.1|  PREDICTED: probable polygalacturonase              151   8e-39   
gb|KJB41376.1|  hypothetical protein B456_007G102200                    152   8e-39   
ref|XP_009378739.1|  PREDICTED: probable polygalacturonase isofor...    151   8e-39   
ref|XP_002509850.1|  polygalacturonase, putative                        151   9e-39   
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              151   9e-39   
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    151   1e-38   
gb|KJB49712.1|  hypothetical protein B456_008G134500                    151   1e-38   
gb|KJB49711.1|  hypothetical protein B456_008G134500                    151   1e-38   
ref|XP_008340766.1|  PREDICTED: probable polygalacturonase              150   1e-38   
ref|XP_006380233.1|  glycoside hydrolase family 28 family protein       150   1e-38   
ref|XP_002989426.1|  hypothetical protein SELMODRAFT_129742             150   1e-38   
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              151   1e-38   
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             150   1e-38   
emb|CDX76617.1|  BnaC08g32030D                                          150   1e-38   
ref|XP_006297662.1|  hypothetical protein CARUB_v10013686mg             150   2e-38   
ref|XP_008390608.1|  PREDICTED: probable polygalacturonase              150   2e-38   
ref|XP_008794777.1|  PREDICTED: probable polygalacturonase isofor...    151   2e-38   
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    150   2e-38   
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase              151   2e-38   
gb|AFG59706.1|  hypothetical protein 0_17434_01                         142   2e-38   
gb|KJB11781.1|  hypothetical protein B456_001G158900                    150   2e-38   
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    150   2e-38   
ref|XP_003617305.1|  Glycoside hydrolase family 28 protein              143   2e-38   
ref|NP_567126.1|  pectin lyase-like superfamily protein                 150   2e-38   
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       150   2e-38   
emb|CAB71871.1|  putative protein                                       150   2e-38   
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         150   3e-38   
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like         150   3e-38   
ref|XP_006829063.1|  PREDICTED: probable polygalacturonase              150   3e-38   
gb|KDO36047.1|  hypothetical protein CISIN_1g038330mg                   144   3e-38   
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             150   3e-38   
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          150   4e-38   
ref|XP_010523877.1|  PREDICTED: probable polygalacturonase isofor...    149   4e-38   
emb|CDP12065.1|  unnamed protein product                                149   4e-38   
gb|KJB20605.1|  hypothetical protein B456_003G155800                    149   4e-38   
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              149   4e-38   
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              149   5e-38   
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    149   5e-38   
ref|XP_008390626.1|  PREDICTED: probable polygalacturonase              150   5e-38   
ref|XP_010523874.1|  PREDICTED: probable polygalacturonase isofor...    149   6e-38   
gb|EPS71596.1|  hypothetical protein M569_03160                         149   6e-38   
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g             149   6e-38   
gb|KJB20604.1|  hypothetical protein B456_003G155800                    149   6e-38   
ref|XP_003557344.1|  PREDICTED: probable polygalacturonase              149   7e-38   
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    149   7e-38   
ref|XP_010676424.1|  PREDICTED: probable polygalacturonase              149   7e-38   
gb|KEH21119.1|  polygalacturonase/glycoside hydrolase family protein    149   7e-38   
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase              149   7e-38   
gb|AEW08036.1|  hypothetical protein 0_17434_01                         141   8e-38   
ref|XP_002310517.2|  glycoside hydrolase family 28 family protein       149   8e-38   
ref|XP_003592200.1|  Polygalacturonase-like protein                     149   8e-38   
ref|XP_006362679.1|  PREDICTED: probable polygalacturonase-like         149   8e-38   
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              149   8e-38   
ref|XP_008807914.1|  PREDICTED: probable polygalacturonase              149   8e-38   
gb|AFG59697.1|  hypothetical protein 0_17434_01                         140   9e-38   
ref|XP_009346610.1|  PREDICTED: probable polygalacturonase isofor...    148   9e-38   
gb|KHG23155.1|  putative polygalacturonase                              148   1e-37   
ref|XP_010504717.1|  PREDICTED: probable polygalacturonase              148   1e-37   
ref|XP_009346609.1|  PREDICTED: probable polygalacturonase isofor...    148   1e-37   
ref|XP_010027649.1|  PREDICTED: probable polygalacturonase              149   1e-37   
ref|XP_003592202.1|  hypothetical protein MTR_1g100060                  149   1e-37   
ref|XP_006840361.1|  PREDICTED: probable polygalacturonase              148   1e-37   
gb|AES62452.2|  pectin lyase superfamily protein                        148   1e-37   
ref|XP_003592201.1|  Polygalacturonase-like protein                     148   1e-37   
gb|KJB24315.1|  hypothetical protein B456_004G138900                    148   1e-37   
ref|XP_009613774.1|  PREDICTED: probable polygalacturonase              148   1e-37   
ref|XP_002437680.1|  hypothetical protein SORBIDRAFT_10g000660          148   1e-37   
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         148   1e-37   
ref|XP_010933983.1|  PREDICTED: probable polygalacturonase isofor...    148   1e-37   
ref|XP_010523770.1|  PREDICTED: probable polygalacturonase isofor...    148   1e-37   
ref|XP_007051305.1|  Pectin lyase-like superfamily protein isoform 4    146   1e-37   
ref|XP_008345224.1|  PREDICTED: probable polygalacturonase isofor...    148   2e-37   
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              148   2e-37   
ref|XP_010933982.1|  PREDICTED: probable polygalacturonase isofor...    148   2e-37   
ref|XP_007051732.1|  Polygalacturonase, putative isoform 2              148   2e-37   
gb|AES62453.2|  pectin lyase superfamily protein                        148   2e-37   
ref|XP_010276903.1|  PREDICTED: probable polygalacturonase isofor...    147   2e-37   
ref|XP_006842393.1|  PREDICTED: probable polygalacturonase              148   2e-37   
ref|XP_009369995.1|  PREDICTED: probable polygalacturonase isofor...    147   2e-37   
gb|KJB38841.1|  hypothetical protein B456_006G260100                    146   2e-37   
ref|XP_008345223.1|  PREDICTED: probable polygalacturonase isofor...    147   2e-37   
ref|XP_002513653.1|  polygalacturonase, putative                        147   2e-37   
ref|XP_009369994.1|  PREDICTED: probable polygalacturonase isofor...    147   2e-37   
ref|XP_010468984.1|  PREDICTED: probable polygalacturonase              147   2e-37   
ref|XP_006386609.1|  hypothetical protein POPTR_0002s16390g             145   2e-37   
ref|XP_007040335.1|  Pectin lyase-like superfamily protein isoform 1    147   2e-37   
gb|ACG41831.1|  glycoside hydrolase, family 28                          147   2e-37   
gb|KFK39027.1|  hypothetical protein AALP_AA3G191200                    147   3e-37   
ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...    147   3e-37   
ref|XP_010276902.1|  PREDICTED: probable polygalacturonase isofor...    147   3e-37   
ref|XP_008796910.1|  PREDICTED: probable polygalacturonase              147   3e-37   
ref|XP_011092828.1|  PREDICTED: probable polygalacturonase              147   3e-37   
ref|NP_190464.1|  pectin lyase-like superfamily protein                 147   3e-37   
ref|XP_009383709.1|  PREDICTED: probable polygalacturonase              147   3e-37   
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    147   3e-37   
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    147   3e-37   
ref|XP_010512597.1|  PREDICTED: probable polygalacturonase isofor...    148   3e-37   
ref|XP_008795320.1|  PREDICTED: probable polygalacturonase              147   3e-37   
ref|NP_001059282.1|  Os07g0245200                                       147   3e-37   
ref|XP_002960960.1|  hypothetical protein SELMODRAFT_33152              146   3e-37   
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...    147   3e-37   
ref|XP_010523769.1|  PREDICTED: probable polygalacturonase isofor...    147   4e-37   
gb|EEE66877.1|  hypothetical protein OsJ_23693                          147   4e-37   
ref|XP_008235135.1|  PREDICTED: probable polygalacturonase              147   4e-37   
gb|KHN08663.1|  Putative polygalacturonase                              144   4e-37   
ref|NP_001151164.1|  glycoside hydrolase, family 28 precursor           147   4e-37   
gb|AFW75224.1|  glycoside hydrolase, family 28                          147   4e-37   
gb|KHN30667.1|  Putative polygalacturonase                              147   4e-37   
ref|XP_012083329.1|  PREDICTED: probable polygalacturonase              147   4e-37   
gb|KJB38842.1|  hypothetical protein B456_006G260100                    146   5e-37   
gb|KJB39427.1|  hypothetical protein B456_007G0129001                   145   5e-37   
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              147   5e-37   
ref|XP_006295548.1|  hypothetical protein CARUB_v10024654mg             147   5e-37   
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         147   5e-37   
gb|KJB38840.1|  hypothetical protein B456_006G260100                    146   5e-37   
ref|XP_006588584.1|  PREDICTED: probable polygalacturonase-like         146   5e-37   
gb|AFG59707.1|  hypothetical protein 0_17434_01                         139   5e-37   
ref|XP_010276899.1|  PREDICTED: probable polygalacturonase isofor...    147   6e-37   
ref|XP_009384145.1|  PREDICTED: probable polygalacturonase              146   6e-37   
ref|XP_007051302.1|  Pectin lyase-like superfamily protein isoform 1    146   6e-37   
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase              146   6e-37   
emb|CDP20376.1|  unnamed protein product                                146   7e-37   
ref|XP_010527099.1|  PREDICTED: probable polygalacturonase              146   7e-37   
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              146   7e-37   
ref|XP_011022938.1|  PREDICTED: probable polygalacturonase              146   8e-37   
ref|XP_012086833.1|  PREDICTED: probable polygalacturonase              146   8e-37   
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase              146   8e-37   
ref|XP_002967047.1|  hypothetical protein SELMODRAFT_408393             146   8e-37   
ref|XP_007139799.1|  hypothetical protein PHAVU_008G059700g             146   9e-37   
ref|XP_011023292.1|  PREDICTED: probable polygalacturonase isofor...    146   9e-37   
ref|XP_002301370.1|  polygalacturonase-like family protein              146   9e-37   
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...    146   9e-37   
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         146   9e-37   
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like         146   1e-36   
ref|XP_011023291.1|  PREDICTED: probable polygalacturonase isofor...    145   1e-36   
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...    146   1e-36   
ref|XP_009393955.1|  PREDICTED: probable polygalacturonase              140   1e-36   
ref|XP_011099733.1|  PREDICTED: probable polygalacturonase isofor...    145   1e-36   
ref|XP_008437531.1|  PREDICTED: probable polygalacturonase              145   1e-36   
gb|KHN46704.1|  Putative polygalacturonase                              145   1e-36   
ref|XP_007219266.1|  hypothetical protein PRUPE_ppa018224mg             145   1e-36   
ref|XP_006598941.1|  PREDICTED: probable polygalacturonase-like i...    145   1e-36   
ref|XP_003548644.2|  PREDICTED: probable polygalacturonase-like i...    145   1e-36   
gb|EEC81792.1|  hypothetical protein OsI_25505                          146   1e-36   
ref|XP_007035679.1|  Pectin lyase-like superfamily protein              146   1e-36   
ref|XP_009149779.1|  PREDICTED: probable polygalacturonase              145   1e-36   
ref|XP_004240097.1|  PREDICTED: probable polygalacturonase              145   1e-36   
ref|XP_010429342.1|  PREDICTED: probable polygalacturonase              145   1e-36   
ref|XP_003624048.1|  Polygalacturonase                                  145   1e-36   
emb|CDY08095.1|  BnaA06g16310D                                          145   2e-36   
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              145   2e-36   
ref|XP_010934935.1|  PREDICTED: probable polygalacturonase              145   2e-36   
gb|KDO71782.1|  hypothetical protein CISIN_1g012788mg                   145   2e-36   



>ref|XP_009603675.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=448

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
             GDDLV+VKSGWD+YGIAYGRPSHGITIRR+TGSSPF+GI+VGSETSGG+VDVLAEHINL
Sbjct  249  VGDDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTNIGRGG+IRNITVSNVYMEN RTGIKIAGDVGDHPD  FNPNALP+V G
Sbjct  309  FNMGVGIHIKTNIGRGGVIRNITVSNVYMENTRTGIKIAGDVGDHPDENFNPNALPVVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVS  255
            IKI+DVWG+KV Q G IRGLK SPF+ ICLSNI+L+G +  PRN PWKCSDV GAAIQVS
Sbjct  369  IKIKDVWGEKVLQAGLIRGLKNSPFSGICLSNINLHGNNPGPRNSPWKCSDVSGAAIQVS  428

Query  254  PWPCSELATNHRYGACSATL  195
            PWPCSEL ++ + GACS  L
Sbjct  429  PWPCSELTSSQQTGACSTYL  448



>gb|KDO76503.1| hypothetical protein CISIN_1g0134022mg [Citrus sinensis]
Length=280

 Score =   295 bits (756),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS GITIRRVTGSSPFSGI+VGSETSGG+ +VLAEHINL
Sbjct  82   TGDDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINL  141

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+G
Sbjct  142  YNVGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNG  201

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DVWG KV Q G I+GLK SPFT ICLSNI+L G + P +PP KCSDV G+A QV P
Sbjct  202  ITIKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKP  261

Query  251  WPCSELATNHRYGACS  204
            WPCSEL+++ + GACS
Sbjct  262  WPCSELSSSQQTGACS  277



>gb|KDO76502.1| hypothetical protein CISIN_1g0134022mg [Citrus sinensis]
Length=328

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS GITIRRVTGSSPFSGI+VGSETSGG+ +VLAEHINL
Sbjct  130  TGDDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINL  189

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+G
Sbjct  190  YNVGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNG  249

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DVWG KV Q G I+GLK SPFT ICLSNI+L G + P +PP KCSDV G+A QV P
Sbjct  250  ITIKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKP  309

Query  251  WPCSELATNHRYGACS  204
            WPCSEL+++ + GACS
Sbjct  310  WPCSELSSSQQTGACS  325



>emb|CDP12145.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPSHGITIRRVTGSSPF+GI++GSETSGGI DVLAEHINL
Sbjct  249  TGDDLVAVKSGWDEYGIAYGRPSHGITIRRVTGSSPFAGIAIGSETSGGIEDVLAEHINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTN+GRGG+IRNITVSNVYM+NAR GIKIAGDVGDHPD  +NPNALP+V  
Sbjct  309  YNMGVGIHLKTNVGRGGVIRNITVSNVYMQNARKGIKIAGDVGDHPDTNYNPNALPVVKD  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG+ V Q G I+GLK SPFT ICLSNI+L G   PRNPPWKCSDV GAA++VSP
Sbjct  369  VTIKDVWGEGVLQSGQIQGLKNSPFTGICLSNINLQGNVGPRNPPWKCSDVSGAAVRVSP  428

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL + ++ G+CS + 
Sbjct  429  WPCSELTSTYQAGSCSNSF  447



>ref|XP_009767931.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=454

 Score =   298 bits (764),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 176/194 (91%), Gaps = 1/194 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
             GDDLV+VKSGWD+YGIAYGRPSHGITIRR+TGSSPF+GI+VGSETSGG+ DVLAEHINL
Sbjct  249  VGDDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVADVLAEHINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +++GVGIHIKTNIGRGG+IRNITVSNVYMEN RTGIKIAGDVGDHPD +FNPNALP+V G
Sbjct  309  FDMGVGIHIKTNIGRGGVIRNITVSNVYMENTRTGIKIAGDVGDHPDEKFNPNALPVVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVS  255
            IKI+DVWG+KV Q G IRGLK SPF+ ICLSNI+L+G +  PRN PWKCSDV GAAIQVS
Sbjct  369  IKIKDVWGEKVLQAGLIRGLKNSPFSGICLSNINLHGNNPGPRNSPWKCSDVSGAAIQVS  428

Query  254  PWPCSELATNHRYG  213
            PWPCSEL ++ + G
Sbjct  429  PWPCSELTSSQQTG  442



>gb|KDO76501.1| hypothetical protein CISIN_1g0134022mg, partial [Citrus sinensis]
Length=335

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS GITIRRVTGSSPFSGI+VGSETSGG+ +VLAEHINL
Sbjct  137  TGDDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINL  196

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+G
Sbjct  197  YNVGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNG  256

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DVWG KV Q G I+GLK SPFT ICLSNI+L G + P +PP KCSDV G+A QV P
Sbjct  257  ITIKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKP  316

Query  251  WPCSELATNHRYGACS  204
            WPCSEL+++ + GACS
Sbjct  317  WPCSELSSSQQTGACS  332



>ref|XP_011101030.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=447

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL++VKSGWDEYGIAYGRPSHGITIRRVTGSSPF+GI+VGSETSGG+ DVLAEHINL
Sbjct  249  TGDDLIAVKSGWDEYGIAYGRPSHGITIRRVTGSSPFAGIAVGSETSGGVEDVLAEHINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIH+KTN+GRGG+IRNITVSNVYME+AR GIKI+GDVGDHPD  +N NALP++  
Sbjct  309  FNMGVGIHLKTNVGRGGVIRNITVSNVYMEDARKGIKISGDVGDHPDEYYNRNALPVLKD  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+++WG++V QPG I GLK +PFT ICLSNIHL GA  PRN PW+CSDV GAA+QVSP
Sbjct  369  VVIKNIWGERVQQPGLIHGLKNAPFTGICLSNIHLRGARGPRNLPWQCSDVRGAAVQVSP  428

Query  251  WPCSELATNHRYGACSATL  195
            WPCS+L ++ + GACS++ 
Sbjct  429  WPCSQLTSHQQTGACSSSF  447



>ref|XP_006439367.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
 gb|ESR52607.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
Length=443

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS GITIRRVTGSSPFSGI+VGSETSGG+ +VLAEHINL
Sbjct  245  TGDDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINL  304

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+G
Sbjct  305  YNVGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNG  364

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DVWG KV Q G I+GLK SPFT ICLSNI+L G + P +PP KCSDV G+A QV P
Sbjct  365  ITIKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKP  424

Query  251  WPCSELATNHRYGACS  204
            WPCSEL+++ + GACS
Sbjct  425  WPCSELSSSQQTGACS  440



>ref|XP_006476397.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=443

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS GITIRRVTGSSPFSGI+VGSETSGG+ +VLAEHINL
Sbjct  245  TGDDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINL  304

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+G
Sbjct  305  YNVGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNG  364

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DVWG KV Q G I+GLK SPFT ICLSNI+L+G + P +PP KCSDV G+A QV P
Sbjct  365  ITIKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLHGVAGPTSPPLKCSDVSGSAYQVKP  424

Query  251  WPCSELATNHRYGACS  204
            WPCSEL+ + + GACS
Sbjct  425  WPCSELSGSQQTGACS  440



>ref|XP_006343870.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=447

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
             GDDLV+VKSGWD+YGIAYGRPSHGITIRR+TGSSPF+GI+VGSETSGG+VDVLAEHI+L
Sbjct  249  VGDDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTNIGRGG+IRNITVSNVYMENARTGIKIAGDVGDHP+  FNPNALP+V G
Sbjct  309  FNMGVGIHIKTNIGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPNENFNPNALPVVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            IKI+DVWG+KV Q G I GLK SPF+ ICLSNI+L+G    +N  WKCSDV GAAIQVSP
Sbjct  369  IKIKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLHGNPGSQNSIWKCSDVSGAAIQVSP  428

Query  251  WPCSELATNHRYGACSA  201
            +PC+EL ++ + GACS 
Sbjct  429  FPCAELTSSQQTGACST  445



>ref|XP_004245522.1| PREDICTED: probable polygalacturonase isoform X2 [Solanum lycopersicum]
Length=466

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDLV+VKSGWD+YGIAYGRPSHGITIRR+TGSSPF+GI+VGSETSGG+VDVLAEHI+L+
Sbjct  259  GDDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISLF  318

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
            N+GVGIHIKTN+GRGG+IRNITVSNVYMENARTGIKIAGDVGDHPD  FNPNALP+V GI
Sbjct  319  NMGVGIHIKTNVGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPDENFNPNALPVVKGI  378

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
            KI+DVWG+KV Q G I GLK SPF+ ICLSNI+L G   PRN  WKCSDV GAAIQVSP+
Sbjct  379  KIKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLRGNPGPRNSIWKCSDVSGAAIQVSPF  438

Query  248  PCSELATNHRYGA  210
            PC+EL ++ + G 
Sbjct  439  PCAELTSSQKTGC  451



>ref|XP_010325363.1| PREDICTED: probable polygalacturonase isoform X1 [Solanum lycopersicum]
Length=476

 Score =   293 bits (751),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDLV+VKSGWD+YGIAYGRPSHGITIRR+TGSSPF+GI+VGSETSGG+VDVLAEHI+L+
Sbjct  259  GDDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISLF  318

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
            N+GVGIHIKTN+GRGG+IRNITVSNVYMENARTGIKIAGDVGDHPD  FNPNALP+V GI
Sbjct  319  NMGVGIHIKTNVGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPDENFNPNALPVVKGI  378

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
            KI+DVWG+KV Q G I GLK SPF+ ICLSNI+L G   PRN  WKCSDV GAAIQVSP+
Sbjct  379  KIKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLRGNPGPRNSIWKCSDVSGAAIQVSPF  438

Query  248  PCSELATNHRYG  213
            PC+EL ++ + G
Sbjct  439  PCAELTSSQKTG  450



>ref|XP_010266478.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=448

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRRVTGSSPFSGI++GSETSGG+ DVLAE+INL
Sbjct  250  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRVTGSSPFSGIAIGSETSGGVEDVLAENINL  309

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+G+GIH+KTNIGRGG IRNITVS+VYMENA+ GI+IAGDVGDHPD++FNPNALP+V+G
Sbjct  310  YNMGIGIHLKTNIGRGGFIRNITVSDVYMENAQKGIRIAGDVGDHPDDKFNPNALPVVNG  369

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG KV Q G I+GLK SPFT ICLSNI+L GA +P + PWKCSDV GAA+QVSP
Sbjct  370  VMIKNVWGVKVQQSGSIQGLKNSPFTQICLSNINLRGAVAPGSTPWKCSDVSGAAVQVSP  429

Query  251  WPCSELATNHRYGACSA  201
            WPCSEL    R  +CS+
Sbjct  430  WPCSELIGTGRTASCSS  446



>ref|XP_002304552.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE79531.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=447

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPFSGI+VGSETSGG+ +VL E++NL
Sbjct  249  TGDDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFSGIAVGSETSGGVKNVLVENVNL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIHIKTNIGRGG I+NITV++VYMEN R GIKIAGDVGDHPD+ FNPNALP+V G
Sbjct  309  YNMGVGIHIKTNIGRGGFIKNITVTDVYMENVRKGIKIAGDVGDHPDDSFNPNALPVVYG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++ +WG+KV QPG I+GLK SPFT ICLSNI+L+G   PR+ PWKCSDV G+A+ VSP
Sbjct  369  ITLKSIWGEKVQQPGSIQGLKNSPFTGICLSNINLHGVPGPRSSPWKCSDVSGSALLVSP  428

Query  251  WPCSELATNHRYGACS  204
            WPCSEL + H+ G+CS
Sbjct  429  WPCSELTSPHQTGSCS  444



>gb|AIU50439.1| pectin lyase-like superfamily protein, partial [Solanum lycopersicum]
Length=406

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 170/191 (89%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
             GDDLV+VKSGWD+YGIAYGRPSHGITIRR+TGSSPF+GI+VGSETSGG+VDVLAEHI+L
Sbjct  221  VGDDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTN+GRGG+IRNITVSNVYMENARTGIKIAGDVGDHPD  FNPNALP+V G
Sbjct  281  FNMGVGIHIKTNVGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPDENFNPNALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            IKI+DVWG+KV Q G I GLK SPF+ ICLSNI+L G     N  WKCSDV GAAIQVSP
Sbjct  341  IKIKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLRG-----NSIWKCSDVSGAAIQVSP  395

Query  251  WPCSELATNHR  219
            +PC+EL ++ +
Sbjct  396  FPCAELTSSQK  406



>ref|XP_010659126.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 emb|CBI34471.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR+TGSSPF+GI+VGSETSGG+ +V AEHINL
Sbjct  249  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRITGSSPFAGIAVGSETSGGVQNVFAEHINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG+IRNITVSNVYME ARTGIKIAGDVGDHPD+ FNPNALP+V G
Sbjct  309  YNMGVGIHLKTNIGRGGVIRNITVSNVYMEKARTGIKIAGDVGDHPDDNFNPNALPVVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG  V QPG I GLK SPFT ICLS I+L+G   P   PWKCSDV GAA+ VSP
Sbjct  369  VVIRDVWGLDVLQPGSIIGLKNSPFTGICLSKINLHGKIKPGTAPWKCSDVSGAAVGVSP  428

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL +  + G+CS+ +
Sbjct  429  WPCSELTSPGQTGSCSSFI  447



>ref|XP_011073737.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
 ref|XP_011073743.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=449

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTGSSPF+GI+VGSETSGG+ DVLAEHINL
Sbjct  251  TGDDLVAVKSGWDEYGIAYGRPSQDITIRRVTGSSPFAGIAVGSETSGGVEDVLAEHINL  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+G GIH+KTNIGRGG+IRNIT+SNVYM+ AR GIKI+GDVGDHPD  +NP ALP++  
Sbjct  311  FNMGFGIHLKTNIGRGGVIRNITISNVYMDKARKGIKISGDVGDHPDENYNPKALPVLKD  370

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            +KI+DVWG +V QPG IRGLK +PF+ ICLSNI L GA+  R+ PW+CSDV G A+QVSP
Sbjct  371  VKIKDVWGDRVQQPGLIRGLKDAPFSGICLSNISLGGATGQRDLPWQCSDVSGGAVQVSP  430

Query  251  WPCSELATNHRYGACSATL  195
             PCSEL ++ + GAC+++ 
Sbjct  431  LPCSELTSSQQIGACASSF  449



>ref|XP_012086739.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 gb|KDP25309.1| hypothetical protein JCGZ_20465 [Jatropha curcas]
Length=448

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR+TGSSPF+GI+VGSETSGG+ +V AE+INL
Sbjct  249  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRITGSSPFAGIAVGSETSGGVENVFAENINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y++GVGIH+KTNIGRGG IRNITVS+VYMEN R GIKIAGDVGDHPD+ +NPNALP+V G
Sbjct  309  YDMGVGIHVKTNIGRGGFIRNITVSDVYMENVRKGIKIAGDVGDHPDDDYNPNALPVVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRN-PPWKCSDVHGAAIQVS  255
            I ++ VWG+KV QPG I+G+K SPFT ICLSNI+L+G   PR+ PPWKCS V GAA++VS
Sbjct  369  ITLKGVWGEKVLQPGSIQGVKNSPFTGICLSNINLHGVPGPRSTPPWKCSYVSGAALEVS  428

Query  254  PWPCSELATNHRYGACS  204
            PWPCSELAT  + G+CS
Sbjct  429  PWPCSELATTSQVGSCS  445



>gb|AIU50429.1| pectin lyase-like superfamily protein, partial [Solanum tuberosum]
Length=406

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 171/191 (90%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
             GDDLV+VKSGWD+YGIAYGRPSHGITIRR+TGSSPF+GI+VGSETSGG+VDVLAEHI+L
Sbjct  221  VGDDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTNIGRGG+IRNITVSNVYMENARTGIKIAGDVGDHP+  FNPNALP+V G
Sbjct  281  FNMGVGIHIKTNIGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPNENFNPNALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            IKI+DVWG+KV Q G I GLK SPF+ ICLSNI+L+G     N  WKCSDV GAAIQVSP
Sbjct  341  IKIKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLHG-----NSIWKCSDVSGAAIQVSP  395

Query  251  WPCSELATNHR  219
            +PC+EL ++ +
Sbjct  396  FPCAELTSSQQ  406



>gb|AIU50408.1| pectin lyase-like superfamily protein, partial [Citrus clementina]
 gb|AIU50412.1| pectin lyase-like superfamily protein, partial [Citrus sinensis]
Length=406

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 168/191 (88%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS GITIRRVTGSSPFSGI+VGSETSGG+ +VLAEHINL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+G
Sbjct  281  YNVGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DVWG KV Q G I+GLK SPFT ICLSNI+L G+     PP KCSDV G+A QV P
Sbjct  341  ITIKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGS-----PPLKCSDVSGSAYQVKP  395

Query  251  WPCSELATNHR  219
            WPCSEL+++ +
Sbjct  396  WPCSELSSSQQ  406



>ref|XP_011022514.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=447

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI+VGSETSGG+ +VL E+I+L
Sbjct  249  TGDDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAVGSETSGGVKNVLVENISL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIHIKTNIGRGG I+NI+V++VYMEN R GIKIAGDVGDHPD  FNPNALP+V G
Sbjct  309  YNMGVGIHIKTNIGRGGFIKNISVTDVYMENVRKGIKIAGDVGDHPDESFNPNALPVVYG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++ +WG+KV  PG I+GLK SPFT ICLSNI+L+G   PR+ PWKCSDV G+A+ VSP
Sbjct  369  ITLKSIWGEKVQHPGSIQGLKNSPFTGICLSNINLHGVPGPRSSPWKCSDVSGSALLVSP  428

Query  251  WPCSELATNHRYGACS  204
            WPCSEL++ H+ G+CS
Sbjct  429  WPCSELSSPHQTGSCS  444



>ref|XP_002509949.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF51336.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=446

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI+VGSETSGG+  VLAE+INL
Sbjct  248  TGDDLVAVKSGWDEYGIAYGRPSSHITIRRITGSSPFAGIAVGSETSGGVEHVLAENINL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y++GVG+H+KTNIGRGG IRNIT S+VYM+NAR GIKIAGDVGDHPD+ +NPNALP+V G
Sbjct  308  YDMGVGLHVKTNIGRGGFIRNITFSDVYMKNARKGIKIAGDVGDHPDDNYNPNALPVVKG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  + VWG+ V QPG I+GLK SPFT ICLSNI+L+G   PR+ PWKCSDV GAA++VSP
Sbjct  368  IIFRGVWGENVLQPGAIQGLKSSPFTGICLSNINLHGVPGPRSTPWKCSDVSGAALEVSP  427

Query  251  WPCSELATNHRYGACS  204
            +PCSELAT H+ G+CS
Sbjct  428  FPCSELATTHQTGSCS  443



>ref|XP_010261531.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
 ref|XP_010261532.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=447

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD+V+VKSGWDEYGIAYGRPS  ITIRRVTGSSPF+GI++GSETSGG+ +VLAE+INL
Sbjct  249  TGDDMVAVKSGWDEYGIAYGRPSSNITIRRVTGSSPFAGIAIGSETSGGVENVLAENINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y +GVGIHIKTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD+ FNPNALP+V G
Sbjct  309  YKMGVGIHIKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDNFNPNALPVVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG +V Q G I+GLK SPFT ICLSNI+L G   P   PWKCSDV GAA +VSP
Sbjct  369  ITIKNVWGVQVQQSGSIQGLKNSPFTEICLSNINLRGVLVPGTTPWKCSDVSGAAFEVSP  428

Query  251  WPCSELATNHRYGACSA  201
            WPCSEL +    G+CS 
Sbjct  429  WPCSELISKSGTGSCSV  445



>gb|AIU50426.1| pectin lyase-like superfamily protein, partial [Manihot esculenta]
Length=406

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 170/191 (89%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRRVTGSSPF+GI+VGSETSGG+ +VLAE+INL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRVTGSSPFAGIAVGSETSGGVENVLAENINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y++GVGIH+KTNIGRGG IRNIT+S+VYMEN R GIKIAGDVGDHPD++FNP ALP+V G
Sbjct  281  YDMGVGIHVKTNIGRGGFIRNITISDVYMENVRKGIKIAGDVGDHPDDKFNPYALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++ VWG+KV QPG I+GLK SPFT ICLSNI+L+G++     PWKCSDV GAA++VSP
Sbjct  341  ITLKGVWGEKVQQPGSIQGLKDSPFTGICLSNINLHGST-----PWKCSDVSGAALEVSP  395

Query  251  WPCSELATNHR  219
            WPCSEL T H+
Sbjct  396  WPCSELTTTHQ  406



>ref|XP_003545367.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=446

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  249  TGDDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAIGSETSGGVENVLAEHINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+G+GIHIKTN GRGG I+NIT+S+VYME AR GI+I+GDVGDHPD++F+ NALP+V G
Sbjct  309  YNMGIGIHIKTNTGRGGFIKNITMSHVYMEEARKGIRISGDVGDHPDDKFDANALPLVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG KV Q G I+GL+ SPFT ICL +I+L+G + PR PPWKCSDV G A QVSP
Sbjct  369  VTIKNVWGMKVLQAGLIQGLRNSPFTDICLYDINLHGVTGPRTPPWKCSDVSGFAHQVSP  428

Query  251  WPCSELATNHRYGACS  204
            WPCSEL++N + G+C+
Sbjct  429  WPCSELSSNQQ-GSCA  443



>gb|KHN12010.1| Putative polygalacturonase [Glycine soja]
Length=446

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  249  TGDDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAIGSETSGGVENVLAEHINL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+G+GIHIKTN GRGG I+NIT+S+VYME AR GI+I+GDVGDHPD++F+ NALP+V G
Sbjct  309  YNMGIGIHIKTNTGRGGFIKNITMSHVYMEEARKGIRISGDVGDHPDDKFDVNALPLVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG KV Q G I+GL+ SPFT ICL +I+L+G + PR PPWKCSDV G A QVSP
Sbjct  369  VTIKNVWGMKVLQAGLIQGLRNSPFTDICLYDINLHGVTGPRTPPWKCSDVSGFAHQVSP  428

Query  251  WPCSELATNHRYGACS  204
            WPCSEL++N + G+C+
Sbjct  429  WPCSELSSNQQ-GSCA  443



>ref|XP_003551949.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=442

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS+GITIRRVTGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  247  TGDDLVAVKSGWDEYGIAYGRPSYGITIRRVTGSSPFAGIAIGSETSGGVENVLAEHINL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTN GRGG+I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V G
Sbjct  307  FNMGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV+Q G I GL+ SPFT +CLS+I+ +G   PR+P WKCSDV G A QVSP
Sbjct  367  ITIKNVWGVKVNQAGLIHGLRNSPFTDVCLSDINFHGMEGPRSPSWKCSDVFGFAHQVSP  426

Query  251  WPCSELATNHRYGACS  204
            WPCS+L++    G+C+
Sbjct  427  WPCSQLSSQEP-GSCA  441



>ref|XP_006586032.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=443

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS+GITIRR+TGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  248  TGDDLVAVKSGWDEYGIAYGRPSYGITIRRLTGSSPFAGIAIGSETSGGVENVLAEHINL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTN GRGG+I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V G
Sbjct  308  FNMGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG +V+Q G I GL+ SPFT +CLSNI+ +G   PR+P WKCSDV G A QVSP
Sbjct  368  ITIKNVWGVRVNQAGLIHGLRNSPFTDVCLSNINFHGMRGPRSPSWKCSDVFGFAHQVSP  427

Query  251  WPCSELATNHRYGACS  204
            WPCS+L++    G+C+
Sbjct  428  WPCSQLSSQEP-GSCA  442



>ref|XP_007141479.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
 gb|ESW13473.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
Length=442

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS  ITIRRV+GSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  245  TGDDLVAVKSGWDEYGIAYGLPSSNITIRRVSGSSPFAGIAIGSETSGGVENVLAEHINL  304

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y +G+GIHIKTN GRGG I+NITVS+VYME+AR GI+I+GDVGDHPD++F+PNALPIV G
Sbjct  305  YKMGIGIHIKTNSGRGGFIKNITVSHVYMEDARKGIRISGDVGDHPDDKFDPNALPIVKG  364

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + +++VWG KV Q G I+G+K SPF+ ICL +I+L G + PR PPWKCSDV G A QVSP
Sbjct  365  VTMKNVWGVKVLQAGLIQGVKNSPFSDICLYDINLGGVTGPRTPPWKCSDVSGFAHQVSP  424

Query  251  WPCSELATNHRYGACS  204
            WPCSEL++NH+ G+C+
Sbjct  425  WPCSELSSNHQ-GSCA  439



>gb|KHN28527.1| Putative polygalacturonase [Glycine soja]
Length=457

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS+GITIRRVTGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  262  TGDDLVAVKSGWDEYGIAYGRPSYGITIRRVTGSSPFAGIAIGSETSGGVENVLAEHINL  321

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTN GRGG+I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V G
Sbjct  322  FNMGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKG  381

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV+Q G I GL+ SPFT +CLS+I+ +G   PR+P WKCSDV G A QVSP
Sbjct  382  ITIKNVWGVKVNQAGLIHGLRNSPFTDVCLSDINFHGMEGPRSPSWKCSDVFGFAHQVSP  441

Query  251  WPCSELATNHRYGACS  204
            WPCS+L++    G+C+
Sbjct  442  WPCSQLSSQEP-GSCA  456



>gb|KHM99685.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS+GITIRR+TGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  230  TGDDLVAVKSGWDEYGIAYGRPSYGITIRRLTGSSPFAGIAIGSETSGGVENVLAEHINL  289

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTN GRGG+I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V G
Sbjct  290  FNMGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKG  349

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG +V+Q G I GL+ SPFT +CLSNI+ +G   PR+P WKCSDV G A QVSP
Sbjct  350  ITIKNVWGVRVNQAGLIHGLRNSPFTDVCLSNINFHGMRGPRSPSWKCSDVFGFAHQVSP  409

Query  251  WPCSELATNHRYGACS  204
            WPCS+L++    G+C+
Sbjct  410  WPCSQLSSQEP-GSCA  424



>ref|XP_004499965.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=449

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGI+YGRPS+GITIRR+TGSSPF+GI++GSETSGG+ ++LAEHINL
Sbjct  252  TGDDLVAVKSGWDEYGISYGRPSYGITIRRLTGSSPFAGIAIGSETSGGVENILAEHINL  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTNIGRGG I+NITVSNVY+ENAR GIKIAGDVGDHPD  F+PNALP+V G
Sbjct  312  FNMGVGIHIKTNIGRGGFIKNITVSNVYIENARQGIKIAGDVGDHPDENFDPNALPVVKG  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I +++VWG KV Q G I GL+ SPFT IC  +I+ +G + PR+PPWKCSDV G + QVSP
Sbjct  372  ITVKNVWGVKVLQAGLIHGLRDSPFTEICFYDINFHGVTGPRSPPWKCSDVFGFSHQVSP  431

Query  251  WPCSELATNHRYGACS  204
            WPCS+L++  + G+C+
Sbjct  432  WPCSQLSS-QQPGSCT  446



>ref|XP_008239046.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=442

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRRV GSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  244  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRVRGSSPFAGIAIGSETSGGVENVLAEHINL  303

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIHIKTNIGRG  IRNITVS+VYME  R GIKIAGDVGDHPD+++N NALP+V G
Sbjct  304  YNMGVGIHIKTNIGRGAFIRNITVSDVYMEKVRRGIKIAGDVGDHPDDKYNQNALPVVKG  363

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++DVWG +  Q G I GLK SPFT ICLSNI+L+G +  R+PPWKCSD+ GAA  VSP
Sbjct  364  ITLKDVWGVQAQQAGVILGLKNSPFTGICLSNINLHGMTGSRSPPWKCSDISGAAHLVSP  423

Query  251  WPCSELATNHRYGACS  204
              CSEL++  R   CS
Sbjct  424  LQCSELSSAQRASTCS  439



>gb|AIU50442.1| pectin lyase-like superfamily protein, partial [Vitis vinifera]
Length=406

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 164/188 (87%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR+TGSSPF+GI+VGSETSGG+ +V AEHINL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRITGSSPFAGIAVGSETSGGVQNVFAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIH+KTNIGRGG+IRNITVSNVYME ARTGIKIAGDVGDHPD+ FNPNALP+V G
Sbjct  281  YNMGVGIHLKTNIGRGGVIRNITVSNVYMEKARTGIKIAGDVGDHPDDNFNPNALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG  V QPG I GLK SPFT ICLS I+L+G +     PWKCSDV GAA+ VSP
Sbjct  341  VVIRDVWGLDVLQPGSIIGLKNSPFTGICLSKINLHGTA-----PWKCSDVSGAAVGVSP  395

Query  251  WPCSELAT  228
            WPCSEL +
Sbjct  396  WPCSELTS  403



>gb|AIU50430.1| pectin lyase-like superfamily protein, partial [Populus trichocarpa]
Length=406

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 167/191 (87%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPFSGI+VGSETSGG+ +VL E++NL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFSGIAVGSETSGGVKNVLVENVNL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIHIKTNIGRGG I+NITV++VYMEN R GIKIAGDVGDHPD+ FNPNALP+V G
Sbjct  281  YNMGVGIHIKTNIGRGGFIKNITVTDVYMENVRKGIKIAGDVGDHPDDSFNPNALPVVYG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++ +WG+KV QPG I+GLK SPFT ICLSNI+L+G+S     PWKCSDV G+A+ VSP
Sbjct  341  ITLKSIWGEKVQQPGSIQGLKNSPFTGICLSNINLHGSS-----PWKCSDVSGSALLVSP  395

Query  251  WPCSELATNHR  219
            WPCSEL + H+
Sbjct  396  WPCSELTSPHQ  406



>gb|KJB39696.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=280

 Score =   267 bits (682),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTGSSPF+GI+VGSETSGG+  VLAE+I +
Sbjct  82   TGDDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVI  141

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G
Sbjct  142  YNSGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKG  201

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG KV + G I+GLK +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP
Sbjct  202  VTLKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSP  261

Query  251  WPCSELATNHRYGACS  204
             PC++L++  + G+C+
Sbjct  262  SPCAQLSSPQQSGSCA  277



>gb|AIU50410.1| pectin lyase-like superfamily protein, partial [Carica papaya]
Length=405

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 169/190 (89%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR+TGSSPF+GI++GSETSGG+++VLAEHINL
Sbjct  220  TGDDLVAVKSGWDEYGIAYGRPSFGITIRRITGSSPFAGIAIGSETSGGVLNVLAEHINL  279

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +++GVGI++KTNIGRGG+I NIT+S+VYMEN RTG+KIAGD GDHPD++FNPNALP+V G
Sbjct  280  FDMGVGINVKTNIGRGGVIENITISDVYMENVRTGLKIAGDTGDHPDDKFNPNALPVVKG  339

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G I GLK SPFT ICL+N++L+G     +P WKCSDV GAA++VSP
Sbjct  340  ITIKNVWGVKVQRAGSILGLKDSPFTGICLANVNLHG-----DPTWKCSDVSGAALKVSP  394

Query  251  WPCSELATNH  222
            WPCSELA+ +
Sbjct  395  WPCSELASTY  404



>ref|XP_007209143.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
 gb|EMJ10342.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
Length=442

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRRV GSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  244  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRVRGSSPFAGIAIGSETSGGVENVLAEHINL  303

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIHIKTNIGRGG IRNITVS+VYME  R GIKIAGDVGDHPD+++N NALP+V G
Sbjct  304  YNMGVGIHIKTNIGRGGFIRNITVSDVYMEEVRRGIKIAGDVGDHPDDKYNQNALPVVKG  363

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++D+WG +V Q G I GLK SPFT ICLSNI+L+G +  R+PPWKCSD+ GAA  VSP
Sbjct  364  ITLKDIWGVQVQQAGVILGLKNSPFTGICLSNINLHGMTGSRSPPWKCSDISGAAHLVSP  423

Query  251  WPCSELATNHRYGACS  204
              CSEL+   +   CS
Sbjct  424  LQCSELSGAQQASTCS  439



>ref|XP_007040496.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY24997.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=448

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTG+SPFSGI+VGSETSGG+ +VLAE+I L
Sbjct  250  TGDDLVAVKSGWDEYGIAYGRPSSCITIRRVTGTSPFSGIAVGSETSGGVENVLAENIVL  309

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G+++KTNIGRGG I+NITVS V+MEN RTGIKIAGD GDHPDN FNPNALP V G
Sbjct  310  YNTGIGVNVKTNIGRGGFIKNITVSEVFMENVRTGIKIAGDTGDHPDNNFNPNALPYVKG  369

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            +  +++WG KV + G I+GLK +PFT ICLS ++L+G + P +PPWKCSDV GAAI+VSP
Sbjct  370  VTFKNIWGVKVQRAGSIQGLKNAPFTGICLSKVNLHGTTGPGSPPWKCSDVSGAAIEVSP  429

Query  251  WPCSELATNHRYGACSA  201
            WPC+EL +  + G+C++
Sbjct  430  WPCAELTSPQQSGSCAS  446



>gb|AIU50416.1| pectin lyase-like superfamily protein, partial [Buxus sinica]
Length=406

 Score =   268 bits (685),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD+V+VKSGWDEYGIA+GRPS  ITIRR+TGSSPF+GI++GSETSGG+ ++LAE+INL
Sbjct  221  TGDDMVAVKSGWDEYGIAFGRPSSSITIRRITGSSPFAGIAIGSETSGGVENILAENINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YNIGVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+G
Sbjct  281  YNIGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+ VWG KV QPG I+GLK SPFT ICLSNI+L+G +     PWKCSDV G AI V P
Sbjct  341  ITIRRVWGVKVQQPGLIQGLKNSPFTGICLSNINLHGGT-----PWKCSDVSGTAIVVKP  395

Query  251  WPCSELAT  228
            WPCS+  +
Sbjct  396  WPCSQFTS  403



>gb|KHG27846.1| putative polygalacturonase [Gossypium arboreum]
Length=404

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGI YGRPS  ITIRRVTGSSPF+GI+VGSETSGG+  VLAE+I +
Sbjct  206  TGDDLVAVKSGWDEYGIGYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVI  265

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G++IKTNIGRGG I+NITVS V+MEN RTGIKIAGD GDHPDNRFNPNALP V G
Sbjct  266  YNSGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKIAGDTGDHPDNRFNPNALPYVKG  325

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG KV + G I+GLK +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP
Sbjct  326  VTLKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSP  385

Query  251  WPCSELATNHRYGACS  204
             PC++L++  + G+C+
Sbjct  386  SPCAQLSSPQQSGSCA  401



>gb|KJB39695.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=343

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTGSSPF+GI+VGSETSGG+  VLAE+I +
Sbjct  145  TGDDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVI  204

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G
Sbjct  205  YNSGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKG  264

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG KV + G I+GLK +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP
Sbjct  265  VTLKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSP  324

Query  251  WPCSELATNHRYGACS  204
             PC++L++  + G+C+
Sbjct  325  SPCAQLSSPQQSGSCA  340



>ref|XP_008437386.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=445

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGR S+ ITIRR++GSSPF+G++VGSETSGG+ +VLAEH+N 
Sbjct  247  TGDDLVAVKSGWDEYGIAYGRSSYDITIRRISGSSPFAGVAVGSETSGGVANVLAEHLNF  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y++GVGI+IKTNIGRGG I+NITVSNVYMEN+R G+KIAGD GDHPD++F+PNALPIV  
Sbjct  307  YDMGVGINIKTNIGRGGFIKNITVSNVYMENSRKGLKIAGDTGDHPDDKFDPNALPIVKD  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++ WG KV Q G I GL+ SPFT ICLSNI+  G + PR+ PW CS V GAA+ VSP
Sbjct  367  ITIKNAWGVKVQQAGSIYGLRDSPFTGICLSNINFRGTTRPRSVPWTCSYVSGAALMVSP  426

Query  251  WPCSELATNHRYGACS  204
            WPCSEL +  + G CS
Sbjct  427  WPCSELTSTEQDGLCS  442



>gb|KEH33635.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=451

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 169/197 (86%), Gaps = 2/197 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWD YGI+YGRPS+ ITIRR+TGSSPF+GI+VGSETSGG+ +VLAEHINL
Sbjct  253  TGDDLVAVKSGWDAYGISYGRPSNDITIRRITGSSPFAGIAVGSETSGGVQNVLAEHINL  312

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTNIGRGG+I+NITVSNVY+EN+R GIKIAGDVGDHPD  FNPNALP+V G
Sbjct  313  FNMGVGIHIKTNIGRGGLIKNITVSNVYIENSRQGIKIAGDVGDHPDENFNPNALPVVKG  372

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVS  255
            I I+ VWG KV Q G I GL+ SPFT IC  +I+L+G + S R+PPWKCSDV G + QVS
Sbjct  373  ITIKSVWGVKVLQAGLIHGLRNSPFTEICFYDINLHGETGSGRSPPWKCSDVFGFSKQVS  432

Query  254  PWPCSELATNHRYGACS  204
            PWPCS+L++    G+C+
Sbjct  433  PWPCSQLSSQEP-GSCT  448



>gb|AIU50446.1| pectin lyase-like superfamily protein, partial [Platanus x acerifolia]
Length=406

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 165/190 (87%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGR S GITIRR+TGSSPF+GI++GSETSGG+ + LAE+INL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRRSSGITIRRITGSSPFAGIAIGSETSGGVENFLAENINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIH+KTN+GRGG+I+NIT+S+V+MEN R GI+IAGDVGDHPD+ FNPNALP+V G
Sbjct  281  YNTGIGIHLKTNVGRGGVIKNITISDVFMENVRKGIRIAGDVGDHPDDYFNPNALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG KV QPG I+G+K SPFT ICLSNI+L+G +     PWKCSDV GAAI V+P
Sbjct  341  VTIKNVWGVKVQQPGSIQGIKNSPFTRICLSNINLHGTT-----PWKCSDVSGAAIGVNP  395

Query  251  WPCSELATNH  222
            WPCSEL + H
Sbjct  396  WPCSELISTH  405



>gb|AIU50435.1| pectin lyase-like superfamily protein, partial [Ricinus communis]
Length=406

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 167/191 (87%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI+VGSETSGG+  VLAE+INL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSHITIRRITGSSPFAGIAVGSETSGGVEHVLAENINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y++GVG+H+KTNIGRGG IRNIT S+VYM+NAR GIKIAGDVGDHPD+ +NPNALP+V G
Sbjct  281  YDMGVGLHVKTNIGRGGFIRNITFSDVYMKNARKGIKIAGDVGDHPDDNYNPNALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  + VWG+ V QPG I+GLK SPFT ICLSNI+L+G++     PWKCSDV GAA++VSP
Sbjct  341  IIFRGVWGENVLQPGAIQGLKSSPFTGICLSNINLHGST-----PWKCSDVSGAALEVSP  395

Query  251  WPCSELATNHR  219
            +PCSELAT H+
Sbjct  396  FPCSELATTHQ  406



>gb|AIU50414.1| pectin lyase-like superfamily protein, partial [Glycine max]
Length=406

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAIGSETSGGVENVLAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+G+GIHIKTN GRGG I+NIT+S+VYME AR GI+I+GDVGDHPD++F+ NALP+V G
Sbjct  281  YNMGIGIHIKTNTGRGGFIKNITMSHVYMEEARKGIRISGDVGDHPDDKFDANALPLVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG KV Q G I+GL+ SPFT ICL +I+L+G      PPWKCSDV G A QVSP
Sbjct  341  VTIKNVWGMKVLQAGLIQGLRNSPFTDICLYDINLHGT-----PPWKCSDVSGFAHQVSP  395

Query  251  WPCSELATNHR  219
            WPCSEL++N +
Sbjct  396  WPCSELSSNQQ  406



>gb|KJB39697.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=446

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTGSSPF+GI+VGSETSGG+  VLAE+I +
Sbjct  248  TGDDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVI  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G
Sbjct  308  YNSGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG KV + G I+GLK +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP
Sbjct  368  VTLKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSP  427

Query  251  WPCSELATNHRYGACS  204
             PC++L++  + G+C+
Sbjct  428  SPCAQLSSPQQSGSCA  443



>gb|EPS61079.1| hypothetical protein M569_13719, partial [Genlisea aurea]
Length=416

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGI+Y RPS GITIRRVTGSSPF+GI+VGSETSGG+ DVLAEH+ L
Sbjct  223  TGDDLVAIKSGWDEYGISYNRPSRGITIRRVTGSSPFAGIAVGSETSGGVEDVLAEHVTL  282

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIH+KTN+GRGGI+RNITVSNVYMENAR GIKIAGDVGDHPD  ++P ALP ++ 
Sbjct  283  FNVGVGIHLKTNVGRGGIVRNITVSNVYMENARLGIKIAGDVGDHPDGGYDPKALPELTD  342

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVS  255
            I I++VWG++V QPG I GLK +PFT ICLSNIHL GA  +  + PW CSDV G+A+QVS
Sbjct  343  IVIRNVWGERVLQPGLIHGLKGAPFTGICLSNIHLIGAQGASDSKPWLCSDVSGSAVQVS  402

Query  254  PWPCSELATNHRYG  213
            PWPC++L  +   G
Sbjct  403  PWPCAQLTVSQHTG  416



>ref|XP_004143871.1| PREDICTED: probable polygalacturonase [Cucumis sativus]
 gb|KGN50025.1| hypothetical protein Csa_5G150430 [Cucumis sativus]
Length=445

 Score =   264 bits (675),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGR S+ ITIRR++GSSPF+G++VGSE SGG+ +VLAEH+N 
Sbjct  247  TGDDLVAVKSGWDEYGIAYGRCSYDITIRRISGSSPFAGVAVGSEASGGVANVLAEHLNF  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y++GVGI+IKTNIGRGG I+NITVSNVYMEN+R G+KIAGD GDHPD++F+PNALPIV  
Sbjct  307  YDMGVGINIKTNIGRGGFIKNITVSNVYMENSRKGLKIAGDAGDHPDDKFDPNALPIVKD  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+++WG  V Q G I GL+ SPFT ICLSNI+L GA+ PR+ PW CS V GAA  VSP
Sbjct  367  ITIKNIWGVNVQQAGSIYGLRDSPFTGICLSNINLRGATRPRSVPWTCSYVSGAASLVSP  426

Query  251  WPCSELATNHRYGACS  204
            WPCSEL +  + G CS
Sbjct  427  WPCSELTSTDQDGLCS  442



>gb|AIU50433.1| pectin lyase-like superfamily protein, partial [Phaseolus vulgaris]
Length=406

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYG PS  ITIRRV+GSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGLPSSNITIRRVSGSSPFAGIAIGSETSGGVENVLAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y +G+GIHIKTN GRGG I+NITVS+VYME+AR GI+I+GDVGDHPD++F+PNALPIV G
Sbjct  281  YKMGIGIHIKTNSGRGGFIKNITVSHVYMEDARKGIRISGDVGDHPDDKFDPNALPIVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + +++VWG KV Q G I+G+K SPF+ ICL +I+L G      PPWKCSDV G A QVSP
Sbjct  341  VTMKNVWGVKVLQAGLIQGVKNSPFSDICLYDINLGGT-----PPWKCSDVSGFAHQVSP  395

Query  251  WPCSELATNHR  219
            WPCSEL++NH+
Sbjct  396  WPCSELSSNHQ  406



>ref|XP_003617307.1| Glycoside hydrolase family 28 protein [Medicago truncatula]
 gb|AET00266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=450

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGR S  ITIRRV+GSSPF+GI+VGSETSGG+ ++LAEHINL
Sbjct  251  TGDDLVAVKSGWDEYGIAYGRSSSNITIRRVSGSSPFAGIAVGSETSGGVENILAEHINL  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+G+GIHIKTNIGRGG I+NI VSNVY+ENAR GIKI+GDVGDH D++++ NALPIV G
Sbjct  311  YNMGIGIHIKTNIGRGGYIKNINVSNVYIENARKGIKISGDVGDHADDKYDSNALPIVKG  370

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGA--SSPRNPPWKCSDVHGAAIQV  258
            I + +VWG KV Q G I+G+K SPFT ICLS+I+L+G   +  R P W+CSDV G A+QV
Sbjct  371  ITMANVWGVKVLQAGLIKGMKHSPFTDICLSDINLHGVNGTRSRTPSWQCSDVSGVALQV  430

Query  257  SPWPCSELATNHRYGACS  204
            SPWPCSEL + H+ G+C+
Sbjct  431  SPWPCSELIS-HQLGSCA  447



>ref|XP_004298894.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
 ref|XP_011463978.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWD+YGIAYGRPS  ITIRR+ GSSPF+GI+VGSETSGG+ +V  EHINL
Sbjct  245  TGDDLVAVKSGWDQYGIAYGRPSSDITIRRIRGSSPFAGIAVGSETSGGVENVFVEHINL  304

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTNIGRGG IRNITVSNVYME AR GIKIAGDVGDHPDN +NPNALP+V G
Sbjct  305  HNVGVGIHIKTNIGRGGFIRNITVSNVYMEKARKGIKIAGDVGDHPDNNYNPNALPVVKG  364

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGA-SSPRNPPWKCSDVHGAAIQVS  255
            I + D+WG +V Q G I+GLK SPFT ICLSNI+L+G   + R PPWKCSD+ GAA  VS
Sbjct  365  ITLTDIWGIQVLQAGLIQGLKNSPFTGICLSNINLHGMPGTSRTPPWKCSDISGAAHLVS  424

Query  254  PWPCSELATNHRYGACS  204
            P  CSEL +     +CS
Sbjct  425  PIQCSELTSAQHASSCS  441



>ref|XP_007146299.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
 gb|ESW18293.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
Length=456

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR+TGSSPF+GI+VGSETSGG+ +VLAE+INL
Sbjct  261  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRLTGSSPFAGIAVGSETSGGVENVLAENINL  320

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIHIKTN GRGG I+NITV++VY+ENAR GIKIAGDVG HPD ++NP+ALP+V G
Sbjct  321  FNMGVGIHIKTNKGRGGFIKNITVAHVYVENARQGIKIAGDVGGHPDEKYNPDALPVVKG  380

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV++ G I GLK SPFT +CLS I+ +G +  R P WKCSDV G A QVSP
Sbjct  381  ITIRNVWGVKVNRAGLINGLKNSPFTDVCLSVINFHGMAGSRAPNWKCSDVSGFAYQVSP  440

Query  251  WPCSELATNHRYGACS  204
            WPCS+L +    G+C+
Sbjct  441  WPCSQLHSQEP-GSCA  455



>gb|AIU50443.1| pectin lyase-like superfamily protein, partial [Lactuca sativa]
Length=406

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS+ ITIRR+TGSSPF+GI+VGSETSGG+ +VLAEHI L
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSNDITIRRLTGSSPFAGIAVGSETSGGVTNVLAEHITL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIH+KTNIGRGGIIRNITVSNV+M+  R GIKIAGDVGDHPD  +NPNALP++  
Sbjct  281  YNTGIGIHLKTNIGRGGIIRNITVSNVFMDKVRKGIKIAGDVGDHPDENYNPNALPVMKH  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I+I++VWG+ V QPG I+GLK SPFT ICLSNI+L G     N PWKC+DV G A+QVSP
Sbjct  341  IRIKNVWGENVQQPGLIQGLKNSPFTDICLSNINLFG-----NVPWKCADVSGGAVQVSP  395

Query  251  WPCSELATNHR  219
             PCSEL ++ +
Sbjct  396  SPCSELISSRQ  406



>gb|AIU50407.1| pectin lyase-like superfamily protein, partial [Sarcandra glabra]
Length=406

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 162/190 (85%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +VLAEHIN+
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSYITIRRLTGSSPFAGIAIGSETSGGIENVLAEHINI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N GVGIH+KTN+GRGG+IRNIT ++VYMEN R GIKIAGDVGDHPD++FNPNALP V G
Sbjct  281  FNSGVGIHLKTNVGRGGVIRNITFTDVYMENVRKGIKIAGDVGDHPDDKFNPNALPTVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  + QPG ++GLK SPFT ICLSN++L G +     PWKCSDV G+A+ V P
Sbjct  341  VTIRNVWGVNIQQPGSMQGLKNSPFTRICLSNVNLRGGT-----PWKCSDVSGSALGVHP  395

Query  251  WPCSELATNH  222
            WPCSEL + H
Sbjct  396  WPCSELISTH  405



>gb|AIU50418.1| pectin lyase-like superfamily protein, partial [Chloranthus japonicus]
Length=406

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 162/190 (85%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +VLAEH+N+
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSHITIRRLTGSSPFAGIAIGSETSGGIENVLAEHVNI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G+GIH+KTN GRGG+I+NITV++VYMEN R GI+IAGDVGDHPD++FNPNALPIV G
Sbjct  281  FNCGIGIHVKTNAGRGGVIQNITVTDVYMENVRKGIRIAGDVGDHPDDKFNPNALPIVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I +VWG  V QPG ++G+K SPFT ICLSN++L G +     PWKCSDV G+A+ V P
Sbjct  341  VTIGNVWGVNVQQPGSMQGIKNSPFTRICLSNVNLRGGT-----PWKCSDVSGSALGVHP  395

Query  251  WPCSELATNH  222
            WPC+EL + H
Sbjct  396  WPCAELISTH  405



>gb|AIU50431.1| pectin lyase-like superfamily protein, partial [Prunus persica]
Length=406

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 5/187 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRRV GSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRVRGSSPFAGIAIGSETSGGVENVLAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+GVGIHIKTNIGRGG IRNITVS+VYME  R GIKIAGDVGDHPD+++N NALP+V G
Sbjct  281  YNMGVGIHIKTNIGRGGFIRNITVSDVYMEEVRRGIKIAGDVGDHPDDKYNQNALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++D+WG +V Q G I GLK SPFT ICLSNI+L+G+     PPWKCSD+ GAA  VSP
Sbjct  341  ITLKDIWGVQVQQAGVILGLKNSPFTGICLSNINLHGS-----PPWKCSDISGAAHLVSP  395

Query  251  WPCSELA  231
              CSEL+
Sbjct  396  LQCSELS  402



>gb|AIU50397.1| pectin lyase-like superfamily protein, partial [Aquilegia coerulea]
Length=406

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 161/188 (86%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGI YGR S+GITIRRVTGSSPF+GI++GSETSGG+ +VLAEHINL
Sbjct  221  TGDDLVAVKSGWDEYGIKYGRKSYGITIRRVTGSSPFAGIAIGSETSGGVENVLAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+G+GIH+KTNIGRGG I+NIT+S+VYMENAR GIKIAGDVGDHPD  ++PNALP+V G
Sbjct  281  FNMGLGIHVKTNIGRGGYIKNITISDVYMENARKGIKIAGDVGDHPDENYDPNALPVVHG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG+KV QPG I+GLK SPFT IC SNIHL+G      P WKCSDV G A  VSP
Sbjct  341  VTMRNIWGEKVLQPGSIQGLKNSPFTGICFSNIHLHGT-----PLWKCSDVSGTASAVSP  395

Query  251  WPCSELAT  228
             PC++L +
Sbjct  396  SPCAQLTS  403



>gb|AIU50405.1| pectin lyase-like superfamily protein, partial [Theobroma cacao]
Length=406

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 160/188 (85%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTG+SPFSGI+VGSETSGG+ +VLAE+I L
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSCITIRRVTGTSPFSGIAVGSETSGGVENVLAENIVL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G+++KTNIGRGG I+NITVS V+MEN RTGIKIAGD GDHPDN FNPNALP V G
Sbjct  281  YNTGIGVNVKTNIGRGGFIKNITVSEVFMENVRTGIKIAGDTGDHPDNNFNPNALPYVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            +  +++WG KV + G I+GLK +PFT ICLS ++L+G+     PPWKCSDV GAAI+VSP
Sbjct  341  VTFKNIWGVKVQRAGSIQGLKNAPFTGICLSKVNLHGS-----PPWKCSDVSGAAIEVSP  395

Query  251  WPCSELAT  228
            WPC+EL +
Sbjct  396  WPCAELTS  403



>gb|AIU50424.1| pectin lyase-like superfamily protein, partial [Medicago truncatula]
Length=406

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGR S  ITIRRV+GSSPF+GI+VGSETSGG+ ++LAEHINL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRSSSNITIRRVSGSSPFAGIAVGSETSGGVENILAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+G+GIHIKTNIGRGG I+NI VSNVY+ENAR GIKI+GDVGDH D++++ NALPIV G
Sbjct  281  YNMGIGIHIKTNIGRGGYIKNINVSNVYIENARKGIKISGDVGDHADDKYDSNALPIVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I + +VWG KV Q G I+G+K SPFT ICLS+I+L+G      P W+CSDV G A+QVSP
Sbjct  341  ITMANVWGVKVLQAGLIKGMKHSPFTDICLSDINLHGT-----PSWQCSDVSGVALQVSP  395

Query  251  WPCSELATNH  222
            WPCSEL ++ 
Sbjct  396  WPCSELISHQ  405



>ref|XP_010676306.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=441

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 168/195 (86%), Gaps = 3/195 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD+V++KSGWDEYG+A+GRPS  ITIRR+TGSSPFSGI++GSE SGG+ +VLAEHINL
Sbjct  246  TGDDMVAIKSGWDEYGLAFGRPSSDITIRRITGSSPFSGIAIGSEMSGGVENVLAEHINL  305

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIH+KT +GRGG IRNITV+N+Y++NA+ G+KI+GDVGDH D++F+P A+P+V  
Sbjct  306  FNMGVGIHLKTKVGRGGYIRNITVANIYIKNAKKGVKISGDVGDHADDKFDPKAIPVVQD  365

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I+++ +WG+ + QPG ++G+K +PFT+ICLS+I+L G+   R  PW+CSDV G++++VSP
Sbjct  366  IRMKSIWGENIQQPGLVKGIKNAPFTNICLSDINLYGSFKLRTRPWECSDVEGSSLEVSP  425

Query  251  WPCSELATNHRYGAC  207
            WPCSEL ++   G+C
Sbjct  426  WPCSELLSS---GSC  437



>ref|XP_010053124.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010053125.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77376.1| hypothetical protein EUGRSUZ_D01730 [Eucalyptus grandis]
Length=449

 Score =   256 bits (655),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDLVSVKSGWDEYGI YGR S GITIRR+TGSSPF+GISVGSETSGG+ +V  E+INLY
Sbjct  250  GDDLVSVKSGWDEYGIRYGRRSSGITIRRITGSSPFAGISVGSETSGGVENVWIENINLY  309

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
            N+G+GIHIKTNIGRGG IR+ITVSNV+MEN R GI+I G+VGDHPD  +NP+ALP V GI
Sbjct  310  NVGIGIHIKTNIGRGGFIRDITVSNVFMENVRKGIRIMGNVGDHPDEYYNPSALPYVKGI  369

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
            +I+DVWG KV + G I+GLK +PFT ICLSNI+L+G    R   W CSDV GAA++VSP 
Sbjct  370  RIKDVWGVKVQEAGLIQGLKNAPFTGICLSNIYLHGVPGQRRATWTCSDVSGAALEVSPG  429

Query  248  PCSELATNHRYGACS  204
             CSELA+ +    CS
Sbjct  430  VCSELASTYHSSICS  444



>ref|XP_004491304.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=452

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDLV+VKSGWDEYGIAYG+PS  ITIRRV GSSPF+GI+VGSE SGG+ +VLAEHINL 
Sbjct  252  GDDLVAVKSGWDEYGIAYGQPSSNITIRRVNGSSPFAGIAVGSEASGGVENVLAEHINLQ  311

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
            N+G+GIHIKTNIGRGG I+NI VSNVYMEN R GIKIAGDVGDHPD++++ NA+PIV GI
Sbjct  312  NMGIGIHIKTNIGRGGYIKNINVSNVYMENTRKGIKIAGDVGDHPDDKYDKNAVPIVKGI  371

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             I++VWG KV Q G I G++ SPF+ ICLSNI+L+G    R P WKCS V G A QVSP 
Sbjct  372  VIENVWGVKVLQAGLITGIRNSPFSDICLSNINLHGVVGTRAPTWKCSSVIGVAYQVSPL  431

Query  248  PCSELATNHRYGACSAT  198
            PCSEL + H+ G+C  T
Sbjct  432  PCSELVS-HQSGSCGIT  447



>gb|EYU40022.1| hypothetical protein MIMGU_mgv1a006305mg [Erythranthe guttata]
Length=449

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWD+YGI+Y RPS GITIRR+TGSSPF+GI+VGSETSGG+ DV+AEHINL
Sbjct  251  TGDDLVAVKSGWDQYGISYNRPSQGITIRRLTGSSPFAGIAVGSETSGGVADVIAEHINL  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+G+GIH+KTNIGRGG+IRNI++SNVYM  AR GIKI+GDVGDHPD  ++ NALP++  
Sbjct  311  SNMGIGIHLKTNIGRGGVIRNISISNVYMYKARKGIKISGDVGDHPDENYDRNALPVLKD  370

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DV G  V QPG I GLKK+PF+ ICLSN+ L G    R+  W+CSDV G A++VSP
Sbjct  371  VVIKDVSGDFVQQPGLIHGLKKAPFSGICLSNVSLGGVVGVRDSGWQCSDVSGGAVRVSP  430

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL ++ + G+C +TL
Sbjct  431  LPCAELTSSQQIGSCFSTL  449



>gb|KHG21610.1| putative polygalacturonase [Gossypium arboreum]
Length=448

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  IT+RRVTGS+PF+G++VGSETSGG+ +VLAE+INL
Sbjct  250  TGDDLVAVKSGWDEYGIAYGRPSSYITVRRVTGSTPFAGVAVGSETSGGVENVLAENINL  309

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN GVG+HIKTNIGRGG+I+NITVS ++MEN RTGIK+AGD GDHPDN FNPNALP V  
Sbjct  310  YNSGVGVHIKTNIGRGGVIKNITVSELFMENVRTGIKVAGDTGDHPDNNFNPNALPYVKD  369

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG  V + G++ G++ + FT ICLSN+ L G + PR P W C+ + GAAI+VSP
Sbjct  370  LTLKNIWGVNVQRAGWMHGIENATFTGICLSNVTLQGTTGPRPPSWNCNAIRGAAIEVSP  429

Query  251  WPCSELATNHRYGACSA  201
             PC+ELA+  + G+C++
Sbjct  430  RPCAELASVEQSGSCAS  446



>ref|XP_010055855.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW72401.1| hypothetical protein EUGRSUZ_E00853 [Eucalyptus grandis]
Length=451

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDD+VSVKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSE SGGI +VL E++NLY
Sbjct  254  GDDVVSVKSGWDEYGIAYGRPSSNITIRRLTGSSPFAGIAIGSEMSGGIENVLVENVNLY  313

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
             +G+GIH+KTN GRG  IRNITVS+VY+E+AR GIKI+GDVGDHPD+ ++PNALP+V+GI
Sbjct  314  KVGIGIHVKTNSGRGAFIRNITVSDVYVEDARKGIKISGDVGDHPDDGYDPNALPVVTGI  373

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             ++D+ G  V Q G IRG+K SPFT +CLSN++L+G   PR  PW CSDV GAA +VSP 
Sbjct  374  LVKDMRGTNVQQAGLIRGIKNSPFTGLCLSNVNLHGKPGPREDPWSCSDVSGAAFKVSPS  433

Query  248  PCSELATNHRYGACS  204
            PCSEL +     +C+
Sbjct  434  PCSELTSVSDRDSCA  448



>gb|KJB24230.1| hypothetical protein B456_004G134000 [Gossypium raimondii]
Length=448

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  IT+RRVTGS+PF+G++VGSETSGG+ +VLAE+INL
Sbjct  250  TGDDLVAVKSGWDEYGIAYGRPSSYITVRRVTGSTPFAGVAVGSETSGGVENVLAENINL  309

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN GVG+HIKTNIGRGG+I+NITVS ++MEN RTGIK+AGD GDHPDN FNPNALP V  
Sbjct  310  YNSGVGVHIKTNIGRGGVIKNITVSELFMENVRTGIKVAGDTGDHPDNNFNPNALPYVKD  369

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG  V + G++ G++ + FT ICLSN+ L G + PR P W C+ + GAAI+VSP
Sbjct  370  LMLKNIWGVNVQRAGWMHGIENATFTGICLSNVTLQGTTGPRPPSWNCNAIRGAAIEVSP  429

Query  251  WPCSELATNHRYGACSA  201
             PC+EL +  + G+C++
Sbjct  430  RPCAELTSVEQSGSCAS  446



>ref|XP_006413510.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
 gb|ESQ54963.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
Length=449

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  252  TGDDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVG++IKTNIGRGG I+NI +SNVY+ENAR GIK+AGD GDHPD  +NPNALPIV G
Sbjct  312  FNMGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKLAGDTGDHPDAYYNPNALPIVKG  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+++WG  V   G IRGLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  372  IHIKNIWGVNVQNAGSIRGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSP  430

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  431  WPCSELRTTGGSYSCSSTF  449



>gb|AIU50409.1| pectin lyase-like superfamily protein, partial [Gossypium raimondii]
Length=406

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 161/188 (86%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTGSSPF+GI+VGSETSGG+  VLAE+I +
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G
Sbjct  281  YNSGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG KV + G I+GLK +PFT+ICLS I+L+G+     PPWKCSDV GAAI+VSP
Sbjct  341  VTLKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGS-----PPWKCSDVSGAAIEVSP  395

Query  251  WPCSELAT  228
             PC++L++
Sbjct  396  SPCAQLSS  403



>ref|XP_009413832.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413833.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=445

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 155/199 (78%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR+TGSSPFSG+++GSETSGG+ +VL E++NL
Sbjct  248  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRLTGSSPFSGVAIGSETSGGVENVLVENVNL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+ G+GIHIKTN+GRGG +RNITV NV M   R GI+IAGDVGDHPD  F+  A+P V G
Sbjct  308  YDTGIGIHIKTNVGRGGFVRNITVVNVSMNKVRKGIRIAGDVGDHPDEYFDRRAIPTVDG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V QPG I+G+K SPFT ICLSN+ L G +  R+ PWKC DV GAA+ V P
Sbjct  368  ITIKNVWGVDVQQPGSIQGIKNSPFTRICLSNVKLWGVAK-RSAPWKCVDVSGAALGVQP  426

Query  251  WPCSELATNHRYGACSATL  195
            WPCS LA     G CS   
Sbjct  427  WPCSALARTISSGYCSTAF  445



>gb|AIU50420.1| pectin lyase-like superfamily protein, partial [Chimonanthus 
praecox]
Length=406

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 162/190 (85%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGI+YGRPS+ ITIRR+ GSSPF+G+++GSE SGG+ +V AE+I L
Sbjct  221  TGDDLVAVKSGWDEYGISYGRPSYDITIRRLRGSSPFAGVAIGSEASGGVHNVFAENITL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+ GVGIH+KTNIGRGGIIRNITV++V+M+N R GIK+AGDVGDHPD++FNPNALP V G
Sbjct  281  YDTGVGIHVKTNIGRGGIIRNITVTDVHMDNVRKGIKVAGDVGDHPDDKFNPNALPTVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++++WG KV Q G I+GLK SPFT ICLS+I+L G+S     PWKCSD+ GAA++V+P
Sbjct  341  ITVKNMWGVKVQQAGSIQGLKDSPFTRICLSSINLGGSS-----PWKCSDITGAALEVNP  395

Query  251  WPCSELATNH  222
             PC+EL T H
Sbjct  396  SPCAELTTTH  405



>emb|CDY47619.1| BnaA01g13460D [Brassica napus]
Length=444

 Score =   248 bits (634),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  ITIRR+TGS+PF+GI++GSETSGGI +++AEHI+L
Sbjct  247  TGDDLVAIKSGWDEYGIAFGRPSSNITIRRITGSTPFAGIAIGSETSGGIKNIVAEHISL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY+ENAR GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKIAGDTGDHPDTYYNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I +VWG  V   G I+GLK SPFT ICLS I+++G+ +  N  WKCSDV G +++VSP
Sbjct  367  IHINNVWGVNVRNAGSIQGLKDSPFTGICLSEINIHGSLNT-NRTWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+TL
Sbjct  426  WPCSELRTTGGSYSCSSTL  444



>gb|AIU50434.1| pectin lyase-like superfamily protein, partial [Artemisia annua]
Length=277

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 161/189 (85%), Gaps = 5/189 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL++VKSGWD+YGIAYGRPS+ ITIRR+TGSSPF+GI+VGSETSGG+ +VLAEHI L
Sbjct  92   TGDDLIAVKSGWDQYGIAYGRPSNDITIRRITGSSPFAGIAVGSETSGGVTNVLAEHITL  151

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             + G+GIH+KTNIGRGGIIRNIT+S+V+M+  R GIKIAGDVGDHPD+ ++PNALP++  
Sbjct  152  SHTGIGIHLKTNIGRGGIIRNITISDVFMDTVRKGIKIAGDVGDHPDDNYDPNALPVLKH  211

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I++VWG+KV + G I+GLK SPFT ICLSN+HL G     + PW C+DV G ++QVSP
Sbjct  212  VRIKNVWGEKVLEAGLIKGLKNSPFTDICLSNVHLTG-----HGPWTCADVSGGSVQVSP  266

Query  251  WPCSELATN  225
             PCSEL ++
Sbjct  267  SPCSELISS  275



>ref|XP_009380525.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=446

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 150/199 (75%), Gaps = 0/199 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRR+ GSSPFSGI++GSETSGG+ +VL E+INL
Sbjct  248  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRLQGSSPFSGIAIGSETSGGVENVLVENINL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G GIHIKTN GRGG IRN+TV NV M   R GI+IAGDVGDHPD  FN  A+P V G
Sbjct  308  YNTGFGIHIKTNAGRGGYIRNVTVVNVSMNKVRKGIRIAGDVGDHPDEYFNRYAMPTVDG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  + QPG I G++ SPFT ICLSN+ L GA      PWKC DV GAA+ V P
Sbjct  368  VTIKNVWGVDIQQPGSIEGIRSSPFTRICLSNVKLWGALMHYEQPWKCMDVSGAALGVQP  427

Query  251  WPCSELATNHRYGACSATL  195
            WPCS+L      G CS+  
Sbjct  428  WPCSQLTGTFSAGFCSSAF  446



>gb|AIU50441.1| pectin lyase-like superfamily protein, partial [Schrenkiella 
parvula]
Length=406

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 157/188 (84%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVG++IKTNIGRGG I+NI +SNVY+ENAR GIK+AGD GDHPD  +NPNALPIV G
Sbjct  281  FNMGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKLAGDTGDHPDAYYNPNALPIVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+++WG  V   G IRGLK SPFT ICLS I+L+G  +     WKCSDV G +++VSP
Sbjct  341  IHIKNIWGVNVQNAGSIRGLKGSPFTGICLSEINLHGYRT-----WKCSDVIGTSLKVSP  395

Query  251  WPCSELAT  228
            WPCSEL T
Sbjct  396  WPCSELRT  403



>ref|XP_010541559.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=446

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIA+GRPS  ITIRR+TGSSPF+GI++GSETSGGI ++LA+HI L
Sbjct  249  TGDDLVAVKSGWDEYGIAFGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNILAQHITL  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +S+VY+ENAR GIKIAGD GDHPD  +NPNALPIV G
Sbjct  309  SNMGVGVNIKTNIGRGGFIQNIRISDVYVENARYGIKIAGDTGDHPDGNYNPNALPIVKG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            IKI +VWG  V   G IRGLK SPFT ICLS I+L+G  +   P WKCSDV G +++VSP
Sbjct  369  IKINNVWGVNVLNAGSIRGLKGSPFTGICLSEINLHGRWNSY-PTWKCSDVIGTSLKVSP  427

Query  251  WPCSELATNHRYGAC  207
            WPCSEL +  +  +C
Sbjct  428  WPCSELRSTGKASSC  442



>ref|XP_010541551.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=463

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIA+GRPS  ITIRR+TGSSPF+GI++GSETSGGI ++LA+HI L
Sbjct  266  TGDDLVAVKSGWDEYGIAFGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNILAQHITL  325

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +S+VY+ENAR GIKIAGD GDHPD  +NPNALPIV G
Sbjct  326  SNMGVGVNIKTNIGRGGFIQNIRISDVYVENARYGIKIAGDTGDHPDGNYNPNALPIVKG  385

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            IKI +VWG  V   G IRGLK SPFT ICLS I+L+G  +   P WKCSDV G +++VSP
Sbjct  386  IKINNVWGVNVLNAGSIRGLKGSPFTGICLSEINLHGRWNSY-PTWKCSDVIGTSLKVSP  444

Query  251  WPCSELATNHRYGAC  207
            WPCSEL +  +  +C
Sbjct  445  WPCSELRSTGKASSC  459



>gb|AIU50402.1| pectin lyase-like superfamily protein, partial [Magnolia denudata]
Length=392

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 157/190 (83%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR++GS+PF+GI++GSETSGG+ +VLAE+++L
Sbjct  207  TGDDLVAVKSGWDEYGIAYGRPSSGITIRRLSGSTPFAGIAIGSETSGGVENVLAENVSL  266

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N GVGIH+KTNIGRGG IRNITV +V M+N R GIKIAGDVGDHPDN FNPNALPIV G
Sbjct  267  FNTGVGIHVKTNIGRGGFIRNITVQDVRMDNVRKGIKIAGDVGDHPDNNFNPNALPIVDG  326

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG  + QPG ++GLK SPFT ICLSN++  G +      WKC+D+ GAA+ V P
Sbjct  327  VMLRNLWGVNIQQPGVMQGLKNSPFTQICLSNVNFGGGAV-----WKCADISGAALGVEP  381

Query  251  WPCSELATNH  222
             PC EL + H
Sbjct  382  SPCPELTSTH  391



>gb|KJB39694.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=427

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 156/183 (85%), Gaps = 3/183 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS  ITIRRVTGSSPF+GI+VGSETSGG+  VLAE+I +
Sbjct  248  TGDDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVI  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G
Sbjct  308  YNSGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG KV + G I+GLK +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+   
Sbjct  368  VTLKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIER--  425

Query  251  WPC  243
             PC
Sbjct  426  -PC  427



>gb|AIU50448.1| pectin lyase-like superfamily protein, partial [Houttuynia cordata]
Length=406

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 154/190 (81%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIA+GRPS GITIRR+TGS+PF+GI++GSE SGG+ +V AEHIN+
Sbjct  221  TGDDLVAVKSGWDEYGIAFGRPSFGITIRRITGSTPFAGIAIGSEASGGVENVYAEHINI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N G+GIHIKTN GRGG I+NITVS+VYM+  R GIKI+G+VGDHPDN +NPNALPIV G
Sbjct  281  LNSGIGIHIKTNTGRGGTIKNITVSDVYMDKVRKGIKISGNVGDHPDNGYNPNALPIVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DVWG  V Q G ++G+K SPFT ICLSN+ L G        W+C D+ GAA+QV P
Sbjct  341  ITIKDVWGMNVEQAGSMQGIKNSPFTRICLSNVKLFGGMM-----WQCGDISGAALQVKP  395

Query  251  WPCSELATNH  222
             PCSEL ++H
Sbjct  396  SPCSELISSH  405



>ref|XP_009137402.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=444

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  ITIRR+TGS+PF+GI++GSETSGGI +++AEHI+L
Sbjct  247  TGDDLVAIKSGWDEYGIAFGRPSSNITIRRITGSTPFAGIAIGSETSGGIKNIVAEHISL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY+ENAR GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKIAGDTGDHPDAYYNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I +VWG  V   G I+GLK SPFT ICLS I+++G S   N  WKCSDV G +++VSP
Sbjct  367  IHINNVWGVNVRNAGSIQGLKDSPFTGICLSEINIHG-SLNTNRTWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  426  WPCSELRTTGGSYSCSSTF  444



>emb|CDY03516.1| BnaC01g15660D [Brassica napus]
Length=444

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  ITIRR+TGS+PF+GI++GSETSGGI +++AEHI+L
Sbjct  247  TGDDLVAIKSGWDEYGIAFGRPSSNITIRRITGSTPFAGIAIGSETSGGIKNIVAEHISL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY+ENAR GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIKISNVYVENARYGIKIAGDTGDHPDAYYNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I+I +VWG  V   G I+GLK SPFT ICLS I+++G+ +     WKCSDV G +++VSP
Sbjct  367  IRINNVWGVNVRNAGSIQGLKDSPFTGICLSEINIHGSLNTYR-TWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  426  WPCSELRTTGGSYSCSSTF  444



>ref|XP_009404468.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404469.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 159/196 (81%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GIT+RR+TGSSPFSGI++GSETSGG+ +VL E+INL
Sbjct  248  TGDDLVAVKSGWDEYGIAYGRPSSGITVRRLTGSSPFSGIAIGSETSGGVENVLVENINL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y++G+GIHIKTN+GRGG IRNIT+S+V M N R  I+IAGDVGDHPD  F+PNA+P V G
Sbjct  308  YDVGIGIHIKTNVGRGGYIRNITISDVNMNNVRKAIRIAGDVGDHPDENFDPNAVPTVDG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG++V QPG I G+K SPFT +CLSN+ L G  +    PWKC+DV GAA+ V+P
Sbjct  368  VTIKNVWGEEVEQPGSIEGIKNSPFTRVCLSNVKLWGVGA---SPWKCTDVTGAALGVNP  424

Query  251  WPCSELATNHRYGACS  204
             PC +L ++     CS
Sbjct  425  GPCPQLTSSFAMSYCS  440



>gb|ACC91250.1| glycoside hydrolase family 28 protein [Arabidopsis halleri]
Length=444

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  247  TGDDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKI GD GDHPD  +NPNALPIV G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIKISDVYIDTAKYGIKITGDTGDHPDENYNPNALPIVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  367  IHIKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGSLNSYK-TWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T   Y  CS+T 
Sbjct  426  WPCSELRTTGGYNLCSSTF  444



>ref|XP_010925748.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
 ref|XP_010925749.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=441

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 153/196 (78%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRR+TGSSPFSGI++GSE SGG+ +VL E+I+L
Sbjct  245  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRLTGSSPFSGIAIGSEASGGVENVLVENISL  304

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G+GIHIKTN+GRGG IRNIT S+V M   R G++IAGDVGDHPD +FNP A+P V  
Sbjct  305  FNTGIGIHIKTNVGRGGYIRNITFSDVNMNKVRKGVRIAGDVGDHPDEKFNPYAIPTVDD  364

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  V QPG I G+K SPFT ICL N+ L G   P+N PWKC+ V GAA+ V P
Sbjct  365  VTIKNVWGTNVQQPGSIEGIKTSPFTRICLFNVKLWGG--PQNTPWKCAAVSGAALGVQP  422

Query  251  WPCSELATNHRYGACS  204
            WPC+EL      G CS
Sbjct  423  WPCTELTRTSESGFCS  438



>ref|XP_010913844.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=349

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYG+AY RPS GITIRR+TGSSPF+GI+VGSETSGG+ +VL E I++
Sbjct  152  TGDDLVAVKSGWDEYGMAYARPSSGITIRRLTGSSPFAGIAVGSETSGGVENVLVESIHI  211

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTN GRGG IRNITVS V + N R  ++IAGDVGDHPD+ +NPNALPIV+G
Sbjct  212  YNTGIGIHIKTNSGRGGYIRNITVSGVNLSNVRKALRIAGDVGDHPDDMYNPNALPIVNG  271

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG  + QPG I G+K SPFT +CLSN+ LNG  + R  PWKC+DV G A+ V P
Sbjct  272  LTIKDVWGVDIQQPGSIDGIKNSPFTGVCLSNVKLNGDGT-REVPWKCADVSGGALGVQP  330

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+  +
Sbjct  331  SPCTELTSISGLSFCTNAI  349



>gb|AIU50404.1| pectin lyase-like superfamily protein, partial [Pinellia ternata]
Length=406

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYG+A+ RPS+GITIRR+TGSSPF+GI+VGSETSGGI +VL E+INL
Sbjct  221  TGDDLVAVKSGWDEYGMAFRRPSYGITIRRITGSSPFAGIAVGSETSGGIENVLVENINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+G+GIHIKTN+GRGG I+NIT+S+V M   R G++IAG+VGDHPD+ +NPNA+P V G
Sbjct  281  SNMGIGIHIKTNVGRGGYIKNITISDVNMNTTRKGLRIAGNVGDHPDDNYNPNAVPFVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V QPG I+G+K SPFT +CLSN+ L G       PWKC+DV GAA++V P
Sbjct  341  ITIKNVWGVNVLQPGTIQGIKGSPFTRVCLSNVKLWGEV-----PWKCTDVSGAALEVQP  395

Query  251  WPCSELAT  228
            WPCSEL T
Sbjct  396  WPCSELTT  403



>ref|XP_008790157.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008790230.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=442

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYG PS GITIRR+TGSSPFSGI++GSE SGG+ +VL E+I+L
Sbjct  246  TGDDLVAIKSGWDEYGIAYGHPSSGITIRRLTGSSPFSGIAIGSEASGGVENVLVENISL  305

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G+GIHIKTN+GRGG IRNIT ++V M N R G++IAGDVGDHPD++FNP A+P+V  
Sbjct  306  FNTGIGIHIKTNVGRGGYIRNITFADVNMNNVRKGVRIAGDVGDHPDDKFNPYAIPVVDK  365

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  V QPG I G+K SPFT ICL N+ L G   P+N PW+C+ V GAA+ V P
Sbjct  366  VTIKNVWGINVQQPGSIEGIKTSPFTRICLFNVKLWG--RPQNTPWECTAVSGAALGVQP  423

Query  251  WPCSELATNHRYGACS  204
            WPC+EL  N   G CS
Sbjct  424  WPCAELTGNSESGFCS  439



>ref|NP_199002.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 dbj|BAB10662.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAT85725.1| At5g41870 [Arabidopsis thaliana]
 gb|AED94738.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=449

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 159/196 (81%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  ITIRR+TGSSPF+GI++GSETSGGI +V  E+I L
Sbjct  252  TGDDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITL  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTNIGRGG I+ IT+S VY+E  RTGIKI+GD GDHPD++FN +ALPIV G
Sbjct  312  YNSGIGIHIKTNIGRGGSIQGITISGVYLEKVRTGIKISGDTGDHPDDKFNTSALPIVRG  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G ++GLK SPFT++C SN+ L G  + R+P WKCSDV GAA +V+P
Sbjct  372  ITIKNVWGIKVERAGMVQGLKDSPFTNLCFSNVTLTG--TKRSPIWKCSDVVGAADKVNP  429

Query  251  WPCSEL-ATNHRYGAC  207
             PC EL AT  + G+C
Sbjct  430  TPCPELSATTQQGGSC  445



>gb|AIU50413.1| pectin lyase-like superfamily protein, partial [Eucalyptus grandis]
Length=406

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 155/187 (83%), Gaps = 5/187 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDD+VSVKSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSE SGGI +VL E++NLY
Sbjct  222  GDDVVSVKSGWDEYGIAYGRPSSNITIRRLTGSSPFAGIAIGSEMSGGIENVLVENVNLY  281

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
             +G+GIH+KTN GRG  IRNITVS+VY+E+AR GIKI+GDVGDHPD+ ++PNALP+V+GI
Sbjct  282  KVGIGIHVKTNSGRGAFIRNITVSDVYVEDARKGIKISGDVGDHPDDGYDPNALPVVTGI  341

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             ++D+ G  V Q G IRG+K SPFT +CLSN++L+G       PW CSDV GAA +VSP 
Sbjct  342  LVKDMRGTNVQQAGLIRGIKNSPFTGLCLSNVNLHGED-----PWSCSDVSGAAFKVSPS  396

Query  248  PCSELAT  228
            PCSEL +
Sbjct  397  PCSELTS  403



>emb|CDY10970.1| BnaA03g46290D [Brassica napus]
Length=451

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  ITIRR+TGSSP++GI++GSETSGGI +++AEHI+L
Sbjct  254  TGDDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISL  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NPNALPIV G
Sbjct  314  SNMGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAFYNPNALPIVKG  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I +VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  374  IHINNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSY-LTWKCSDVIGTSLKVSP  432

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  433  WPCSELRTTSGSYSCSSTF  451



>emb|CDX94222.1| BnaC07g38560D [Brassica napus]
Length=451

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  ITIRR+TGSSP++GI++GSETSGGI +++AEHI+L
Sbjct  254  TGDDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISL  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NPNALPIV G
Sbjct  314  SNMGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAFYNPNALPIVKG  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I +VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  374  IHINNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSP  432

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  433  WPCSELRTTGGSYSCSSTF  451



>ref|XP_009137393.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=451

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  ITIRR+TGSSP++GI++GSETSGGI +++AEHI+L
Sbjct  254  TGDDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISL  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+G+G++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NPNALPIV G
Sbjct  314  SNMGLGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAFYNPNALPIVKG  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I +VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  374  IHINNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSP  432

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  433  WPCSELRTTSGSYSCSSTF  451



>ref|XP_010441363.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010441364.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   244 bits (622),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY R S  ITIRR+TGSS F+GI++GSETSGGI ++  E+I L
Sbjct  251  TGDDLVAVKSGWDEYGIAYNRSSRDITIRRITGSSRFAGIAIGSETSGGIQNITVENITL  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTN GRGG IR IT+S VYMEN RTGIKI+GD GDHPD++FN  ALP+VSG
Sbjct  311  YNSGIGIHIKTNTGRGGSIRGITISGVYMENVRTGIKISGDTGDHPDDKFNLTALPVVSG  370

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G I+GL+ SPFT++C SN+ L G  SP  P WKCSDV GAA +V+P
Sbjct  371  ITIKNVWGIKVERAGMIQGLEDSPFTNLCFSNVTLTGTKSP--PTWKCSDVVGAAHKVNP  428

Query  251  WPCSEL-ATNHRYGAC  207
             PC EL AT  + G+C
Sbjct  429  TPCPELTATTQQGGSC  444



>gb|AIU50423.1| pectin lyase-like superfamily protein, partial [Aristolochia 
tagala]
Length=406

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 158/190 (83%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS GITIRR+TG++PF+GI+VGSETSGG+++V+AEH+NL
Sbjct  221  TGDDLVAVKSGWDEYGIAYGRPSDGITIRRLTGTTPFAGIAVGSETSGGVMNVVAEHVNL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N GVGIH+KTNIGRGG+I+NIT S++YM+  R GIKIAGDVGDHPDN +NPNALP V G
Sbjct  281  FNSGVGIHLKTNIGRGGVIKNITCSDIYMDRVRKGIKIAGDVGDHPDNGYNPNALPRVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + ++++WG  V Q G ++GLK SPFT ICLSN++L+GA S     WKC D+ GAA  V P
Sbjct  341  VTLKNIWGVNVLQAGSLQGLKGSPFTRICLSNVNLSGAVS-----WKCGDISGAAQLVHP  395

Query  251  WPCSELATNH  222
             PC EL T+ 
Sbjct  396  SPCQELITSQ  405



>ref|XP_010448059.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY R S  ITIRR+TGSS F+GI++GSETSGGI ++  E+I L
Sbjct  251  TGDDLVAVKSGWDEYGIAYNRSSRDITIRRITGSSRFAGIAIGSETSGGIQNITVENITL  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTN GRGG I+ IT+S VYMEN RTGIKI+GD GDHPD++FN  ALP+V G
Sbjct  311  YNSGIGIHIKTNTGRGGSIQGITISGVYMENVRTGIKISGDTGDHPDDKFNLTALPVVRG  370

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G I+GLK SPFT++C SN+ L G  SP  P WKCSDV GAA +V+P
Sbjct  371  ITIKNVWGIKVERAGMIQGLKDSPFTNLCFSNVTLTGTKSP--PTWKCSDVVGAAHKVNP  428

Query  251  WPCSEL-ATNHRYGAC  207
             PC EL AT  + G+C
Sbjct  429  TPCPELTATTQQGGSC  444



>ref|XP_002867688.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43947.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  247  TGDDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALPIV G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIKISDVYIDTAKYGIKIAGDTGDHPDENYNPNALPIVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  367  IHIKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGSLNSYK-TWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  426  WPCSELRTTGGSYSCSSTF  444



>gb|KFK28938.1| hypothetical protein AALP_AA7G068200 [Arabis alpina]
Length=445

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+ RPS  ITIRR+TGSSPF+GI++GSETSGGI ++ AEHI+L
Sbjct  248  TGDDLVAIKSGWDEYGIAFNRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIFAEHISL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKI G+ GDHPD  +NPNALPIV G
Sbjct  308  SNMGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKINGETGDHPDANYNPNALPIVKG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  368  IHIKNVWGFNVQNAGSIQGLKGSPFTEICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSP  426

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T     +CS+T 
Sbjct  427  WPCSELRTTGGSNSCSSTF  445



>ref|XP_010913831.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913836.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913839.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=450

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 155/196 (79%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYG+AY RPS GITIRR+TGSSPF+GI+VGSETSGG+ +VL E I++
Sbjct  253  TGDDLVAVKSGWDEYGMAYARPSSGITIRRLTGSSPFAGIAVGSETSGGVENVLVESIHI  312

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTN GRGG IRNITVS V + N R  ++IAGDVGDHPD+ +NPNALPIV+G
Sbjct  313  YNTGIGIHIKTNSGRGGYIRNITVSGVNLSNVRKALRIAGDVGDHPDDMYNPNALPIVNG  372

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG  + QPG I G+K SPFT +CLSN+ LNG  + R  PWKC+DV G A+ V P
Sbjct  373  LTIKDVWGVDIQQPGSIDGIKNSPFTGVCLSNVKLNGDGT-REVPWKCADVSGGALGVQP  431

Query  251  WPCSELATNHRYGACS  204
             PC+EL +      C+
Sbjct  432  SPCTELTSISGLSFCT  447



>ref|NP_194113.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
 emb|CAA23048.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAB81300.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAL32775.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAM91193.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE84810.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
Length=444

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  247  TGDDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIIAEHITL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIKISDVYVDTAKYGIKIAGDTGDHPDENYNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  367  IHIKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGSLNSYK-TWKCSDVSGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T      CS+T 
Sbjct  426  WPCSELRTTGGSNLCSSTF  444



>gb|AIU50421.1| pectin lyase-like superfamily protein, partial [Pandanus utilis]
Length=406

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGI YGRPS GITIRR+ GSSPF+G++VGSE SGG+ +VL E++N+
Sbjct  221  TGDDLVAVKSGWDEYGIVYGRPSSGITIRRLAGSSPFAGVAVGSENSGGVENVLVENLNI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G+GIHIKTN GRGG IRNIT+S+V M   + GI+I GDVGDHPD++FNPNALP+V G
Sbjct  281  FNSGLGIHIKTNTGRGGYIRNITISDVNMNKVQKGIRIVGDVGDHPDDKFNPNALPVVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  + QPG I+G+K SPFT ICLSN+ L G       PWKC DV GAA++V P
Sbjct  341  VTIKNVWGVDIEQPGSIQGIKDSPFTRICLSNVKLWGEV-----PWKCDDVSGAALEVQP  395

Query  251  WPCSELAT  228
            WPC+EL +
Sbjct  396  WPCTELTS  403



>gb|AIU50427.1| pectin lyase-like superfamily protein, partial [Erythranthe guttata]
Length=406

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWD+YGI+Y RPS GITIRR+TGSSPF+GI+VGSETSGG+ DV+AEHINL
Sbjct  221  TGDDLVAVKSGWDQYGISYNRPSQGITIRRLTGSSPFAGIAVGSETSGGVADVIAEHINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+G+GIH+KTNIGRGG+IRNI++SNVYM  AR GIKI+GDVGDHPD  ++ NALP++  
Sbjct  281  SNMGIGIHLKTNIGRGGVIRNISISNVYMYKARKGIKISGDVGDHPDENYDRNALPVLKD  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DV G  V QPG I GLKK+PF+ ICLSN+ L G S      W+CSDV G A++VSP
Sbjct  341  VVIKDVSGDFVQQPGLIHGLKKAPFSGICLSNVSLGGDSG-----WQCSDVSGGAVRVSP  395

Query  251  WPCSELATNHR  219
             PC+EL ++ +
Sbjct  396  LPCAELTSSQQ  406



>ref|XP_002868572.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44831.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 153/193 (79%), Gaps = 2/193 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY  PS  ITIRR+TGSSPF+GI++GSETSGGI +V  E+I L
Sbjct  252  TGDDLVAVKSGWDEYGIAYNLPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITL  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTNIGRGG I+ IT+S VY+E  RTGIKI+GD GDHPD++FN +ALPIV G
Sbjct  312  YNSGIGIHIKTNIGRGGSIQGITISGVYLEKVRTGIKISGDTGDHPDDKFNTSALPIVRG  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G ++GLK SPFT++C SN+ L G  S   P WKCSDV GAA +V+P
Sbjct  372  ITIKNVWGIKVERAGMVQGLKDSPFTNLCFSNVTLTGTKS--TPIWKCSDVVGAASKVNP  429

Query  251  WPCSELATNHRYG  213
             PC EL T  + G
Sbjct  430  TPCPELTTTTQQG  442



>ref|XP_006283738.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
 gb|EOA16636.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
Length=444

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  247  TGDDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIRISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVEG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V + G I+GLK SPFT ICLS I+L+G+ +     WKC+DV G +++VSP
Sbjct  367  IHIKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGSLNMYR-TWKCADVIGTSMKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL T+     CS+  
Sbjct  426  WPCSELRTSGGSNVCSSAF  444



>ref|XP_006283728.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
 gb|EOA16626.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
Length=448

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  ITIRR+TGSSPF+GI++GSETSGGI ++  E+I L
Sbjct  251  TGDDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNITVENITL  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTNIGRGG I+ IT+S VY+E  RTGIKI+GD G+HPD+ FNP ALPIV G
Sbjct  311  YNSGIGIHIKTNIGRGGSIQGITISGVYLEKVRTGIKISGDTGNHPDDNFNPTALPIVRG  370

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G ++GLK SPFT++C SN+ L G  S  +P WKCS V GAA +V+P
Sbjct  371  ITIKNVWGIKVERAGMVQGLKDSPFTNLCFSNVTLTGTKS--SPIWKCSYVVGAANKVNP  428

Query  251  WPCSEL-ATNHRYGAC  207
             PC EL AT  + G+C
Sbjct  429  TPCPELTATTQQGGSC  444



>ref|XP_006405300.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 ref|XP_006405301.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46753.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46754.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
Length=447

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  ITIRR+TGSSPF+GI++GSETSGGI +V  E+I L
Sbjct  256  TGDDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITL  315

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+ G+GIHIKTNIGRGG +  IT+S V+ME  RTGIKI+G+ GDHPD+RFN +ALPIVSG
Sbjct  316  YSSGIGIHIKTNIGRGGSVHGITISGVHMEKVRTGIKISGNTGDHPDDRFNTSALPIVSG  375

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G ++GLK SPFT++CLSN+ L G  S  +P WKCSDV GAA +V+P
Sbjct  376  ITIKNVWGIKVERAGMVQGLKDSPFTNLCLSNVTLTGTKS--SPIWKCSDVVGAAEKVTP  433

Query  251  WPCSELATNHRYG  213
              C ELA+  + G
Sbjct  434  TACPELASTTQQG  446



>gb|AIU50399.1| pectin lyase-like superfamily protein, partial [Arabidopsis lyrata]
Length=406

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 155/188 (82%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALPIV G
Sbjct  281  SNMGVGVNIKTNIGRGGYIKNIKISDVYIDTAKYGIKIAGDTGDHPDENYNPNALPIVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V   G I+GLK SPFT ICLS I+L+G  +     WKCSDV G +++VSP
Sbjct  341  IHIKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGYKT-----WKCSDVIGTSLKVSP  395

Query  251  WPCSELAT  228
            WPCSEL T
Sbjct  396  WPCSELRT  403



>gb|AIU50403.1| pectin lyase-like superfamily protein, partial [Musa acuminata]
Length=396

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 145/187 (78%), Gaps = 5/187 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRR+ GSSPFSGI++GSETSGG+ +VL E+INL
Sbjct  211  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRLQGSSPFSGIAIGSETSGGVENVLVENINL  270

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G GIHIKTN GRGG IRN+TV NV M   R GI+IAGDVGDHPD  FN  A+P V G
Sbjct  271  YNTGFGIHIKTNAGRGGYIRNVTVVNVSMNKVRKGIRIAGDVGDHPDEYFNRYAMPTVDG  330

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  + QPG I G++ SPFT ICLSN+ L G       PWKC DV GAA+ V P
Sbjct  331  VTIKNVWGVDIQQPGSIEGIRSSPFTRICLSNVKLWGEQ-----PWKCMDVSGAALGVQP  385

Query  251  WPCSELA  231
            WPCS+L 
Sbjct  386  WPCSQLT  392



>gb|AIU50437.1| pectin lyase-like superfamily protein, partial [Yucca filamentosa]
Length=406

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 155/188 (82%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGI+YGRPS GITIRRVTGSSPF+ I+VGSETSGG+ +VL E++N+
Sbjct  221  TGDDLVAVKSGWDEYGISYGRPSSGITIRRVTGSSPFAAIAVGSETSGGVENVLVENVNI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G GIHIKTN+GRGG IRNIT++ V M N R G++IAGDVGDHPD++F+PNA+P+VSG
Sbjct  281  FNSGFGIHIKTNVGRGGYIRNITITEVNMNNVRKGLRIAGDVGDHPDDKFSPNAIPVVSG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  V QPG I+G+K SPFT ICL N+ L+        PWKC+DV G+A+ V P
Sbjct  341  LTIKNVWGMNVQQPGSIQGIKNSPFTGICLYNVKLSNEV-----PWKCTDVSGSALVVQP  395

Query  251  WPCSELAT  228
             PCSELA+
Sbjct  396  GPCSELAS  403



>gb|AIU50400.1| pectin lyase-like superfamily protein, partial [Arabidopsis thaliana]
Length=406

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 155/188 (82%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  221  TGDDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIIAEHITL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALP+V G
Sbjct  281  SNMGVGVNIKTNIGRGGYIKNIKISDVYVDTAKYGIKIAGDTGDHPDENYNPNALPVVKG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V   G I+GLK SPFT ICLS I+L+G  +     WKCSDV G +++VSP
Sbjct  341  IHIKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGYKT-----WKCSDVSGTSLKVSP  395

Query  251  WPCSELAT  228
            WPCSEL T
Sbjct  396  WPCSELRT  403



>gb|AAO62947.1| putative polygalacturonase-like protein [Lactuca sativa]
 gb|AAO62948.1| putative polygalacturonase-like protein, partial [Lactuca sativa]
Length=193

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWD+YGI Y RPS+ ITIRR+TGSSPF+GI++GSETSGG+ +VLAEHI L
Sbjct  20   TGDDLVAVKSGWDQYGIKYARPSNDITIRRLTGSSPFAGIAIGSETSGGVYNVLAEHITL  79

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+G+GIH+KTNIGRGGIIRNITVS+VYM N R GIKI+ DVGDHPD  +NPNALP++  
Sbjct  80   KNMGIGIHLKTNIGRGGIIRNITVSDVYMVNVRKGIKISADVGDHPDKNYNPNALPVLKH  139

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNG-ASSPRNPPWKCSDVHG  273
            ++I++VWGKKV Q G I GLK SPFT ICLSNI+L G   S RN PWKCS V G
Sbjct  140  VRIKNVWGKKVQQAGLIHGLKNSPFTDICLSNINLQGPIISTRNVPWKCSYVSG  193



>gb|AIU50411.1| pectin lyase-like superfamily protein, partial [Capsella rubella]
Length=406

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 157/189 (83%), Gaps = 5/189 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  221  TGDDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V G
Sbjct  281  SNMGVGVNIKTNIGRGGYIKNIRISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVEG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V + G I+GLK SPFT ICLS I+L+G  +     WKC+DV G +++VSP
Sbjct  341  IHIKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGYRT-----WKCADVIGTSMKVSP  395

Query  251  WPCSELATN  225
            WPCSEL T+
Sbjct  396  WPCSELRTS  404



>gb|AIN44009.1| polygalacturonase-like protein [Brassica juncea var. tumida]
Length=451

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 159/199 (80%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  ITIRR+TGSSP++GI++GSETSGGI +++AEHI+L
Sbjct  254  TGDDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISL  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NP ALP+V G
Sbjct  314  SNMGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAYYNPKALPVVKG  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I +VWG  V   G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  374  IHINNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSP  432

Query  251  WPCSELATNHRYGACSATL  195
            WPCSEL        CS++ 
Sbjct  433  WPCSELRATGGSYLCSSSF  451



>gb|AIU50415.1| pectin lyase-like superfamily protein, partial [Illicium henryi]
Length=406

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLVS+KSGWDEYGIAYGRPS  ITIRR+T SSPF+GI++GSE SGG+ +VL E+IN+
Sbjct  221  TGDDLVSIKSGWDEYGIAYGRPSSDITIRRITCSSPFAGIAIGSEMSGGVRNVLVENINI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G+GIH+KTN+GRGG IRNIT+S VYMEN R GI+ AG+VGDHPD+++NPNALP+V G
Sbjct  281  FNAGIGIHLKTNLGRGGFIRNITISEVYMENVRKGIRFAGNVGDHPDDKYNPNALPVVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            IK+ +VWG  V QPG I+GLK SPFT +C SNI+L+G+S      W+C D+ G+A+ V P
Sbjct  341  IKVTNVWGVNVQQPGSIQGLKDSPFTRLCFSNINLHGSSL-----WQCRDISGSALGVHP  395

Query  251  WPCSELAT  228
              C EL +
Sbjct  396  LACPELTS  403



>gb|AIU50401.1| pectin lyase-like superfamily protein, partial [Lilium brownii]
Length=406

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 152/188 (81%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  IT+RR+TGSSP++GI+VGSETSGG+ ++  ++IN+
Sbjct  221  TGDDLVAVKSGWDEYGIAYNRPSSDITVRRITGSSPYAGIAVGSETSGGVQNIFVQNINI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G+GIHIKTN+GRGG I+NIT+S+V M N R G+KI GD GDHPD++F+PNALP+V G
Sbjct  281  FNSGIGIHIKTNVGRGGYIKNITISDVNMYNVRYGLKIEGDAGDHPDDKFDPNALPVVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG  + QPG IRG+K +PFT ICLSN+  +        PWKC+DV GAA++V P
Sbjct  341  VTIRDVWGADIQQPGSIRGIKNAPFTRICLSNVRFSAEV-----PWKCTDVSGAALEVQP  395

Query  251  WPCSELAT  228
             PC+EL +
Sbjct  396  GPCAELTS  403



>gb|KFK32989.1| hypothetical protein AALP_AA6G314900 [Arabis alpina]
Length=443

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 156/197 (79%), Gaps = 3/197 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  ITIRR+TGSSPF+GI++GSETSGG+ ++  E+I L
Sbjct  246  TGDDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGVQNITVENITL  305

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+GIHIKTNIGRGG I+ I +S V+ME  RTGIKI+GD GDHPD++FNP+ALP+V G
Sbjct  306  YNSGIGIHIKTNIGRGGSIQGIKISGVHMEKVRTGIKISGDTGDHPDDKFNPSALPVVRG  365

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+++WG KV + G ++GLK SPFT++C SN+ L G     +P WKCSDV G+ ++V+P
Sbjct  366  ITIKNIWGIKVERAGTVQGLKDSPFTNLCFSNVTLTGTKG--SPIWKCSDVVGSTVKVNP  423

Query  251  WPCSEL-ATNHRYGACS  204
             PC EL AT  + G C 
Sbjct  424  TPCPELTATAQQGGTCE  440



>ref|XP_010433858.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 159/199 (80%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  247  TGDDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIKISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V + G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  367  IHIKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGSLNTYR-TWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
             PCSEL T      CS+  
Sbjct  426  SPCSELRTTGGSSFCSSAF  444



>ref|XP_010448653.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 159/199 (80%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  247  TGDDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIKISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  V + G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  367  IHIKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGSLNTYR-TWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
             PCSEL T      CS+  
Sbjct  426  SPCSELRTTGGSNFCSSAF  444



>gb|AIU50450.1| pectin lyase-like superfamily protein, partial [Alisma plantago-aquatica]
Length=406

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 151/190 (79%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS+GIT+RR+TGSSPF+GI++GSE SGG+ +VL EHIN+
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSYGITVRRITGSSPFAGIAIGSEASGGVENVLVEHINI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G+HIKTN GRGG I+N+T S+V + N R G++IAG+VGDHPDN FNP+A+P+V G
Sbjct  281  YNTGIGVHIKTNTGRGGYIKNVTFSDVILNNVRKGVRIAGNVGDHPDNNFNPSAVPVVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G KV QPG + G+K SPFT +CL N+ L         PW+C+DV G A++V P
Sbjct  341  VTIKNVVGMKVQQPGTLIGIKDSPFTRVCLDNVKLYSEV-----PWQCTDVSGGAVEVQP  395

Query  251  WPCSELATNH  222
             PCSEL   +
Sbjct  396  SPCSELMGTY  405



>ref|XP_010439131.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 159/199 (80%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS  ITIRR+TGSSPF+GI++GSETSGGI +++AEHI L
Sbjct  247  TGDDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITL  306

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             N+GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V G
Sbjct  307  SNMGVGVNIKTNIGRGGYIKNIKISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVKG  366

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG  + + G I+GLK SPFT ICLS I+L+G+ +     WKCSDV G +++VSP
Sbjct  367  IHIKNVWGVNIRKAGSIQGLKGSPFTGICLSEINLHGSLNTYR-TWKCSDVIGTSLKVSP  425

Query  251  WPCSELATNHRYGACSATL  195
             PCSEL T      CS+  
Sbjct  426  SPCSELRTTGGSDFCSSAF  444



>ref|XP_009395761.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS GI +RR+TGSSPF+G +VGSETSGGI ++LAE++N+
Sbjct  252  TGDDLVAVKSGWDEYGIAYARPSSGIIVRRLTGSSPFAGFAVGSETSGGIENILAENLNI  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +  GVGIHIKTN GRGG I+NIT+S+V + N R G++IAG+VGDHPD+R++PNALP+V G
Sbjct  312  FKTGVGIHIKTNSGRGGFIKNITISDVNLSNVRKGLRIAGNVGDHPDDRYDPNALPVVDG  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG ++ QPG I+G+K SPFT I LSN+ L+  +SPR   W C+DV G A+ V P
Sbjct  372  LTIKNVWGVRIQQPGSIQGIKNSPFTQIHLSNVKLD-VASPRGVAWACADVSGGALDVQP  430

Query  251  WPCSEL  234
             PC+EL
Sbjct  431  SPCAEL  436



>ref|XP_004961056.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=445

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 152/195 (78%), Gaps = 2/195 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDL+S+KSGWDEYGIA+GRPS GITIRR+TGS PF+G +VGSETSGG+ +VL EH+NL+
Sbjct  252  GDDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVLVEHLNLF  311

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
            ++GVGIHIKTN GRGG IRNITVS V +  AR G++IAGDVG HPD  +NPN LP+V  +
Sbjct  312  SMGVGIHIKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDTSYNPNVLPVVHSV  371

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             I++VWG+ + Q G IRG++ S F+ ICLSN+ L G++S    PWKC DV G A+ V P 
Sbjct  372  TIKNVWGQNIRQAGLIRGIRNSVFSRICLSNVKLYGSASIG--PWKCRDVSGGALDVQPS  429

Query  248  PCSELATNHRYGACS  204
            PC+ELA+    G C+
Sbjct  430  PCTELASTSETGFCT  444



>gb|AIU50422.1| pectin lyase-like superfamily protein, partial [Asparagus officinalis]
Length=406

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 152/188 (81%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRVTGSSPF+GI+VGSETSGG+ +V  E+I +
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVTGSSPFAGIAVGSETSGGVENVWIENITI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G GIHIKTN+GRGG IRNIT+++V M   R G++IAGDVGDHPD++FNPNALP VSG
Sbjct  281  FNSGFGIHIKTNVGRGGYIRNITITDVKMTEVRYGLRIAGDVGDHPDDKFNPNALPAVSG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG++V QPG I+G+K SPFT ICL N+ L         PWKC+DV G+A+ V P
Sbjct  341  LMIKNVWGEEVQQPGLIKGIKNSPFTGICLYNVKL-----LNEVPWKCTDVSGSALVVQP  395

Query  251  WPCSELAT  228
              CSEL +
Sbjct  396  GACSELTS  403



>gb|EAY85246.1| hypothetical protein OsI_06620 [Oryza sativa Indica Group]
Length=443

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 150/196 (77%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRV GSSPFSGI++GSE SGG+ DVL E  ++
Sbjct  249  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVSDVLVEDCSI  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G GIHIKTNIGRGG IRNITV NV M + R G++IAGDVGDHPD  F+  ALP V G
Sbjct  309  FNSGYGIHIKTNIGRGGFIRNITVDNVRMNSVRNGLRIAGDVGDHPDEHFSQLALPTVDG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  V QPG I G++ SPFT ICL+N+ L G  +  N  WKC DVHGAA+ V P
Sbjct  369  VSIKNVWGVNVQQPGSIEGIRNSPFTRICLANVKLFGWRN--NAAWKCRDVHGAALGVQP  426

Query  251  WPCSELATNHRYGACS  204
             PC+EL T+   G CS
Sbjct  427  GPCAELTTSLSSGFCS  442



>ref|XP_008810829.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810830.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810831.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=450

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYG+AY  PS GIT+RR+TGSSPFSGI++GSETSGG+ +VL E I++
Sbjct  253  TGDDLVAVKSGWDEYGMAYAHPSSGITVRRLTGSSPFSGIAIGSETSGGVENVLVESIHI  312

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G+GIHIKTN GRGG IRNITVS V + N R  ++IAGDVG HPD+ +NPNALPIV  
Sbjct  313  HNTGIGIHIKTNSGRGGFIRNITVSGVNLNNVRKAVRIAGDVGGHPDSMYNPNALPIVDA  372

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG  + QPG + G+K SPFT ICLSN+ LNG  + R  PWKC DV G A +V P
Sbjct  373  LTIKDVWGVDIQQPGSMEGIKNSPFTRICLSNVKLNGDGA-REVPWKCEDVSGGATEVQP  431

Query  251  WPCSELATNHRYGACS  204
             PC+EL        C+
Sbjct  432  SPCTELTGTSGMSFCA  447



>gb|AIU50425.1| pectin lyase-like superfamily protein, partial [Canna indica]
Length=406

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRR+TGSSPFSGI++GSETSGG+ +VL E++NL
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRLTGSSPFSGIAIGSETSGGVENVLVENVNL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G+HIKTN+GRGG IRN+ V++V M   R GI+IAGDVGDHPD  F+ +A+P V G
Sbjct  281  YNTGIGLHIKTNVGRGGYIRNVRVTDVTMNKVRKGIRIAGDVGDHPDEYFSRDAIPKVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  V QPG I G+K SPFT ICLSN+ L G +     PWKC+ V GAA+ V P
Sbjct  341  VTIKNVWGVGVQQPGSIEGIKNSPFTRICLSNVKLWGRA-----PWKCAAVSGAALGVRP  395

Query  251  WPCSELA  231
             PCSELA
Sbjct  396  SPCSELA  402



>gb|AIU50445.1| pectin lyase-like superfamily protein, partial [Cinnamomum camphora]
Length=406

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 155/190 (82%), Gaps = 5/190 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD+V+VKSGWDEYGIAYGRPS+GITIRR+TGSSPF+GI++GSE SGG+++V AE+I+L
Sbjct  221  TGDDMVAVKSGWDEYGIAYGRPSYGITIRRLTGSSPFAGIAIGSEASGGVLNVFAENISL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIH+KTNIGRGGII+NITV +V+M+  R GIKIAGDVG HPD +F+P ALP+V  
Sbjct  281  FNMGVGIHVKTNIGRGGIIKNITVRDVHMDTVRKGIKIAGDVGGHPDEKFDPTALPVVDS  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I +++V G KV QPG ++GLK  PFT ICL+ I++   S+     W+C DV GAA  V+P
Sbjct  341  ITVKNVVGVKVLQPGLLKGLKDLPFTRICLTGINMGNGSA-----WQCEDVTGAAYGVNP  395

Query  251  WPCSELATNH  222
             PC+EL T H
Sbjct  396  SPCTELITTH  405



>ref|XP_010924850.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=448

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 149/188 (79%), Gaps = 3/188 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL++VKSGWDEYGIAY  PS  +T+RR+TGSSPF+GI+VGSETSGG+ +VLAE I++
Sbjct  253  TGDDLIAVKSGWDEYGIAYAHPSSDVTVRRLTGSSPFAGIAVGSETSGGVENVLAERIHI  312

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN  VGIHIKTN GRGG IRNIT+S V M + R G++I GDVG HPD+++NPNALP+V G
Sbjct  313  YNTSVGIHIKTNSGRGGYIRNITISGVNMNHVRNGLRIKGDVGGHPDDKYNPNALPVVDG  372

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  + QPG I G+K SPFT ICLSNI LNGA    + PWKC DV G A +V P
Sbjct  373  LTIKNVWGVDIQQPGLIEGIKNSPFTRICLSNITLNGAG---DVPWKCKDVSGGAHKVQP  429

Query  251  WPCSELAT  228
             PC+EL +
Sbjct  430  SPCTELTS  437



>emb|CDY13383.1| BnaC06g13740D [Brassica napus]
Length=445

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 152/193 (79%), Gaps = 2/193 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  ITIRR+TGSSPF+GI++GSETSGGI +V  E+I L
Sbjct  248  TGDDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G+HIKTNIGRGG I+ ITVS +++E  RTGIKI+GD GDHPD++FN +ALP+V G
Sbjct  308  YNSGIGVHIKTNIGRGGSIQGITVSGIHLEKVRTGIKISGDTGDHPDDKFNTSALPVVQG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G ++GLK +PFT++C SN+   G     +P WKCSDV GAA +V+P
Sbjct  368  ITIKNVWGIKVERAGMVQGLKDAPFTNLCFSNVTFTGTKG--SPIWKCSDVVGAAEKVNP  425

Query  251  WPCSELATNHRYG  213
              C EL +  + G
Sbjct  426  TACPELTSTSQQG  438



>dbj|BAD61522.1| polygalacturonase-like [Oryza sativa Japonica Group]
Length=261

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYG+AYGRPS  ITIRR+TGSSPF+G +VGSETSGG+  VLAEH+N 
Sbjct  65   TGDDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNF  124

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G
Sbjct  125  FSSGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDG  184

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P
Sbjct  185  LTIKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQP  242

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  243  SPCTELTSTSGMSFCTNSL  261



>emb|CDX67513.1| BnaA07g15530D [Brassica napus]
Length=447

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  ITIRR+TGSSPF+GI++GSETSGGI +V  E+I L
Sbjct  250  TGDDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITL  309

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G+HIKTNIGRGG I+ ITVS V++E  RTGIKI+GD GDHPD++FN +ALP+V G
Sbjct  310  YNSGIGVHIKTNIGRGGSIQGITVSGVHLEKVRTGIKISGDTGDHPDDKFNASALPVVRG  369

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G ++GLK +PFT++C SN+   G     +P WKCSDV GAA +V+P
Sbjct  370  ITIKNVWGIKVERAGMVQGLKDAPFTNLCFSNVTFTGTKG--SPIWKCSDVVGAAEKVNP  427

Query  251  WPCSEL-ATNHRYGAC  207
              C EL +T+ + G C
Sbjct  428  TACPELTSTSQQGGYC  443



>gb|AIU50438.1| pectin lyase-like superfamily protein, partial [Setaria italica]
Length=406

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 148/189 (78%), Gaps = 5/189 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRV GSSPFSGI++GSE SGG+ DVL E  ++
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKT++GRGG IRN+TV NV M   R+G++IAGD GDHPD RF+  A+P+V  
Sbjct  281  FDSGYGIHIKTSVGRGGYIRNVTVDNVRMSRVRSGVRIAGDAGDHPDGRFSQRAVPMVDA  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I++VWG  + QPG + G++ SPFT ICL N+ L G ++     W+C DV GAA+ V P
Sbjct  341  VRIRNVWGVGIQQPGSLEGIRNSPFTRICLDNVKLFGGAA-----WRCRDVRGAALGVQP  395

Query  251  WPCSELATN  225
            WPC+ELAT+
Sbjct  396  WPCAELATS  404



>ref|XP_009125202.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=447

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS  ITIRR+TGSSPF+GI++GSETSGGI +V  E+I L
Sbjct  250  TGDDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITL  309

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G+G+HIKTNIGRGG I+ ITVS V++E  RTGIKI+GD GDHPD++FN +ALP+V G
Sbjct  310  YNSGIGVHIKTNIGRGGSIQGITVSGVHLEKVRTGIKISGDTGDHPDDKFNVSALPVVRG  369

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I++VWG KV + G ++GLK +PFT++C SN+   G     +P WKCSDV GAA +V+P
Sbjct  370  ITIKNVWGIKVERAGMVQGLKDAPFTNLCFSNVTFTGTKG--SPIWKCSDVVGAAEKVNP  427

Query  251  WPCSEL-ATNHRYGAC  207
              C EL +T+ + G C
Sbjct  428  TACPELTSTSQQGGYC  443



>ref|XP_009396562.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   231 bits (589),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAY RPS GIT+RRVTGS+ F+GI++GSETSGGI +V AE++++
Sbjct  252  TGDDLVAVKSGWDEYGIAYARPSSGITVRRVTGSNQFAGIAIGSETSGGIENVFAENLDI  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G+GIHIKTN GRGG IRNIT+S+V + N R  +KI+G  GDHPD+ ++PNALP+V G
Sbjct  312  FDSGIGIHIKTNSGRGGFIRNITISDVNLNNVRKALKISGKAGDHPDDGYDPNALPVVDG  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  V QPG I+G+K SPFTHICLSN+ L   +S R  PW C+DV G A++V P
Sbjct  372  LTIKNVWGVGVRQPGSIQGIKDSPFTHICLSNVTLK-VNSSREVPWTCADVSGGALEVQP  430

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL + +    C+  L
Sbjct  431  SPCAELTSVNGVRFCTNAL  449



>ref|XP_006654851.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=306

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 149/196 (76%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWDEYGIA+GRPS GITIRR+TGS PF+G +VGSETSGG+ +V  EH+N 
Sbjct  112  TGDDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNF  171

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +++GVGIHIKTN GRGG IRNITVS V ++ AR G++IAGDVG HPD  +NP+ LP V G
Sbjct  172  FSMGVGIHIKTNSGRGGFIRNITVSEVTLDGARYGLRIAGDVGGHPDASYNPSMLPAVDG  231

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG+ + Q G IRG++ S F+ ICLSN+ L G++S    PWKC  V G A+ V P
Sbjct  232  VTIKNVWGQNIRQAGLIRGIRNSVFSRICLSNVKLYGSASV--GPWKCRAVSGGALDVQP  289

Query  251  WPCSELATNHRYGACS  204
             PC+EL    +   C+
Sbjct  290  LPCAELTNTSKMSFCT  305



>ref|NP_001046468.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAD29699.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAD27952.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAF08382.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAG87758.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87044.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56682.1| hypothetical protein OsJ_06128 [Oryza sativa Japonica Group]
Length=443

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 149/196 (76%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRV GSSPFSGI++GSE SGG+ +VL E  ++
Sbjct  249  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVSNVLVEDCSI  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G GIHIKTNIGRGG IRNITV NV M + R G++IAGDVGDHPD  F+  ALP V  
Sbjct  309  FNSGYGIHIKTNIGRGGFIRNITVDNVRMNSVRNGLRIAGDVGDHPDEHFSQLALPTVDA  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG  V QPG I G++ SPFT ICL+N+ L G  +  N  WKC DVHGAA+ V P
Sbjct  369  VSIKNVWGVNVQQPGSIEGIRNSPFTRICLANVKLFGWRN--NAAWKCRDVHGAALGVQP  426

Query  251  WPCSELATNHRYGACS  204
             PC+EL T+   G CS
Sbjct  427  GPCAELTTSLSSGFCS  442



>ref|XP_004951285.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=447

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRV GSSPFSGI++GSE SGG+ DVL E  ++
Sbjct  252  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSI  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKT++GRGG IRN+TV NV M   R+G++IAGD GDHPD RF+  A+P+V  
Sbjct  312  FDSGYGIHIKTSVGRGGYIRNVTVDNVRMSRVRSGVRIAGDAGDHPDGRFSQRAVPMVDA  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I++VWG  + QPG + G++ SPFT ICL N+ L G  +     W+C DV GAA+ V P
Sbjct  372  VRIRNVWGVGIQQPGSLEGIRNSPFTRICLDNVKLFGWRT--GAAWRCRDVRGAALGVQP  429

Query  251  WPCSELATN  225
            WPC+ELAT+
Sbjct  430  WPCAELATS  438



>ref|NP_001043594.2| Os01g0618900 [Oryza sativa Japonica Group]
 dbj|BAD61521.1| polygalacturonase-like [Oryza sativa Japonica Group]
 dbj|BAF05508.2| Os01g0618900 [Oryza sativa Japonica Group]
Length=308

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYG+AYGRPS  ITIRR+TGSSPF+G +VGSETSGG+  VLAEH+N 
Sbjct  112  TGDDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNF  171

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G
Sbjct  172  FSSGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDG  231

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P
Sbjct  232  LTIKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQP  289

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  290  SPCTELTSTSGMSFCTNSL  308



>ref|XP_010527633.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=186

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = -3

Query  758  WDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLYNIGVGIHIKT  579
            WDEYGIAY RPSH ITIRR+TGSSP++GI++GSE+SG I +V AE I LYN G G+HIKT
Sbjct  1    WDEYGIAYNRPSHDITIRRITGSSPYAGIAIGSESSGSIHNVTAEDITLYNSGFGVHIKT  60

Query  578  nigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIKIQDVWGKKV  399
            NIGRGG ++NI +S +YMEN RTGI+I+G  GDHPD++FNP ALPIV  I I++V G KV
Sbjct  61   NIGRGGTVQNIRISGLYMENVRTGIRISGATGDHPDDKFNPKALPIVRDIMIKNVKGVKV  120

Query  398  SQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWPCSELATNHR  219
               G ++GL+ SPFT++CLSN+ L    +  +PPWKCSDV GAA++VSP PC+EL    +
Sbjct  121  QHAGLVQGLRDSPFTNVCLSNVTLTDPKA--SPPWKCSDVTGAAVKVSPLPCAELVATTQ  178

Query  218  YGAC  207
             G+C
Sbjct  179  GGSC  182



>ref|XP_002441600.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
 gb|EES20030.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
Length=439

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 153/196 (78%), Gaps = 2/196 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDL+S+KSGWDEYGIA+GRPS GITIRR+TGS PF+G +VGSETSGG+ +VL EH+NL+
Sbjct  246  GDDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVLVEHLNLF  305

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
             +GVGIHIKTN GRGG IRNITVS V +  AR G++IAGDVG HPD  +NP+ LP+V+ +
Sbjct  306  GMGVGIHIKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYNPSVLPVVNSV  365

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             I++V G+ + Q G IRG++ S F++ICLSN+ L G++S    PWKC  V GAA+ V P 
Sbjct  366  TIKNVLGQNIRQAGLIRGIRNSVFSNICLSNVKLYGSASIG--PWKCRAVSGAALDVQPS  423

Query  248  PCSELATNHRYGACSA  201
            PC+ELA+    G C++
Sbjct  424  PCTELASTSETGFCTS  439



>gb|AIU50432.1| pectin lyase-like superfamily protein, partial [Panicum virgatum]
Length=406

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 5/189 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRV GSSPFSGI++GSE SGG+ DVL E  ++
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G GIHIKTN+GRGG IRN+TV NV M   R+G++IAGDVGDHPD RF+  A+P V  
Sbjct  281  FNSGYGIHIKTNVGRGGYIRNVTVDNVRMSGVRSGVRIAGDVGDHPDGRFSQLAVPTVDA  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I++VWG  V QPG + G++ SPFT ICLSN+ L G ++     W+C DV GAA+ V P
Sbjct  341  VRIRNVWGVGVQQPGSLEGIRNSPFTRICLSNVKLFGGAA-----WRCRDVRGAALGVHP  395

Query  251  WPCSELATN  225
             PC+ELAT+
Sbjct  396  SPCAELATS  404



>emb|CDM83426.1| unnamed protein product [Triticum aestivum]
Length=450

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+G SVGSETSGG+ +VLAEH+N 
Sbjct  254  TGDDLIAIKSGWDEYGIAYGRPSSDITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNF  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+ G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N NALPIV  
Sbjct  314  YSSGFGVHIKTNSGRGGFIRNITVSDVVLDNVRYGLRIAGDVGGHPDERYNHNALPIVDS  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ V + G I+G+  S F+ ICLSNI L+G++  R  PWKC+ V G A+ V P
Sbjct  374  LTIKNVQGQNVREAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCAAVSGGALDVQP  431

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  432  SPCTELTSTSGMSFCTNSL  450



>dbj|BAJ94644.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91541.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+G SVGSETSGG+ +VLAEH+N 
Sbjct  254  TGDDLIAIKSGWDEYGIAYGRPSSDITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNF  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+ G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N NALPIV  
Sbjct  314  YSSGFGVHIKTNSGRGGFIRNITVSDVILDNVRYGLRIAGDVGGHPDERYNHNALPIVDS  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSNI L+G++  R  PWKC  V G A+ V P
Sbjct  374  LMIKNVQGQNIKEAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCQAVSGGALDVQP  431

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  432  SPCTELTSMSGMSFCTNSL  450



>dbj|BAJ89948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  ITIRR+TGSSPF+G SVGSETSGG+ +VLAEH+N 
Sbjct  254  TGDDLIAIKSGWDEYGIAYGRPSSDITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNF  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+ G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N NALPIV  
Sbjct  314  YSSGFGVHIKTNSGRGGFIRNITVSDVILDNVRYGLRIAGDVGGHPDERYNHNALPIVDS  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSNI L+G++  R  PWKC  V G A+ V P
Sbjct  374  LMIKNVQGQNIKEAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCQAVSGGALDVQP  431

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  432  SPCTELTSMSGMSFCTNSL  450



>gb|EAZ12715.1| hypothetical protein OsJ_02632 [Oryza sativa Japonica Group]
Length=419

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYG+AYGRPS  ITIRR+TGSSPF+G +VGSETSGG+  VLAEH+N 
Sbjct  223  TGDDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNF  282

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G
Sbjct  283  FSSGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDG  342

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P
Sbjct  343  LTIKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQP  400

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  401  SPCTELTSTSGMSFCTNSL  419



>gb|EAY74990.1| hypothetical protein OsI_02888 [Oryza sativa Indica Group]
Length=445

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYG+AYGRPS  ITIRR+TGSSPF+G +VGSETSGG+  VLAEH+N 
Sbjct  249  TGDDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G
Sbjct  309  FSSGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDG  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P
Sbjct  369  LTIKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQP  426

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  427  SPCTELTSTSGMSFCTNSL  445



>gb|AIU50444.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=406

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 148/186 (80%), Gaps = 5/186 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS GITIRR+TGS+PF+GI++GSE SGG+ +VLAE + +
Sbjct  221  TGDDLVAIKSGWDQYGIAYGRPSSGITIRRLTGSTPFAGIAIGSEMSGGVENVLAEDVTI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G GI++KT IGRGGII+NITVS +Y+ N R  I+IAG+VGDHPD+ F+P+A+PIV+G
Sbjct  281  YNSGFGINLKTTIGRGGIIKNITVSGLYVANVRKAIRIAGNVGDHPDDGFDPDAVPIVNG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G  V QPG I G+K SPFT ICLSNI++     P    WKCSD+ G A  V P
Sbjct  341  ITIKDVRGVDVLQPGSIEGIKSSPFTQICLSNINI-----PIGTAWKCSDISGVAQSVYP  395

Query  251  WPCSEL  234
            WPCS L
Sbjct  396  WPCSNL  401



>gb|AIU50440.1| pectin lyase-like superfamily protein, partial [Sorghum bicolor]
Length=406

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 5/189 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRV GSSPFSGI++GSE SGG+ DVL E  ++
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN+GRGG IRN+TV NV M   R+G++IAGDVGDHPD  F+  A+P+V  
Sbjct  281  FDSGYGIHIKTNVGRGGYIRNVTVDNVRMSGVRSGVRIAGDVGDHPDAHFSQLAVPLVDA  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I +VWG  V  PG + G++ SPFT ICLSN+ L G ++     W+C DV GAA+ V P
Sbjct  341  VRISNVWGVNVQHPGSLEGIRSSPFTRICLSNVKLFGDAA-----WRCRDVRGAALGVQP  395

Query  251  WPCSELATN  225
             PC+ELAT+
Sbjct  396  SPCAELATS  404



>ref|NP_001149385.1| LOC100283011 precursor [Zea mays]
 gb|ACG35253.1| polygalacturonase [Zea mays]
Length=446

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDL+S+KSGWDEYG+A+GRPS GIT+RR+TGS PF+G +VGSETSGG+ DV+AEH++  
Sbjct  252  GDDLISIKSGWDEYGVAFGRPSSGITVRRITGSGPFAGFAVGSETSGGVEDVVAEHLSFS  311

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
             +GVG+H+KTN GRGG IRN+TVS V ++ AR G++IAGDVG HP   +N + LP+V G+
Sbjct  312  GVGVGVHVKTNSGRGGFIRNVTVSQVTLDGARYGLRIAGDVGGHPGASYNASLLPVVDGV  371

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             +++VWG+ V Q G IRG++ S F++ICLSN+ L G  S    PW+C  V G+A+ V P 
Sbjct  372  AVRNVWGRNVRQAGLIRGIRDSVFSNICLSNVKLYGIGSDSIGPWRCRAVSGSALDVQPS  431

Query  248  PCSELATNHRYGACS  204
            PC+ELA+    G C+
Sbjct  432  PCAELASTSGTGFCT  446



>gb|EAY99223.1| hypothetical protein OsI_21181 [Oryza sativa Indica Group]
Length=448

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWDEYGIA+GRPS GITIRR+TGS PF+G +VGSETSGG+ +V  EH+N 
Sbjct  254  TGDDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNF  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            + +GVGIH+KTN GRGG IRNITVS V +  AR G++IAGDVG HPD  ++P+ LP+V G
Sbjct  314  FGMGVGIHVKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYDPSKLPVVDG  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG+ + Q G +RG++ S F+ ICLSN+ L G  S    PWKC  V G A+ V P
Sbjct  374  VTIKNVWGQNIRQAGLVRGIRDSVFSRICLSNVKLYGGDSV--GPWKCRAVSGGALDVQP  431

Query  251  WPCSELATNHRYGACS  204
             PC+EL +      C+
Sbjct  432  SPCAELTSTSEMSFCT  447



>ref|NP_001056466.1| Os05g0587000 [Oryza sativa Japonica Group]
 dbj|BAF18380.1| Os05g0587000 [Oryza sativa Japonica Group]
 gb|EAZ10399.1| hypothetical protein OsJ_00232 [Oryza sativa Japonica Group]
Length=448

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWDEYGIA+GRPS GITIRR+TGS PF+G +VGSETSGG+ +V  EH+N 
Sbjct  254  TGDDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNF  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            + +GVGIH+KTN GRGG IRNITVS V +  AR G++IAGDVG HPD  ++P+ LP+V G
Sbjct  314  FGMGVGIHVKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYDPSKLPVVDG  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG+ + Q G +RG++ S F+ ICLSN+ L G  S    PWKC  V G A+ V P
Sbjct  374  VTIKNVWGQNIRQAGLVRGIRDSVFSRICLSNVKLYGGDSV--GPWKCRAVSGGALDVQP  431

Query  251  WPCSELATNHRYGACS  204
             PC+EL +      C+
Sbjct  432  SPCAELTSTSEMSFCT  447



>gb|AAT44156.1| putative polygalacturonase [Oryza sativa Japonica Group]
Length=474

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWDEYGIA+GRPS GITIRR+TGS PF+G +VGSETSGG+ +V  EH+N 
Sbjct  280  TGDDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNF  339

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            + +GVGIH+KTN GRGG IRNITVS V +  AR G++IAGDVG HPD  ++P+ LP+V G
Sbjct  340  FGMGVGIHVKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYDPSKLPVVDG  399

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++VWG+ + Q G +RG++ S F+ ICLSN+ L G  S    PWKC  V G A+ V P
Sbjct  400  VTIKNVWGQNIRQAGLVRGIRDSVFSRICLSNVKLYGGDSV--GPWKCRAVSGGALDVQP  457

Query  251  WPCSELATNHRYGACS  204
             PC+EL +      C+
Sbjct  458  SPCAELTSTSEMSFCT  473



>gb|ACN36471.1| unknown [Zea mays]
Length=347

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS G+T+RRV GSSPFSGI++GSE SGG+ DVL E   +
Sbjct  152  TGDDLVAIKSGWDEYGIAYGRPSAGVTVRRVRGSSPFSGIAIGSEASGGVRDVLVEDCAI  211

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN+GRGG IRN+TV  V +   R+G++IAGDVGDHPD  F+  A+P V  
Sbjct  212  FDSGYGIHIKTNVGRGGYIRNVTVDGVRLTGVRSGVRIAGDVGDHPDAHFSQLAVPTVDA  271

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I +VWG  V QPG + G++ SPFT ICLSN+ L G  S  +  WKC DV GAA+ V P
Sbjct  272  VRISNVWGVNVQQPGSLEGIRASPFTRICLSNVKLFGWRS--DAAWKCRDVRGAALGVQP  329

Query  251  WPCSELATN  225
             PC+ELAT+
Sbjct  330  SPCAELATS  338



>gb|AFW81284.1| hypothetical protein ZEAMMB73_960645 [Zea mays]
Length=458

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDDL+S+KSGWDEYG+A+GRPS GIT+RR+TGS PF+G +VGSETSGG+ DV+AEH++  
Sbjct  264  GDDLISIKSGWDEYGVAFGRPSSGITVRRITGSGPFAGFAVGSETSGGVEDVVAEHLSFS  323

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
             +GVG+H+KTN GRGG IRN+TVS V ++ AR G++IAGDVG HP   +N + LP++ G+
Sbjct  324  GVGVGVHVKTNSGRGGFIRNVTVSQVTLDGARYGLRIAGDVGGHPGASYNASLLPVIDGV  383

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             +++VWG+ V Q G IRG++ S F++ICLSN+ L G  S    PW+C  V G+A+ V P 
Sbjct  384  AVRNVWGRNVRQAGLIRGIRDSVFSNICLSNVKLYGIGSDSIGPWRCRAVSGSALDVQPS  443

Query  248  PCSELATNHRYGACS  204
            PC+ELA+    G C+
Sbjct  444  PCAELASTSGTGFCT  458



>gb|AIU50436.1| pectin lyase-like superfamily protein, partial [Dioscorea oppositifolia]
Length=406

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 148/188 (79%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGI +GRPS  ITIRR+ GSSP++GI++GSE SGG+ +VL +++N+
Sbjct  221  TGDDLVAVKSGWDEYGITFGRPSSDITIRRLRGSSPYAGIAIGSEASGGVQNVLVDNVNI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G GIHIKTN GRGG IRNIT+SNV M   R GI+IAG+VGDHPD++++ +ALP+V G
Sbjct  281  FNSGFGIHIKTNTGRGGFIRNITISNVIMNKVRKGIRIAGNVGDHPDDKYDQSALPVVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G  + QPG I+G+K SPFT ICLSN+ L         PWKC DV GAA++V P
Sbjct  341  VTIKNVQGFNIEQPGTIQGIKDSPFTRICLSNVKLWSEV-----PWKCDDVTGAALEVQP  395

Query  251  WPCSELAT  228
             PC+ELA+
Sbjct  396  SPCTELAS  403



>ref|XP_006646109.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=444

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYG+AYGRPS  IT+RR+TGSSPF+G +VGSETSGG+  +LAEH+N 
Sbjct  248  TGDDLIAIKSGWDEYGMAYGRPSSHITVRRITGSSPFAGFAVGSETSGGVEHILAEHLNF  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             + G GIHIKTN GRGG IRN+TVS+V ++  R G++IAGDVG HPD+R++ NALP+V G
Sbjct  308  VSSGFGIHIKTNTGRGGFIRNVTVSDVTLDTVRYGLRIAGDVGGHPDDRYDRNALPVVDG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSN+  NG +  R  PWKC  V GAA+ V P
Sbjct  368  LTIKNVQGQNIREAGSIKGIATSAFSRICLSNVKFNGGTPVR--PWKCEAVSGAALDVQP  425

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  426  SPCTELTSTSGMSFCTNSL  444



>ref|XP_003569374.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=448

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS  IT+RR+TGSSPF+G +VGSETSGG+ +VLAEH+N 
Sbjct  252  TGDDLVAIKSGWDEYGIAYGRPSSDITVRRITGSSPFAGFAVGSETSGGVENVLAEHLNF  311

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G G+HIKTN GRGG IRN+TVS+V ++N R G++IAGDVGDHPD  +N NALP V  
Sbjct  312  FSSGFGVHIKTNSGRGGFIRNVTVSDVTLDNVRYGLRIAGDVGDHPDEHYNHNALPKVDS  371

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSNI L+G+   R  PWKC  V G A+ + P
Sbjct  372  LTIKNVQGQNIKEAGSIKGIASSAFSRICLSNIKLHGSVPVR--PWKCESVSGGALDLQP  429

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  430  SPCTELTSTSGTSFCTNSL  448



>ref|XP_004969187.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=444

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD V++KSGWDEYGIAYGRPS  IT+RR+TGSSPF+G +VGSETSGG+ +VLAEH+N 
Sbjct  248  TGDDAVAIKSGWDEYGIAYGRPSSDITVRRITGSSPFAGFAVGSETSGGVQNVLAEHLNF  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN GRGG IRNITVS+V ++N R G++I GDVGDHPD+ +N +ALP+V  
Sbjct  308  FSSGFGIHIKTNTGRGGFIRNITVSDVTLDNVRYGLRITGDVGDHPDDSYNRSALPVVDT  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSN+ L+G +  R  PWKC  V G A+ V P
Sbjct  368  LTIKNVQGQNIREAGLIKGITNSAFSRICLSNVKLSGGTPVR--PWKCEAVTGGALDVQP  425

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  426  SPCTELTSTSGTSFCTNSL  444



>ref|NP_001170283.1| uncharacterized protein LOC100384246 precursor [Zea mays]
 gb|ACN33336.1| unknown [Zea mays]
 gb|AFW65883.1| hypothetical protein ZEAMMB73_311601 [Zea mays]
Length=451

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS G+T+RRV GSSPFSGI++GSE SGG+ DVL E   +
Sbjct  256  TGDDLVAIKSGWDEYGIAYGRPSAGVTVRRVRGSSPFSGIAIGSEASGGVRDVLVEDCAI  315

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN+GRGG IRN+TV  V +   R+G++IAGDVGDHPD  F+  A+P V  
Sbjct  316  FDSGYGIHIKTNVGRGGYIRNVTVDGVRLTGVRSGVRIAGDVGDHPDAHFSQLAVPTVDA  375

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I +VWG  V QPG + G++ SPFT ICLSN+ L G  S  +  WKC DV GAA+ V P
Sbjct  376  VRISNVWGVNVQQPGSLEGIRASPFTRICLSNVKLFGWRS--DAAWKCRDVRGAALGVQP  433

Query  251  WPCSELATN  225
             PC+ELAT+
Sbjct  434  SPCAELATS  442



>ref|XP_002455965.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
 gb|EES01085.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
Length=447

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 149/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD +++KSGWDEYGIAYGRPS  IT+RR+TGSSPF+G +VGSETSGG+ +VLAEH+N 
Sbjct  251  TGDDAIAIKSGWDEYGIAYGRPSSDITVRRITGSSPFAGFAVGSETSGGVENVLAEHLNF  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN GRGG IRN+TVS+V ++N R G++I GDVG+HPD R+N +ALPIV  
Sbjct  311  FSSGFGIHIKTNTGRGGFIRNVTVSDVTLDNVRYGLRIVGDVGNHPDERYNRSALPIVDA  370

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I++V G+ + + G I+G+  S F+ ICLSN+ L G +  +  PWKC  V G A+ V P
Sbjct  371  LTIKNVQGQNIKEAGLIKGIANSAFSRICLSNVKLTGGAPVQ--PWKCEAVSGGALDVQP  428

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  429  SPCTELTSTSGTSFCTNSL  447



>gb|AIU50449.1| pectin lyase-like superfamily protein, partial [Zea mays]
Length=406

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 144/189 (76%), Gaps = 5/189 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS G+T+RRV GSSPFSGI++GSE SGG+ DVL E   +
Sbjct  221  TGDDLVAIKSGWDEYGIAYGRPSAGVTVRRVRGSSPFSGIAIGSEASGGVRDVLVEDCAI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++ G GIHIKTN+GRGG IRN+TV  V +   R+G++IAGDVGDHPD  F+  A+P V  
Sbjct  281  FDSGYGIHIKTNVGRGGYIRNVTVDGVRLTGVRSGVRIAGDVGDHPDAHFSQLAVPTVDA  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            ++I +VWG  V QPG + G++ SPFT ICLSN+ L G ++     WKC DV GAA+ V P
Sbjct  341  VRISNVWGVNVQQPGSLEGIRASPFTRICLSNVKLFGDAA-----WKCRDVRGAALGVQP  395

Query  251  WPCSELATN  225
             PC+ELAT+
Sbjct  396  SPCAELATS  404



>ref|XP_006837459.1| PREDICTED: probable polygalacturonase [Amborella trichopoda]
 gb|ERN00313.1| hypothetical protein AMTR_s00107p00122980 [Amborella trichopoda]
Length=447

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 144/197 (73%), Gaps = 3/197 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSS-PFSGISVGSETSGGIVDVLAEHIN  615
            TGDDLV++KSGWDEYGIAY RPS  ITIRR++GSS  F+GI+ GSETSGGI D++ E+I 
Sbjct  248  TGDDLVAIKSGWDEYGIAYARPSSFITIRRISGSSLAFTGIAFGSETSGGISDIVVENIT  307

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L N    I +KTN GRGG IRNITV  V++EN    IK AGDVGDHPD++++P ALP+V 
Sbjct  308  LVNTATAIFLKTNAGRGGYIRNITVRGVHLENVTKAIKFAGDVGDHPDDKYDPRALPVVE  367

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
            G+ I DVWG  V QPG ++G+  +PF  ICLSN++L G        WKC+D+ G A+ V 
Sbjct  368  GVSISDVWGVGVMQPGSMKGINGAPFKGICLSNVNLYGWVP--GAQWKCTDISGVALGVR  425

Query  254  PWPCSELATNHRYGACS  204
            PWPC+ELA  H  GACS
Sbjct  426  PWPCAELAATHGTGACS  442



>gb|AIU50451.1| pectin lyase-like superfamily protein, partial [Cabomba caroliniana]
Length=406

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 143/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIA+GRPS  IT+RR+TG+S F+GI+ GSETSGGI ++L E+INL
Sbjct  221  TGDDLVAIKSGWDEYGIAFGRPSSNITVRRITGTSSFAGIAFGSETSGGIENILVENINL  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI +KTN GRGG+IRNITV ++YMEN +  IK AG+VGDHPDN +NPNALP+V G
Sbjct  281  YNTATGIFLKTNAGRGGVIRNITVRDIYMENVKNAIKFAGNVGDHPDNNYNPNALPVVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I +VWG  V  PG + G++ +PF  ICLSNI+L G+      PWKC  V G A+ V P
Sbjct  341  VAIVNVWGDSVLHPGSLVGVQGAPFQRICLSNINLRGSL-----PWKCDGVEGFALGVHP  395

Query  251  WPCSELAT  228
             PC+ L +
Sbjct  396  GPCASLVS  403



>ref|NP_001141464.1| uncharacterized protein LOC100273574 precursor [Zea mays]
 ref|XP_008654580.1| PREDICTED: uncharacterized protein LOC100273574 isoform X1 [Zea 
mays]
 gb|ACF86427.1| unknown [Zea mays]
 gb|ACN28939.1| unknown [Zea mays]
 gb|AFW83292.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
 gb|AFW83293.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
Length=446

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD +++KSGWDEYGIAYGR S GIT+RR+TGSSPF+G +VGSETSGG+ +VLAEH+N 
Sbjct  250  TGDDSIAIKSGWDEYGIAYGRASSGITVRRITGSSPFAGFAVGSETSGGVENVLAEHLNF  309

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N G GIH+KTN GRGG IRNITVS+V ++N R G++I GDVG+HPD+ +N +ALPIV  
Sbjct  310  FNSGFGIHVKTNTGRGGFIRNITVSDVTLDNVRYGLRIVGDVGNHPDDSYNRSALPIVDA  369

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + +++V G+ V + G I+G+  S F+ ICLSN+   G +  R  PWKC  V G A+ V P
Sbjct  370  LTVKNVQGQNVREAGLIKGIPNSAFSRICLSNVKFTGGAPVR--PWKCEAVSGGALDVQP  427

Query  251  WPCSELATNHRYGACSATL  195
             PC+EL +      C+ +L
Sbjct  428  SPCTELTSTSGTSFCTNSL  446



>ref|XP_002451891.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
 gb|EES04867.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
Length=448

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWDEYGIAYGRPS GITIRRV GSSPFSGI++GSE SGG+ DVL E  ++
Sbjct  251  TGDDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSI  310

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENAR-TGIKIAGDVGDHPDNRFNPNALPIVS  435
            ++ G GIHIKTN+GRGG IRN+TV NV M   R +G++IAGDVGDHPD  F+  A+P+V 
Sbjct  311  FDSGYGIHIKTNVGRGGYIRNVTVDNVRMSGVRISGVRIAGDVGDHPDAHFSQLAVPLVD  370

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             ++I +VWG  V  PG + G++ SPFT ICLSN+ L G     +  W+C DV GAA+ V 
Sbjct  371  AVRISNVWGVNVQHPGSLEGIRSSPFTRICLSNVKLFGWRK-NDAAWRCRDVRGAALGVQ  429

Query  254  PWPCSELATN  225
            P PC+ELAT+
Sbjct  430  PSPCAELATS  439



>gb|AIU50417.1| pectin lyase-like superfamily protein, partial [Iris japonica]
Length=406

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 136/186 (73%), Gaps = 5/186 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD +++KSGWDEYGI+YGRPS  ITI+R+T SSPFS I++GSE SGGI  +L  +IN+
Sbjct  221  TGDDAIAIKSGWDEYGISYGRPSTFITIQRITASSPFSAIAIGSEASGGIQHILIHNINI  280

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++  + IHIKTN GRGG I N+T+S+V+M     G++I GDVGDHPD  FNP AL  V G
Sbjct  281  HSTAIAIHIKTNAGRGGFITNVTISDVHMSRVTEGVRIVGDVGDHPDGNFNPGALTRVDG  340

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DVWG  V +PG I G+K SPFT ICLSN+ L G        W+C++V G A+ V P
Sbjct  341  VTIRDVWGVGVREPGSIEGIKDSPFTRICLSNVRLWGMEK-----WRCAEVSGVAVGVEP  395

Query  251  WPCSEL  234
            WPC+EL
Sbjct  396  WPCAEL  401



>gb|AIU50447.1| pectin lyase-like superfamily protein, partial [Ginkgo biloba]
Length=401

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINLY  609
            GDD++++KSGWDEYGIAYGRPS  I IRRVTG++ FSGI+ GSETSGGI D+L E+++++
Sbjct  222  GDDMIAIKSGWDEYGIAYGRPSSNIIIRRVTGTTGFSGIAFGSETSGGIRDILVENVSIF  281

Query  608  NIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  429
            N G GI +KTN GRGGII+NIT+S++Y+EN R  IK  GD GDHPD+++NP ALPIV+ I
Sbjct  282  NSGTGIRLKTNAGRGGIIQNITISDIYLENVRIAIKFTGDTGDHPDSQYNPQALPIVTKI  341

Query  428  KIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  249
             +++V GK +   G + GL++SPF  ICL+NI+L G  S     W+CS V GA++ V P 
Sbjct  342  AVKNVRGKNIHSVGSMDGLERSPFLDICLANINLQGTDS-----WQCSAVEGASVGVYPQ  396

Query  248  PCSEL  234
            PC +L
Sbjct  397  PCPQL  401



>gb|EMT32528.1| Putative polygalacturonase [Aegilops tauschii]
Length=443

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIA GRPS GITIRR+TGSSPF+G SVGSETSGG+ +VLAEH+N 
Sbjct  239  TGDDLIAIKSGWDEYGIACGRPSSGITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNF  298

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+ G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N +ALPIV  
Sbjct  299  YSSGFGVHIKTNSGRGGFIRNITVSDVVLDNVRYGLRIAGDVGGHPDERYNHSALPIVDS  358

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVH  276
            + I++V G+ + + G I+G+  S F+ ICLSNI L+G++  R  PWKC+  H
Sbjct  359  LTIKNVQGQNIKEAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCAAGH  408



>gb|AIU50428.1| pectin lyase-like superfamily protein, partial [Persea americana]
Length=190

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+VKSGWDEYGIAYGRPS+GITIRR+TGSSPFSGI++GSE SGG+++V AE+I L
Sbjct  47   TGDDLVAVKSGWDEYGIAYGRPSNGITIRRLTGSSPFSGIAIGSEASGGVLNVFAENITL  106

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N+GVGIH+KTNIGRGGII+NITV +V+M   R GIKIAGDVGDHPD++F+P ALP+VS 
Sbjct  107  FNMGVGIHVKTNIGRGGIIKNITVRDVHMHTVRKGIKIAGDVGDHPDDKFDPKALPVVS-  165

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPF  357
            I +++V G KV QPG ++GLK  PF
Sbjct  166  ITVKNVRGLKVLQPGLLQGLKDLPF  190



>gb|AIU50419.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
demersum]
Length=368

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV++KSGWD+YGIAYGRPS GITIRR+TGS+PF+GI++GSE SGG+ +VLAE + +
Sbjct  216  TGDDLVAIKSGWDQYGIAYGRPSSGITIRRLTGSTPFAGIAIGSEMSGGVENVLAEDVTI  275

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN G GI++KT IGRGGII+NITVS +Y+ N R  I+IAG+VGDHPD+ F+P+A+PIV+G
Sbjct  276  YNSGFGINLKTTIGRGGIIKNITVSGLYVANVRKAIRIAGNVGDHPDDGFDPDAVPIVNG  335

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNI  333
            I I+DV G  V QPG I G+K SPFT ICLSNI
Sbjct  336  ITIKDVRGVDVLQPGSIEGIKSSPFTQICLSNI  368



>gb|KHN38363.1| Putative polygalacturonase [Glycine soja]
Length=327

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDLV+ KSGWDEYGI YGRPS  ITIRRVTGSSPF+GI++GSETSGG+ +VL+EHINL
Sbjct  148  TGDDLVAEKSGWDEYGIVYGRPSSDITIRRVTGSSPFAGIAIGSETSGGVENVLSEHINL  207

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN+G+GIHIKTN GR G I+NIT+S+VYME AR GI+I+GDVGDHPD++++PNALP+V G
Sbjct  208  YNMGIGIHIKTNTGRAGYIKNITMSHVYMEEARKGIRISGDVGDHPDDKYDPNALPLVKG  267

Query  431  IKIQDVWGKK  402
            + I++VWG K
Sbjct  268  VTIKNVWGVK  277



>ref|XP_009387922.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 125/196 (64%), Gaps = 4/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPF-SGISVGSETSGGIVDVLAEHIN  615
            TGDDL+ +KSGWDEYGI+Y  PS  I+IRR+ G +   +GI+ GSE SGGI DV AE I+
Sbjct  249  TGDDLIVIKSGWDEYGISYAHPSSNISIRRIVGEAKSGAGIAFGSEMSGGISDVEAEDIS  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI IKT+ GRGG ++ I +SNV + N    I I G  G+HPD  F+PNALPI+ 
Sbjct  309  LFNSLYGIRIKTSPGRGGYVQYIHISNVVLNNVNIAIGITGQYGEHPDENFDPNALPIIK  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I ++D+ G  +   G + G++   F+ ICL N+HLN  SS    PW+CS + G++  VS
Sbjct  369  MITLEDIKGTNIKHAGTLEGIQGDNFSSICLFNVHLNVTSS---SPWQCSYIQGSSNLVS  425

Query  254  PWPCSELATNHRYGAC  207
            P  C  L   ++   C
Sbjct  426  PESCEPLRNPYQTSVC  441



>ref|XP_006584015.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=394

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 129/189 (68%), Gaps = 2/189 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHIN  615
            TG D +S+KSGWDEYGIAYGRP+  + IRRV   +S  S I+ GS+ SGGI ++L E+++
Sbjct  190  TGYDAISLKSGWDEYGIAYGRPTENVHIRRVHLQASSGSTIAFGSDMSGGISNILVENVH  249

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            LYN   GI  +T  GRGG ++ I +S++ MEN  T I   G  G HPD++F+PNALP++ 
Sbjct  250  LYNSKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAIAATGYCGSHPDDKFDPNALPLLD  309

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I +QD+ G  ++  G   GL++SPFT+ICLSNI L+  +S  + PW+CS+V G +  V 
Sbjct  310  HIILQDMIGTNITIAGSFAGLQESPFTNICLSNITLS-TNSVSSIPWECSNVSGFSDYVL  368

Query  254  PWPCSELAT  228
            P PC +L T
Sbjct  369  PKPCPDLET  377



>ref|XP_011040145.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=469

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD++++KSGWDEYG++YGRPS  ITIRR+ G +  +GI++GSE SGG+ +V AE++  
Sbjct  249  TGDDIIAIKSGWDEYGMSYGRPSKNITIRRLVGQTTSAGIAIGSEMSGGVSEVHAENLRF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI IKT+ GRGG +RNI +SN+ + + +T I+  G  G+HPD  ++P ALP++  
Sbjct  309  YNSTTGIRIKTSPGRGGYVRNIYISNMSLTDVKTAIRFTGQYGEHPDESYDPKALPLIER  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I DV G+ V   G + GL+   F  ICLSNI+L+  S     PW CS + G +  VSP
Sbjct  369  ITIDDVTGQNVKYAGLLEGLEGDTFLDICLSNINLSVTS---KSPWNCSYIQGYSEAVSP  425

Query  251  WPCSEL  234
              C  L
Sbjct  426  EICEPL  431



>ref|XP_006576262.1| PREDICTED: uncharacterized protein LOC100817309 isoform X1 [Glycine 
max]
Length=468

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 123/196 (63%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  I I R+ G +  SGI++GSE SGG+ +V AE I  
Sbjct  249  TGDDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+    I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  
Sbjct  309  YDSYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEK  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G+ +   G I G++   F +ICLSNI LN  S   N PW CS V G +  V P
Sbjct  369  ITIKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQP  425

Query  251  WPCSELATNHRYGACS  204
              C  L      G CS
Sbjct  426  EACEPLKERIFPGHCS  441



>ref|NP_001241086.1| uncharacterized protein LOC100817309 precursor [Glycine max]
 gb|ACU18828.1| unknown [Glycine max]
Length=467

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 123/196 (63%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  I I R+ G +  SGI++GSE SGG+ +V AE I  
Sbjct  249  TGDDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+    I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  
Sbjct  309  YDSYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEK  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G+ +   G I G++   F +ICLSNI LN  S   N PW CS V G +  V P
Sbjct  369  ITIKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQP  425

Query  251  WPCSELATNHRYGACS  204
              C  L      G CS
Sbjct  426  EACEPLKERIFPGHCS  441



>ref|XP_006576263.1| PREDICTED: uncharacterized protein LOC100817309 isoform X2 [Glycine 
max]
Length=463

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 123/196 (63%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  I I R+ G +  SGI++GSE SGG+ +V AE I  
Sbjct  249  TGDDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+    I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  
Sbjct  309  YDSYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEK  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G+ +   G I G++   F +ICLSNI LN  S   N PW CS V G +  V P
Sbjct  369  ITIKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQP  425

Query  251  WPCSELATNHRYGACS  204
              C  L      G CS
Sbjct  426  EACEPLKERIFPGHCS  441



>ref|XP_003626072.1| Polygalacturonase [Medicago truncatula]
 gb|AES82290.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGIA+GRPS  I I R+ G +  S GI++GSE SGG+ DV AE I+
Sbjct  249  TGDDLIAIKSGWDEYGIAFGRPSTNIVIHRLVGKTHTSAGIAIGSEMSGGVSDVRAEDIH  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             Y+    I IKT+ GRGG +RNI V+N+ + N    I+  G  GDHPD+ ++PNALP++ 
Sbjct  309  FYDSYTAIRIKTSPGRGGYVRNIYVTNMTLANVDIAIRFTGSYGDHPDDAYDPNALPVIE  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I+DV G+ +++ G I G++   F +ICLSNI LN +S   N PW CS++ G +  V 
Sbjct  369  KITIEDVIGENITKAGLIEGIEGDNFVNICLSNITLNVSS---NYPWNCSNIRGYSDMVF  425

Query  254  PWPCSEL  234
            P  C  L
Sbjct  426  PEACEPL  432



>gb|KHN02933.1| Putative polygalacturonase [Glycine soja]
Length=449

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 129/189 (68%), Gaps = 2/189 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHIN  615
            TG D +S+KSGWDEYGIAYGRP+  + IRRV   +S  S I+ GS+ SGGI ++L E+++
Sbjct  245  TGYDAISLKSGWDEYGIAYGRPTENVHIRRVHLQASSGSTIAFGSDMSGGISNILVENVH  304

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            LYN   GI  +T  GRGG ++ I +S++ MEN  T I   G  G HPD++F+PNALP++ 
Sbjct  305  LYNSKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAIAATGYCGSHPDDKFDPNALPLLD  364

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I +QD+ G  ++  G   GL++SPFT+ICLSNI L+  +S  + PW+CS+V G +  V 
Sbjct  365  HIILQDMIGTNITIAGSFAGLQESPFTNICLSNITLS-TNSVSSIPWECSNVSGFSDYVL  423

Query  254  PWPCSELAT  228
            P PC +L T
Sbjct  424  PKPCPDLET  432



>ref|XP_003528627.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=449

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 129/189 (68%), Gaps = 2/189 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHIN  615
            TG D +S+KSGWDEYGIAYGRP+  + IRRV   +S  S I+ GS+ SGGI ++L E+++
Sbjct  245  TGYDAISLKSGWDEYGIAYGRPTENVHIRRVHLQASSGSTIAFGSDMSGGISNILVENVH  304

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            LYN   GI  +T  GRGG ++ I +S++ MEN  T I   G  G HPD++F+PNALP++ 
Sbjct  305  LYNSKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAIAATGYCGSHPDDKFDPNALPLLD  364

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I +QD+ G  ++  G   GL++SPFT+ICLSNI L+  +S  + PW+CS+V G +  V 
Sbjct  365  HIILQDMIGTNITIAGSFAGLQESPFTNICLSNITLS-TNSVSSIPWECSNVSGFSDYVL  423

Query  254  PWPCSELAT  228
            P PC +L T
Sbjct  424  PKPCPDLET  432



>gb|KHN14175.1| Putative polygalacturonase [Glycine soja]
Length=489

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 123/196 (63%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  I I R+ G +  SGI++GSE SGG+ +V AE I  
Sbjct  271  TGDDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQF  330

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+    I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  
Sbjct  331  YDSYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEK  390

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G+ +   G I G++   F +ICLSNI LN  S   N PW CS V G +  V P
Sbjct  391  ITIKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQP  447

Query  251  WPCSELATNHRYGACS  204
              C  L      G CS
Sbjct  448  EACEPLKERIFPGHCS  463



>gb|KEH24447.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGIA+GRPS  I I R+ G +  S GI++GSE SGG+ DV AE I+
Sbjct  249  TGDDLIAIKSGWDEYGIAFGRPSTNIVIHRLVGKTHTSAGIAIGSEMSGGVSDVRAEDIH  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             Y+    I IKT+ GRGG +RNI V+N+ + N    I+  G  GDHPD+ ++PNALP++ 
Sbjct  309  FYDSYTAIRIKTSPGRGGYVRNIYVTNMTLANVDIAIRFTGSYGDHPDDAYDPNALPVIE  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I+DV G+ +++ G I G++   F +ICLSNI LN +S   N PW CS++ G +  V 
Sbjct  369  KITIEDVIGENITKAGLIEGIEGDNFVNICLSNITLNVSS---NYPWNCSNIRGYSDMVF  425

Query  254  PWPCSEL  234
            P  C  L
Sbjct  426  PEACEPL  432



>ref|XP_011079616.1| PREDICTED: probable polygalacturonase isoform X2 [Sesamum indicum]
Length=451

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D + +KSGWDEYGIAYG+P+  + IRRV   SS  SG++ GSE SGGI  VLAE++++
Sbjct  243  GYDAIVLKSGWDEYGIAYGKPTSHVHIRRVRLQSSSGSGLAFGSEMSGGISSVLAENLHV  302

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++  +G+ +KT  GRG  I++I VSNV+MEN + GIK+ G    HPD+ ++P+ALP+VS 
Sbjct  303  HDTLIGVELKTARGRGSYIQDIFVSNVHMENVQQGIKVTGQCTSHPDDGYDPHALPVVSD  362

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I   D+ G  ++  G   G+ +SPFT +CLSN+  N  + P    W C++V G+++ VSP
Sbjct  363  ITFMDIVGVNITTAGIFSGIDESPFTSLCLSNLSFNVTADPST-SWVCANVLGSSVNVSP  421

Query  251  WPCSEL  234
             PC EL
Sbjct  422  EPCPEL  427



>ref|XP_011079615.1| PREDICTED: probable polygalacturonase isoform X1 [Sesamum indicum]
Length=451

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D + +KSGWDEYGIAYG+P+  + IRRV   SS  SG++ GSE SGGI  VLAE++++
Sbjct  243  GYDAIVLKSGWDEYGIAYGKPTSHVHIRRVRLQSSSGSGLAFGSEMSGGISSVLAENLHV  302

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++  +G+ +KT  GRG  I++I VSNV+MEN + GIK+ G    HPD+ ++P+ALP+VS 
Sbjct  303  HDTLIGVELKTARGRGSYIQDIFVSNVHMENVQQGIKVTGQCTSHPDDGYDPHALPVVSD  362

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I   D+ G  ++  G   G+ +SPFT +CLSN+  N  + P    W C++V G+++ VSP
Sbjct  363  ITFMDIVGVNITTAGIFSGIDESPFTSLCLSNLSFNVTADPST-SWVCANVLGSSVNVSP  421

Query  251  WPCSEL  234
             PC EL
Sbjct  422  EPCPEL  427



>gb|EYU46764.1| hypothetical protein MIMGU_mgv1a0060621mg, partial [Erythranthe 
guttata]
Length=318

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 122/186 (66%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+Y + +  + IR+V   SS  S I+ GSE SGGI  +LAE+I +
Sbjct  109  GYDAVVLKSGWDEYGISYNKSTSHVHIRKVHLQSSSGSAIAFGSEMSGGISTILAENIYI  168

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++   GI +KT  GRGG +RNI VS VYMEN + GI + G    HPD++F+P ALPIVS 
Sbjct  169  HDSLTGIELKTAKGRGGYLRNILVSQVYMENVQQGINVTGQSTSHPDDKFDPQALPIVSD  228

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I   D+ G  ++  G   G+++SPFT  CLSN+  +  S P N  W CSDV G+++ VSP
Sbjct  229  ISFHDIIGLNITTAGIFSGIEESPFTSFCLSNVSFSVTSDPSN-SWVCSDVVGSSVNVSP  287

Query  251  WPCSEL  234
             PC EL
Sbjct  288  EPCPEL  293



>ref|XP_011005969.1| PREDICTED: probable polygalacturonase [Populus euphratica]
 ref|XP_011005971.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=465

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD++++KSGWDEYG++YGRPS  ITIRR+ G +  +GI++GSE SGG+ +V AE++  
Sbjct  249  TGDDIIAIKSGWDEYGMSYGRPSKNITIRRLVGQTTSAGIAIGSEMSGGVSEVHAENLRF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI IKT+ GRGG +RNI +SN+ + + +T I   G  G+HPD  ++P ALP++  
Sbjct  309  YNSTTGIRIKTSPGRGGYVRNIYISNMSLTDVKTAISFTGRYGEHPDEYYDPTALPLIER  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G+ V   G + G++   F  ICLSNI+L+  S     PW CS + G +  VSP
Sbjct  369  ITIEDVAGQNVKYAGLLEGIEGDTFLDICLSNINLSVTS---KSPWNCSYIQGYSDTVSP  425

Query  251  WPCSEL  234
              C  L
Sbjct  426  EICEPL  431



>ref|XP_009412155.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 127/196 (65%), Gaps = 4/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTG-SSPFSGISVGSETSGGIVDVLAEHIN  615
            TGDDL+ +KSGWDEYGI++ RPS  I+IR + G ++  +GI++GSE SGGI +V AE I 
Sbjct  252  TGDDLIVIKSGWDEYGISFARPSSNISIRHIVGEANSGAGIALGSEMSGGISNVRAEDIC  311

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI IKT+ GRGG +R+I +SNV M N +T I I G  G+HPD  ++PNALP++ 
Sbjct  312  LFNSLYGIRIKTSPGRGGYVRHIHISNVIMTNVKTAIGITGRYGEHPDENYDPNALPVID  371

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I+DV G  +   G + G+K   F  ICLSN+HLN  S     PWKCS + G +  V+
Sbjct  372  MITIEDVSGTVIKHAGTLEGIKGDNFNSICLSNVHLNVTS---KHPWKCSYIEGFSNLVT  428

Query  254  PWPCSELATNHRYGAC  207
            P  C  L   ++   C
Sbjct  429  PELCESLRNPYQSSVC  444



>emb|CAN69072.1| hypothetical protein VITISV_012807 [Vitis vinifera]
Length=111

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -3

Query  527  MENARTGIKIAGDVGDHPDNRFNPNALPIVSGIKIQDVWGKKVSQPGFIRGLKKSPFTHI  348
            ME ARTGIKIAGDVGDHPD+ FNPNALP+V G+ I+DVWG  V QPG I GLK SPFT I
Sbjct  1    MEKARTGIKIAGDVGDHPDDNFNPNALPVVKGVVIRDVWGLDVLQPGSIIGLKNSPFTGI  60

Query  347  CLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWPCSELATNHRYGACS  204
            CLS I+L+G   P   PWKCSDV GAA+ VSPWPCSEL +  + G+CS
Sbjct  61   CLSKINLHGKIKPGTAPWKCSDVSGAAVGVSPWPCSELTSPGQTGSCS  108



>ref|XP_003554577.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=467

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 121/186 (65%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  I I R+ G +  SGI++GSE SGG+ +V AE I  
Sbjct  249  TGDDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGKTQTSGIAIGSEMSGGVSEVHAEDIQF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+   GI IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ ++PNALP++  
Sbjct  309  YDSYNGIRIKTSPGRGGYVRNIYVSNVSLANVDIAIWFTGSYGEHPDDAYDPNALPVIEK  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DV G+ +   G I G++   F +ICLSNI LN  S   N PW CS V G +  V P
Sbjct  369  VTIKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQP  425

Query  251  WPCSEL  234
              C  L
Sbjct  426  EACEPL  431



>ref|XP_006604763.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=468

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 121/186 (65%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  I I R+ G +  SGI++GSE SGG+ +V AE I  
Sbjct  249  TGDDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGKTQTSGIAIGSEMSGGVSEVHAEDIQF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+   GI IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ ++PNALP++  
Sbjct  309  YDSYNGIRIKTSPGRGGYVRNIYVSNVSLANVDIAIWFTGSYGEHPDDAYDPNALPVIEK  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DV G+ +   G I G++   F +ICLSNI LN  S   N PW CS V G +  V P
Sbjct  369  VTIKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQP  425

Query  251  WPCSEL  234
              C  L
Sbjct  426  EACEPL  431



>ref|XP_009793676.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=462

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 124/186 (67%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+YG+P+  + IR V   SS  S ++ GSE SGGI +VL EHI+L
Sbjct  254  GYDAVVLKSGWDEYGISYGKPTSNVHIRGVRLQSSAGSAVAFGSEMSGGISNVLVEHISL  313

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++   GI +KT  GRGG I++I + NV MEN + GIK  G    HPD +++P++LP+VSG
Sbjct  314  HDSLFGIDLKTARGRGGYIKDILIMNVVMENVQVGIKATGYYDSHPDEKYDPSSLPVVSG  373

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  +S  G   GL +SPFT ICLSNI  + +S P   PW CSDV G++  V P
Sbjct  374  ITFKDIVGTNISIAGNFTGLSESPFTSICLSNISFSISSDPST-PWLCSDVSGSSENVFP  432

Query  251  WPCSEL  234
             PC EL
Sbjct  433  EPCPEL  438



>ref|XP_008227776.1| PREDICTED: probable polygalacturonase [Prunus mume]
 ref|XP_008227777.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=467

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 122/187 (65%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGI+YGRPS  I IRR+TG +  S GI++GSE SGG+ +V AE+++
Sbjct  250  TGDDLIAIKSGWDEYGISYGRPSRNIIIRRITGKTETSAGIAIGSEMSGGVSEVHAENLH  309

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             +N   GI IKT+ GRGG ++NI VSNV ++     I+     G+HPD  ++PNALPI+ 
Sbjct  310  FFNSKTGIRIKTSPGRGGYVKNIYVSNVTLDGIDIAIRFTSHYGEHPDEFYDPNALPIIE  369

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I  +DV GK +   G + GL+   F  ICLSNI LN  S     PW CS + G +  VS
Sbjct  370  QITFKDVVGKNIKTAGLLEGLEGDTFMDICLSNITLNVTS---KSPWICSSIQGYSDLVS  426

Query  254  PWPCSEL  234
            P  C  L
Sbjct  427  PETCEPL  433



>ref|XP_009784607.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana sylvestris]
Length=455

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+YG+P+  + +R V   S   +G++ GSE SGGI +VL EH+ L
Sbjct  248  GHDAVVLKSGWDEYGISYGKPTTNVHVRGVRLQSCAGAGLAFGSEMSGGISNVLVEHVYL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++   GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VSG
Sbjct  308  HDSLFGIELKTARGRGGYIKDIIVTDVVMANVQVGIEATGHCDSHPDEKFDPSALPVVSG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  +S  G   GL +SPFT ICLSN+  + +S+P   PW CS+++G++  VSP
Sbjct  368  ITFEDIVGTNISTAGNFSGLSESPFTSICLSNVTFSVSSNPT--PWLCSNIYGSSQNVSP  425

Query  251  WPCSEL  234
             PC EL
Sbjct  426  EPCPEL  431



>ref|XP_009784614.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana sylvestris]
Length=439

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+YG+P+  + +R V   S   +G++ GSE SGGI +VL EH+ L
Sbjct  232  GHDAVVLKSGWDEYGISYGKPTTNVHVRGVRLQSCAGAGLAFGSEMSGGISNVLVEHVYL  291

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++   GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VSG
Sbjct  292  HDSLFGIELKTARGRGGYIKDIIVTDVVMANVQVGIEATGHCDSHPDEKFDPSALPVVSG  351

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  +S  G   GL +SPFT ICLSN+  + +S+P   PW CS+++G++  VSP
Sbjct  352  ITFEDIVGTNISTAGNFSGLSESPFTSICLSNVTFSVSSNPT--PWLCSNIYGSSQNVSP  409

Query  251  WPCSEL  234
             PC EL
Sbjct  410  EPCPEL  415



>ref|XP_010909275.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
 ref|XP_010909282.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=438

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPF-SGISVGSETSGGIVDVLAEHIN  615
            TGDDL++VKSGWDEYGI++  PS  I+IRR+TG +   +GI+ GSE SGG+ +V AE I+
Sbjct  219  TGDDLIAVKSGWDEYGISFAHPSSNISIRRITGETKLGAGIAFGSEMSGGVSEVWAEDIH  278

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI IKT+ GRGG IRNI +S+V M+N    I+I G  G+HPD +++PNALPI++
Sbjct  279  LFNSKHGIRIKTSPGRGGYIRNIYISDVIMKNVDIAIRIQGQYGEHPDEKYDPNALPIIN  338

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I++V G  +   G + G+    F++ICLSNI LN  +SP   PW CS V G +  VS
Sbjct  339  RITIKNVAGANIRLAGLLEGIHGDNFSNICLSNIILN-VTSPH--PWNCSYVEGYSNMVS  395

Query  254  PWPCSEL  234
            P  C  L
Sbjct  396  PESCEPL  402



>ref|XP_007221479.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
 gb|EMJ22678.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
Length=467

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 121/187 (65%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGI+YGRPS  I IRR+ G +  S GI++GSE SGG+ +V AE+++
Sbjct  250  TGDDLIAIKSGWDEYGISYGRPSRNIIIRRIAGKTETSAGIAIGSEMSGGVSEVHAENLH  309

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             +N   GI IKT+ GRGG ++NI VSNV ++     I+     G+HPD  ++PNALPI+ 
Sbjct  310  FFNSKTGIRIKTSPGRGGYVKNIFVSNVTLDGIDIAIRFTSHYGEHPDEFYDPNALPIIE  369

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I  +D  GK +   G + GL+   F  ICLSNI LN  S     PWKCS + G +  VS
Sbjct  370  QITFKDFVGKNIKTAGLLEGLEGDTFLDICLSNITLNVTS---KSPWKCSSIQGYSDLVS  426

Query  254  PWPCSEL  234
            P  C  L
Sbjct  427  PETCEPL  433



>ref|XP_012083013.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 ref|XP_012083014.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 gb|KDP28345.1| hypothetical protein JCGZ_14116 [Jatropha curcas]
Length=466

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 122/187 (65%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGI+YGRP   I IRR+ G +  S G+S+GSE SGG+ +V AE++ 
Sbjct  249  TGDDLIAIKSGWDEYGISYGRPCRNIIIRRLIGQTRSSAGLSIGSEMSGGVSEVHAENLQ  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             YN   GI IKT+ GRGG +RNI VSN+ + + +  I+  G  G+HPD  ++P ALPIV 
Sbjct  309  FYNSSTGIRIKTSPGRGGYVRNIHVSNITLIDVKIAIRFTGLYGEHPDEHYDPAALPIVE  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I+DV G+ +   G + G++   F  ICLSNI LN  S   N PW CS V G +  VS
Sbjct  369  RITIEDVTGENIEYAGILDGIQADAFLDICLSNITLNVTS---NSPWNCSYVQGYSDSVS  425

Query  254  PWPCSEL  234
            P  C  L
Sbjct  426  PETCEPL  432



>ref|XP_002320934.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
 gb|EEE99249.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
Length=463

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 120/186 (65%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD++++KSGWDEYG +Y RPS  ITIR + G +  +GI++GSE SGG+ +V AE++  
Sbjct  249  TGDDIIAIKSGWDEYGTSYARPSKNITIRGLVGQTTSAGIAIGSEMSGGVSEVHAENLTF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI IKT  GRGG +RNI +SN+ + + +T I+  G  GDHPD  ++P ALP++  
Sbjct  309  YNSTTGIRIKTAPGRGGYVRNIYISNMSLTDVKTAIRFTGQYGDHPDESYDPKALPLIER  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I DV G+ V   G + GL+   F  ICLSNI+L+  S     PW CS + G +  VSP
Sbjct  369  ITIDDVTGQNVKYAGLLEGLEGDTFLDICLSNINLSVTS---KSPWNCSYIQGYSEAVSP  425

Query  251  WPCSEL  234
              C  L
Sbjct  426  EICEPL  431



>ref|XP_003550546.2| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=449

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 130/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHI  618
            TG D +S+KSGWDEYGIAYGRP+  + IRRV   + +SG  I+ GS+ SGGI ++L E++
Sbjct  245  TGYDAISLKSGWDEYGIAYGRPTENVHIRRVHLQA-YSGSTIAFGSDMSGGISNILVENV  303

Query  617  NLYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIV  438
            +LYN   GI  +T  GRGG ++ I +S++ MEN  T +   G  G HPD++F+PNALP++
Sbjct  304  HLYNSKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAMAATGYCGSHPDDKFDPNALPLL  363

Query  437  SGIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQV  258
              I +QD+ G  ++  G   GL++SPFT+ICLSN+ L+  +S  + PW+CS+V G +  V
Sbjct  364  DHIILQDMIGTNITIAGSFAGLQESPFTNICLSNVTLS-INSVSSIPWECSNVSGFSDSV  422

Query  257  SPWPCSELAT  228
             P PC +L T
Sbjct  423  LPKPCPDLET  432



>ref|XP_009624281.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=455

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 129/203 (64%), Gaps = 5/203 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+YG+P+  + +R V   S   +G++ GSE SGGI +VL EH+ L
Sbjct  248  GHDAVVLKSGWDEYGISYGKPTTSVHVRGVRLQSCAGAGLAFGSEMSGGISNVLVEHVYL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++   GI +KT  GRGG I++I V++V M N + GI   G    HPD +F+P+ALP+VSG
Sbjct  308  HDSLFGIELKTARGRGGYIKDIIVTDVVMANVQVGIDATGHCDSHPDEKFDPSALPVVSG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  +   G   GL +SPFT ICLSN+  + +S+P   PW CSD+ G++  VSP
Sbjct  368  ITFEDIVGTDIFTAGNFSGLSESPFTSICLSNVTFSVSSNPI--PWLCSDISGSSQNVSP  425

Query  251  WPCSELATNHR--YGACSATL*P  189
             PC EL  +       CSA L P
Sbjct  426  EPCPELQNSFSGTTSTCSALLYP  448



>gb|KEH43186.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=406

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 127/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWDEYGI++GRPS  I+I R+TG +  +GI++GSE SGG+ +V AE I +
Sbjct  184  TGDDLISIKSGWDEYGISFGRPSTNISIHRLTGRTTSAGIAIGSEMSGGVSEVYAEDIYI  243

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++    I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++ +ALP++  
Sbjct  244  FDSKSAIRIKTSPGRGGYVRNVYISNMTLINVDIAIRFTGLYGEHPDDSYDRDALPVIER  303

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I + +V G+ + + G I+G+K   F  ICLSNI LN +   +N PW CSDV G +  VSP
Sbjct  304  ITVVNVIGENIKRAGLIQGIKGDNFVDICLSNITLNVS---KNNPWNCSDVKGYSELVSP  360

Query  251  WPCSEL  234
              C +L
Sbjct  361  ESCEQL  366



>gb|KHN03332.1| Putative polygalacturonase [Glycine soja]
Length=460

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 130/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHI  618
            TG D +S+KSGWDEYGIAYGRP+  + IRRV   + +SG  I+ GS+ SGGI ++L E++
Sbjct  256  TGYDAISLKSGWDEYGIAYGRPTENVHIRRVHLQA-YSGSTIAFGSDMSGGISNILVENV  314

Query  617  NLYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIV  438
            +LYN   GI  +T  GRGG ++ I +S++ MEN  T +   G  G HPD++F+PNALP++
Sbjct  315  HLYNSKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAMAATGYCGSHPDDKFDPNALPLL  374

Query  437  SGIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQV  258
              I +QD+ G  ++  G   GL++SPFT+ICLSN+ L+  +S  + PW+CS+V G +  V
Sbjct  375  DHIILQDMIGTNITIAGSFAGLQESPFTNICLSNVTLS-INSVSSIPWECSNVSGFSDSV  433

Query  257  SPWPCSELAT  228
             P PC +L T
Sbjct  434  LPKPCPDLET  443



>gb|KHN43408.1| Putative polygalacturonase [Glycine soja]
Length=563

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 123/196 (63%), Gaps = 3/196 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+++KSGWDEYGIAYGRPS  I I R+ G +  SGI++GSE SGG+ +V AE I  
Sbjct  347  TGDDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGKTQTSGIAIGSEMSGGVSEVHAEDIQF  406

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+   GI IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ ++PNALP++  
Sbjct  407  YDSYNGIRIKTSPGRGGYVRNIYVSNVSLANVDIAIWFTGSYGEHPDDAYDPNALPVIEK  466

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            + I+DV G+ +   G I G++   F +ICLSNI LN  S   N PW CS V G +  V P
Sbjct  467  VTIKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQP  523

Query  251  WPCSELATNHRYGACS  204
              C  L        CS
Sbjct  524  EACEPLKERIFPDHCS  539



>gb|KEH37171.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=387

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 127/187 (68%), Gaps = 4/187 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWD+YGI YGRPS  + IRRV   + F+G  IS G+E SGGI  VL EH+N
Sbjct  179  GFDAISLKSGWDQYGINYGRPSEKVHIRRVHLRA-FTGSAISFGTEMSGGISKVLIEHVN  237

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            ++N   GI  +T  GRGG I+ I +S++ MEN  T I   G+ G HPD++F+P ALP++ 
Sbjct  238  IFNSNSGIEFRTTKGRGGYIKEIALSHIEMENVHTAISAKGNSGSHPDDKFDPKALPLLD  297

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I ++D+ GK ++  G + G+++SPFT+ICLSNI L+  +S  +  W+CS+V G +  V 
Sbjct  298  HITLKDITGKNITIAGSLSGIEESPFTNICLSNITLS-TNSVSSSKWECSNVSGFSDSVL  356

Query  254  PWPCSEL  234
            P PC EL
Sbjct  357  PKPCQEL  363



>ref|XP_010909269.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=467

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPF-SGISVGSETSGGIVDVLAEHIN  615
            TGDDL++VKSGWDEYGI++  PS  I+IRR+TG +   +GI+ GSE SGG+ +V AE I+
Sbjct  248  TGDDLIAVKSGWDEYGISFAHPSSNISIRRITGETKLGAGIAFGSEMSGGVSEVWAEDIH  307

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI IKT+ GRGG IRNI +S+V M+N    I+I G  G+HPD +++PNALPI++
Sbjct  308  LFNSKHGIRIKTSPGRGGYIRNIYISDVIMKNVDIAIRIQGQYGEHPDEKYDPNALPIIN  367

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I++V G  +   G + G+    F++ICLSNI LN  +SP   PW CS V G +  VS
Sbjct  368  RITIKNVAGANIRLAGLLEGIHGDNFSNICLSNIILN-VTSPH--PWNCSYVEGYSNMVS  424

Query  254  PWPCSEL  234
            P  C  L
Sbjct  425  PESCEPL  431



>ref|XP_007223360.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
 gb|EMJ24559.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
Length=452

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 121/186 (65%), Gaps = 3/186 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D +++KSGWDEYGIAYGRP+  + IRRV   SS  S ++ GSE SGGI DV  E +++
Sbjct  248  GYDAIALKSGWDEYGIAYGRPTTNVHIRRVYLQSSSGSSLAFGSEMSGGISDVFVEQVHI  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI  +T  GRGG IR I +S+V MEN       +G  G HPD++F+PNALP +  
Sbjct  308  YNSFSGIQFRTTKGRGGYIREIIISDVEMENIHMAFGASGQFGSHPDDKFDPNALPDLDH  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I +QDV G  ++  G   G+++SPFT  CLSNI L+  S   +P W+CS+V G++  V P
Sbjct  368  ITLQDVIGTNITIAGSFTGIQESPFTSFCLSNISLSANSG--SPTWECSNVSGSSDSVFP  425

Query  251  WPCSEL  234
             PCSE 
Sbjct  426  QPCSEF  431



>ref|XP_008223260.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=452

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 119/186 (64%), Gaps = 3/186 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D +++KSGWDEYGIAYGRP+  + IRRV   SS  S ++ GSE SGGI DV  E ++L
Sbjct  248  GYDAIALKSGWDEYGIAYGRPTTNVHIRRVYLQSSSGSSLAFGSEMSGGISDVFVEQVHL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI  +T  GRGG IR I +S+V MEN       +G  G HPD++F+PNALP +  
Sbjct  308  YNSFSGIQFRTTKGRGGYIREIIISDVEMENIHMAFGASGQFGSHPDDKFDPNALPDLDH  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I +QDV G  ++  G   G+++SPFT  CLSNI L+  S    P W CS+V G++  V P
Sbjct  368  ITLQDVIGTNITIAGSFTGIQESPFTSFCLSNISLSANSG--FPTWVCSNVSGSSYSVFP  425

Query  251  WPCSEL  234
             PCSE 
Sbjct  426  QPCSEF  431



>ref|XP_004487815.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=454

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWDEYG+ YGRP+  + IRRV   + FSG  +S GSE SGGI +VL EH+ 
Sbjct  244  GFDAISLKSGWDEYGLTYGRPTEKVHIRRVHLHA-FSGSALSFGSEMSGGISNVLVEHVK  302

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            ++N   GI  +T  GRGG I+ I +SN+ MEN  T I   GD G HPD++F+P A P+++
Sbjct  303  IFNSNSGIEFRTTKGRGGYIKEIAISNIEMENVYTAIGAKGDCGSHPDDKFDPKAFPLLN  362

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQV  258
             I ++D+ GK ++  G   G+K+SPFT+ICLSN+ L+  + SP    W+CS+V G +  V
Sbjct  363  HITLKDIIGKNITIAGSFEGIKESPFTNICLSNVTLSTNNVSPIT--WECSNVSGFSDSV  420

Query  257  SPWPCSEL  234
             P PC EL
Sbjct  421  LPEPCQEL  428



>ref|XP_008788175.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=468

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPF-SGISVGSETSGGIVDVLAEHIN  615
            TGDDL++VKSGWDEYGIA+  PS  I+IRR+TG +   +GI+ GSE SGG+ +V AE I+
Sbjct  249  TGDDLIAVKSGWDEYGIAFAHPSSNISIRRITGETKLGAGIAFGSEMSGGVSEVWAEDIH  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI IKT+ GRGG I+NI +S+V M+N    I+I G  G+HPD +++PNALP+++
Sbjct  309  LFNSKHGIRIKTSPGRGGYIQNIYISDVIMKNVDIAIRIQGQYGEHPDEKYDPNALPVIN  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I++V G  +   G + G+    F++ICLSN+ LN  +SP   PW CS V G +  VS
Sbjct  369  RITIKNVTGGNIRLAGLLEGIHGDNFSNICLSNVILN-VTSPN--PWNCSYVEGYSNMVS  425

Query  254  PWPCSEL  234
            P  C  L
Sbjct  426  PESCEPL  432



>ref|XP_004288344.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
Length=466

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 127/210 (60%), Gaps = 7/210 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+S+KSGWDEYGI+YGRPS  I IR +TG S  S GIS+GSE SGG+ +V AE++ 
Sbjct  259  TGDDLISIKSGWDEYGISYGRPSRNILIRGITGKSQTSAGISIGSEMSGGVSEVHAENLQ  318

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             +    GI IKT+ GRGG +RNI VSN+ ++     I+     G+HPD  ++P+ALPI+ 
Sbjct  319  FFGSHTGIRIKTSPGRGGYVRNICVSNMTLDGVYIAIRFTSQYGEHPDEFYDPSALPIIE  378

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I  +DV G  +   G + GL+   F +ICLSNI LN  S     PW CS +HG +  VS
Sbjct  379  HITFKDVLGDNIKIAGLLEGLEGGSFQNICLSNIFLNVTS---KSPWNCSSIHGYSYLVS  435

Query  254  PWPCSELATN---HRYGACSATL*PAKVDS  174
            P  C  L  +    +Y  C     P +  S
Sbjct  436  PEICEPLKESISPEKYSDCYHLSDPKRFSS  465



>ref|XP_010544930.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=261

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 119/181 (66%), Gaps = 2/181 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTG-SSPFSGISVGSETSGGIVDVLAEHIN  615
            TGDDLVS+KSGWDEYGI+Y RPS  I I R+TG ++  SGI++GSE SGG+ ++  E ++
Sbjct  41   TGDDLVSIKSGWDEYGISYARPSTRIKISRLTGQTTSSSGIAIGSEMSGGVSEIHVEDVH  100

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            LYN   GI IKT+ GRGG +RN+ VSNV +EN    I+  G  G+HPD +++P A P++ 
Sbjct  101  LYNSKTGIRIKTSPGRGGYVRNVYVSNVKLENVSIAIRFTGQYGEHPDGKYDPKAFPLIE  160

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I  ++  G  +   G  +G++   F +ICL N+ L   SS R  PWKCS V G +  VS
Sbjct  161  KITFENFTGDSIGVAGLFQGIEGDEFKNICLVNVSLQVKSS-RKSPWKCSYVRGYSQWVS  219

Query  254  P  252
            P
Sbjct  220  P  220



>ref|XP_011467185.1| PREDICTED: probable polygalacturonase isoform X2 [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 127/210 (60%), Gaps = 7/210 (3%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+S+KSGWDEYGI+YGRPS  I IR +TG S  S GIS+GSE SGG+ +V AE++ 
Sbjct  250  TGDDLISIKSGWDEYGISYGRPSRNILIRGITGKSQTSAGISIGSEMSGGVSEVHAENLQ  309

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             +    GI IKT+ GRGG +RNI VSN+ ++     I+     G+HPD  ++P+ALPI+ 
Sbjct  310  FFGSHTGIRIKTSPGRGGYVRNICVSNMTLDGVYIAIRFTSQYGEHPDEFYDPSALPIIE  369

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I  +DV G  +   G + GL+   F +ICLSNI LN  S     PW CS +HG +  VS
Sbjct  370  HITFKDVLGDNIKIAGLLEGLEGGSFQNICLSNIFLNVTS---KSPWNCSSIHGYSYLVS  426

Query  254  PWPCSELATN---HRYGACSATL*PAKVDS  174
            P  C  L  +    +Y  C     P +  S
Sbjct  427  PEICEPLKESISPEKYSDCYHLSDPKRFSS  456



>ref|XP_006355845.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=457

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+YG+P+  + +R V   S   +G++ GSE SGGI +VL EH+ L
Sbjct  248  GHDAVVLKSGWDEYGISYGKPTSNVHVRGVRLQSFAGAGMAFGSEMSGGISNVLVEHVYL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++  +GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VS 
Sbjct  308  HDSLLGIELKTARGRGGYIKDIQVTDVVMANVQVGIEATGHCDSHPDEKFDPSALPVVSD  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  VS  G   GL +SPFT ICLSNI  + +S+P   PW CSD+ G++  VSP
Sbjct  368  ITFEDIVGTNVSIAGNFTGLSESPFTSICLSNITFSISSNPFT-PWLCSDISGSSQNVSP  426

Query  251  WPCSEL  234
             PC EL
Sbjct  427  EPCPEL  432



>gb|KEH37170.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=452

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 127/190 (67%), Gaps = 10/190 (5%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-----TGSSPFSGISVGSETSGGIVDVLAE  624
            G D +S+KSGWD+YGI YGRPS  + IRRV     TGS+    IS G+E SGGI  VL E
Sbjct  244  GFDAISLKSGWDQYGINYGRPSEKVHIRRVHLRAFTGSA----ISFGTEMSGGISKVLIE  299

Query  623  HINLYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALP  444
            H+N++N   GI  +T  GRGG I+ I +S++ MEN  T I   G+ G HPD++F+P ALP
Sbjct  300  HVNIFNSNSGIEFRTTKGRGGYIKEIALSHIEMENVHTAISAKGNSGSHPDDKFDPKALP  359

Query  443  IVSGIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAI  264
            ++  I ++D+ GK ++  G + G+++SPFT+ICLSNI L+  +S  +  W+CS+V G + 
Sbjct  360  LLDHITLKDITGKNITIAGSLSGIEESPFTNICLSNITLS-TNSVSSSKWECSNVSGFSD  418

Query  263  QVSPWPCSEL  234
             V P PC EL
Sbjct  419  SVLPKPCQEL  428



>ref|XP_010649560.1| PREDICTED: probable polygalacturonase, partial [Vitis vinifera]
Length=285

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVT-GSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D +++KSGWDEYGIAYGRP+  + IRRV   SS  S ++ GSE SGGI +V  E ++L
Sbjct  76   GHDAIALKSGWDEYGIAYGRPTTNVHIRRVNLQSSSGSSLAFGSEMSGGISNVCVEQVHL  135

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI  +T  GRGG I+ I +S+V MEN  T     G +G HPD+ F+PNALP++  
Sbjct  136  YNSFSGIEFRTTKGRGGYIQEIIISDVAMENIHTAFSATGQIGSHPDDHFDPNALPVLDH  195

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I +Q+V G  ++  G   G+++SPFT ICLSNI L+  + P +  W CS+V G +  V P
Sbjct  196  ITLQNVIGTNITIAGSFTGIQESPFTSICLSNISLS-TTPPASISWVCSNVSGFSQWVFP  254

Query  251  WPC  243
             PC
Sbjct  255  EPC  257



>ref|XP_009624502.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=603

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+YG+P+  + IR V   SS  S ++ GSE SGGI +VL EHI+L
Sbjct  395  GYDAVVLKSGWDEYGISYGKPTSNVHIRGVRLQSSAGSAVAFGSEMSGGISNVLVEHISL  454

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++   GI +KT  GRGG IR+I + NV MEN + GI+  G    HPD +++P++LP+VSG
Sbjct  455  HDSLFGIDLKTARGRGGYIRDILIMNVVMENVQVGIRATGYYDSHPDEKYDPSSLPVVSG  514

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  +S  G   GL +SPFT ICLSNI  + +S P + PW CSDV G++  V P
Sbjct  515  ITFKDIVGTNISIAGNFTGLSESPFTSICLSNISFSISSDP-STPWLCSDVSGSSENVFP  573

Query  251  WPCSEL  234
             PC EL
Sbjct  574  EPCPEL  579



>ref|XP_007138953.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
 gb|ESW10947.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
Length=452

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 128/190 (67%), Gaps = 6/190 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWDEYGIAYGRP+  + IRRV   + FSG  ++ GS+ SGGI +VL EH +
Sbjct  244  GFDAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAH  302

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L     GI  +T  GRGG +++I +S++ MEN  T I   G+ G HPD++F+PNALP++ 
Sbjct  303  LLKSNSGIEFRTTRGRGGYMKDIVISDIQMENVHTAIAATGNCGSHPDDKFDPNALPLLD  362

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQV  258
             I ++DV GK ++  G   G+++SPFT+ICLSNI L+  S SP    W+CS+V G A  V
Sbjct  363  HITLRDVTGKNITIAGNFAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFADSV  420

Query  257  SPWPCSELAT  228
             P PC EL T
Sbjct  421  LPEPCPELGT  430



>gb|KHN14635.1| Putative polygalacturonase [Glycine soja]
Length=366

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 132/201 (66%), Gaps = 7/201 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWDEYGIAYGRP+  + IRRV   + FSG  ++ GS+ SGGI +VL EH +
Sbjct  158  GFDAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAH  216

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP + 
Sbjct  217  LFNSKSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLD  276

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQV  258
             I ++DV G  +S  G I G+++SPFT+ICLSNI L+  S SP    W+CS+V G +  V
Sbjct  277  HITLKDVTGTNISIAGNIAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFSDSV  334

Query  257  SPWPCSELATNHRYGACSATL  195
             P PC EL  N  Y + S+  
Sbjct  335  LPEPCPELG-NPSYDSSSSCF  354



>gb|AES61557.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=510

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 127/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWDEYGI++GRPS  I+I R+TG +  +GI++GSE SGG+ +V AE I +
Sbjct  288  TGDDLISIKSGWDEYGISFGRPSTNISIHRLTGRTTSAGIAIGSEMSGGVSEVYAEDIYI  347

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++    I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++ +ALP++  
Sbjct  348  FDSKSAIRIKTSPGRGGYVRNVYISNMTLINVDIAIRFTGLYGEHPDDSYDRDALPVIER  407

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I + +V G+ + + G I+G+K   F  ICLSNI LN +   +N PW CSDV G +  VSP
Sbjct  408  ITVVNVIGENIKRAGLIQGIKGDNFVDICLSNITLNVS---KNNPWNCSDVKGYSELVSP  464

Query  251  WPCSEL  234
              C +L
Sbjct  465  ESCEQL  470



>ref|XP_010094123.1| putative polygalacturonase [Morus notabilis]
 gb|EXC39742.1| putative polygalacturonase [Morus notabilis]
Length=476

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 127/192 (66%), Gaps = 4/192 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHIN  615
            TG D +S+KSGWDEYGI YGRP+  I IRRV   +S  + I+ GSE SGGI +VL EH++
Sbjct  267  TGYDSISLKSGWDEYGIDYGRPTKNIHIRRVDLRASSGASIAFGSEMSGGISNVLVEHVH  326

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            LYN   G+  +T  GRGG I NI +S+V M+N    +   G  G HPD++F+P+ALP++ 
Sbjct  327  LYNSHSGVEFRTTKGRGGYIENILISDVVMKNVYKALGACGQCGSHPDDKFDPSALPVLD  386

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLN-GASSPRNPPWKCSDVHGAAIQV  258
             I IQ+V+G  ++  G   G+K+SPFT ICL  I L+  + SP   PW+CSDV G++  V
Sbjct  387  HITIQNVFGTNITIAGSFVGIKESPFTSICLFKISLSINSGSPT--PWECSDVSGSSESV  444

Query  257  SPWPCSELATNH  222
             P PC EL  ++
Sbjct  445  LPEPCPELKNSY  456



>gb|ABG34277.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=242

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 115/187 (61%), Gaps = 1/187 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG-ISVGSETSGGIVDVLAEHIN  615
            +GDD V+VKSGWDEYGIA+G P+  + IRR+T  SP+S  I++GSE SGGI DV AE I 
Sbjct  21   SGDDCVAVKSGWDEYGIAFGMPTQQLIIRRLTCISPYSATIALGSEMSGGIRDVRAEDIV  80

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              N   GI IKT +GRG  I++I V  + M   +   K+ GD   HPDN+++PNALP++ 
Sbjct  81   AINTESGIRIKTAVGRGAYIKDIYVKKMTMHTMKWAFKMDGDYKSHPDNKYDPNALPVIQ  140

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I  +D+  + VS      G+    FT IC++N+ L   +  +  PW C+DV G    V+
Sbjct  141  NINYRDMVAENVSVAARFNGIAGDKFTGICMANVTLGMTAKHKKYPWTCTDVQGMTSGVT  200

Query  254  PWPCSEL  234
            P PC  L
Sbjct  201  PPPCDSL  207



>ref|XP_011463918.1| PREDICTED: probable polygalacturonase isoform X2 [Fragaria vesca 
subsp. vesca]
Length=467

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 127/217 (59%), Gaps = 3/217 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG-ISVGSETSGGIVDVLAEHIN  615
            +GDD ++VKSGWDEYGIA+G P+  + IRR+T  SPFS  I++GSE SGGI DV AE I 
Sbjct  246  SGDDCIAVKSGWDEYGIAFGMPTKALVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIF  305

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              N    + IKT +GRGG +++I V  + M   +    IAGD G H DN ++PNALP++ 
Sbjct  306  AINTESAVRIKTAVGRGGFVKDIYVRRMTMHTMKYVFWIAGDYGSHADNGYDPNALPVIQ  365

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I   D+  + V+  G + GL   PFT IC+SN+ +  A   +  PW C+DV G +  V 
Sbjct  366  NINYHDMVAENVTMAGKLGGLTGDPFTGICISNVTITMAKKGKKVPWNCTDVAGISSGVV  425

Query  254  PWPCSELATN--HRYGACSATL*PAKVDS*TAHLLLY  150
            P PC  LA     + GAC+       VD+    L  Y
Sbjct  426  PQPCELLADQGPEKIGACNFPEESLPVDNMQVQLCTY  462



>ref|XP_003591306.1| Polygalacturonase-like protein [Medicago truncatula]
Length=601

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 127/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWDEYGI++GRPS  I+I R+TG +  +GI++GSE SGG+ +V AE I +
Sbjct  379  TGDDLISIKSGWDEYGISFGRPSTNISIHRLTGRTTSAGIAIGSEMSGGVSEVYAEDIYI  438

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++    I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++ +ALP++  
Sbjct  439  FDSKSAIRIKTSPGRGGYVRNVYISNMTLINVDIAIRFTGLYGEHPDDSYDRDALPVIER  498

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I + +V G+ + + G I+G+K   F  ICLSNI LN +   +N PW CSDV G +  VSP
Sbjct  499  ITVVNVIGENIKRAGLIQGIKGDNFVDICLSNITLNVS---KNNPWNCSDVKGYSELVSP  555

Query  251  WPCSEL  234
              C +L
Sbjct  556  ESCEQL  561



>ref|XP_006386685.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 ref|XP_002301554.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|ERP64482.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|EEE80827.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
Length=449

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 121/180 (67%), Gaps = 3/180 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD++++KSGWDEYG++YGRPS  ITIRR+ G +  +GI++GSE SGG+ +V AE++  
Sbjct  249  TGDDIIAIKSGWDEYGMSYGRPSKNITIRRLVGQTTSAGIAIGSEMSGGVSEVHAENLRF  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            YN   GI IKT+ GRGG +RNI +SN+ + + +T I   G  G+HPD  ++P ALP++  
Sbjct  309  YNSTTGIRIKTSPGRGGYVRNIYISNMSLTDVKTAISFTGRYGEHPDEYYDPTALPLIER  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++DV G+ V   G + G++   F  ICL NI+L+  S     PW CS + G +  VSP
Sbjct  369  ITVEDVAGQNVKYAGLLEGIEGDTFLDICLLNINLSVTS---KSPWNCSYIQGYSDTVSP  425



>ref|XP_004298828.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 127/217 (59%), Gaps = 3/217 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG-ISVGSETSGGIVDVLAEHIN  615
            +GDD ++VKSGWDEYGIA+G P+  + IRR+T  SPFS  I++GSE SGGI DV AE I 
Sbjct  282  SGDDCIAVKSGWDEYGIAFGMPTKALVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIF  341

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              N    + IKT +GRGG +++I V  + M   +    IAGD G H DN ++PNALP++ 
Sbjct  342  AINTESAVRIKTAVGRGGFVKDIYVRRMTMHTMKYVFWIAGDYGSHADNGYDPNALPVIQ  401

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I   D+  + V+  G + GL   PFT IC+SN+ +  A   +  PW C+DV G +  V 
Sbjct  402  NINYHDMVAENVTMAGKLGGLTGDPFTGICISNVTITMAKKGKKVPWNCTDVAGISSGVV  461

Query  254  PWPCSELATN--HRYGACSATL*PAKVDS*TAHLLLY  150
            P PC  LA     + GAC+       VD+    L  Y
Sbjct  462  PQPCELLADQGPEKIGACNFPEESLPVDNMQVQLCTY  498



>ref|XP_010241442.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=391

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 122/187 (65%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSS-PFSGISVGSETSGGIVDVLAEHIN  615
            TGDDL+S+KSGWDEYGI+Y RPS  I IRR+ G +   SGI++GSE SGG+ +V AE + 
Sbjct  166  TGDDLISIKSGWDEYGISYARPSTNIIIRRIVGQTLSSSGIAIGSEMSGGVSEVHAEGLQ  225

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             +N   GI IKT  GRGG +RNI VS+V + + +  I+  G  G+HPD  ++PNALPI++
Sbjct  226  FFNSKTGIRIKTAPGRGGYVRNIYVSDVKLTDVKMAIRFTGQYGEHPDEFYDPNALPIIN  285

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             +  +D+ G  +S  G + G++   F +ICLSNI LN  S+    PWKCS + G +  V 
Sbjct  286  NVTFKDIRGDNISIAGLLEGVEGESFQNICLSNITLNVTST---SPWKCSFIKGYSDLVY  342

Query  254  PWPCSEL  234
            P  C  L
Sbjct  343  PETCEPL  349



>ref|XP_010652214.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=456

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 4/199 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D + +KSGWDEYGIAYG+P+  + IRRV   SS  SG++ GSE SGGI D+L EHI+L
Sbjct  248  GYDAIVLKSGWDEYGIAYGKPTRNVHIRRVWLQSSSGSGLAFGSEMSGGISDILVEHIHL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             +   GI +KT  GRGG I+ I +S+V MEN    I   G    HPD++++P ALP+V G
Sbjct  308  QDSSTGIKLKTTKGRGGYIKGILISDVEMENVGLTIGATGQCRSHPDDKYDPGALPVVDG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  VS  G   G+ +SPFT ICL NI L+  +S  + PW CS+V G++  VSP
Sbjct  368  ITFKDMVGTNVSIAGNFSGIYESPFTSICLFNISLS-ITSNSSKPWLCSNVFGSSECVSP  426

Query  251  WPCSELA--TNHRYGACSA  201
             PC  L   T++ +  CS+
Sbjct  427  EPCPNLQTKTSNSFSTCSS  445



>ref|XP_008780530.1| PREDICTED: probable polygalacturonase, partial [Phoenix dactylifera]
Length=213

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 124/187 (66%), Gaps = 1/187 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG-ISVGSETSGGIVDVLAEHIN  615
            +GDD +++KSGWDEYGIA+  P+  + IRR+T  SPFS  I++GSE SGGI DV AE+I 
Sbjct  22   SGDDCIAIKSGWDEYGIAFNMPTQHVNIRRLTCISPFSATIALGSEMSGGIQDVRAENIT  81

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              N   G+ IKT +GRGG +++I V  + +   +    ++G+ G HPD++++PNA+P+V 
Sbjct  82   AINTESGVRIKTAVGRGGFVKDIFVRGMTLNTMKYVFWMSGNYGQHPDDKYDPNAIPVVR  141

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I+  +V  + V+  G + G+  +PFT ICLSN+ ++ A S +   W C+++ G A  V+
Sbjct  142  NIRYSNVVAENVTIAGHLEGIPGAPFTGICLSNVTIDVAHSKKKLKWNCTEIEGVASAVT  201

Query  254  PWPCSEL  234
            P PC+ L
Sbjct  202  PTPCALL  208



>ref|XP_006597720.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=452

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 132/201 (66%), Gaps = 7/201 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWDEYGIAYGRP+  + IRRV   + FSG  ++ GS+ SGGI +VL EH +
Sbjct  244  GFDAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAH  302

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP + 
Sbjct  303  LFNSKSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLD  362

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQV  258
             I ++DV G  +S  G I G+++SPFT+ICLSNI L+  S SP    W+CS+V G +  V
Sbjct  363  HITLKDVTGTNISIAGNIAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFSDSV  420

Query  257  SPWPCSELATNHRYGACSATL  195
             P PC EL  N  Y + S+  
Sbjct  421  LPEPCPELG-NPSYDSSSSCF  440



>ref|XP_007154320.1| hypothetical protein PHAVU_003G108700g [Phaseolus vulgaris]
 gb|ESW26314.1| hypothetical protein PHAVU_003G108700g [Phaseolus vulgaris]
Length=449

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 128/189 (68%), Gaps = 2/189 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHIN  615
            TG D +++KSGWDEYGIAYGRP+  + IRRV   +S  S I+ GS+ SGGI ++L E+++
Sbjct  245  TGYDAIALKSGWDEYGIAYGRPTENVHIRRVHLQASSGSTIAFGSDMSGGISNILVENVH  304

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            LYN   GI  +T  GRGG ++ I +S + M N  T +   G  G HPD++F+PNALP++ 
Sbjct  305  LYNSRSGIEFRTMRGRGGYMKEIVISGIEMVNIYTAMAATGYCGSHPDDKFDPNALPLLD  364

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I +QD+ G  ++  G   GL++SPFT+ICLSNI+L+  +S  + PW+CS++ G +  V 
Sbjct  365  HIILQDMIGTNITIAGSFAGLQESPFTNICLSNINLS-INSVSSIPWECSNISGFSDSVL  423

Query  254  PWPCSELAT  228
            P PC +L T
Sbjct  424  PKPCPDLET  432



>ref|XP_004240577.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=457

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D V +KSGWDEYGI+YG+P+  + +R V   S   +G++ GSE SGGI +VL EH+ L
Sbjct  248  GHDAVVLKSGWDEYGISYGKPTSNVHVRGVRLQSFAGAGMAFGSEMSGGISNVLIEHVYL  307

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            Y+  +GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VSG
Sbjct  308  YDSLLGIELKTARGRGGYIKDILVTDVVMANVQVGIEATGHYDSHPDEKFDPSALPVVSG  367

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  VS  G   GL +SPFT ICLSNI  + + +P    W CSDV G +  VSP
Sbjct  368  ITFEDIVGTNVSIAGNFTGLSESPFTSICLSNITFSISYNPFT-SWLCSDVSGFSQNVSP  426

Query  251  WPCSEL  234
             PC EL
Sbjct  427  EPCPEL  432



>ref|XP_003535296.2| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN14231.1| Putative polygalacturonase [Glycine soja]
Length=464

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWD YGI++GRPS  I IRR+ G +  +GI++GSE SGG+ +V AE I +
Sbjct  249  TGDDLISIKSGWDGYGISFGRPSTNINIRRLIGKTTSAGIAIGSEMSGGVSEVHAEDIYI  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++    I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++P+ALP++  
Sbjct  309  FDSHSAIRIKTSPGRGGYVRNVYISNMILVNVDIAIRFTGLYGEHPDDTYDPDALPVIER  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G+KV + G I+G+K   F +ICLSNI LN +   +  PW CS V G +  VSP
Sbjct  369  ITIKDVIGEKVKRAGLIQGIKGDNFVNICLSNITLNVS---KKLPWNCSYVKGYSDLVSP  425

Query  251  WPCSEL  234
              C  L
Sbjct  426  EACEPL  431



>ref|XP_002535132.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF27252.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=476

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 120/187 (64%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGI YGRP   ITIRR+ G +  S GI++GSE SGG+ +V AE+I 
Sbjct  259  TGDDLIAIKSGWDEYGILYGRPCRNITIRRLVGQTRSSAGIAIGSEMSGGVSEVHAENIL  318

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             YN   GI IKT+ GRGG +RNI VSNV + +    I+  G+ G+HPD  ++P ALPI+ 
Sbjct  319  FYNSNTGIRIKTSPGRGGYVRNIYVSNVTLNDVNIAIRFTGNYGEHPDEHYDPKALPIIE  378

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I+ V G  +   G + G++   F +ICLSNI LN  S     PW CS + G +  VS
Sbjct  379  RITIEHVMGDNIKYAGILDGIEADSFVNICLSNISLNVTSK---FPWNCSYIQGYSESVS  435

Query  254  PWPCSEL  234
            P  C  L
Sbjct  436  PEICEPL  442



>ref|XP_006597719.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=471

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 132/201 (66%), Gaps = 7/201 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWDEYGIAYGRP+  + IRRV   + FSG  ++ GS+ SGGI +VL EH +
Sbjct  263  GFDAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAH  321

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP + 
Sbjct  322  LFNSKSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLD  381

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQV  258
             I ++DV G  +S  G I G+++SPFT+ICLSNI L+  S SP    W+CS+V G +  V
Sbjct  382  HITLKDVTGTNISIAGNIAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFSDSV  439

Query  257  SPWPCSELATNHRYGACSATL  195
             P PC EL  N  Y + S+  
Sbjct  440  LPEPCPELG-NPSYDSSSSCF  459



>gb|ERN03187.1| hypothetical protein AMTR_s00003p00141260 [Amborella trichopoda]
Length=471

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPF-SGISVGSETSGGIVDVLAEHINL  612
            G+D +++KSGWDEYGI+YG  + G+  RR+   +P  S +++G+E SGGI D+L EH+++
Sbjct  264  GNDAIALKSGWDEYGISYGASTSGVHARRLFLHAPMGSALALGTEMSGGISDILFEHLSI  323

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N   G+ + T  GRGG +R++ VSN+ MEN    ++  G+ G HPD+RFNP A P +S 
Sbjct  324  FNSRKGLSVATTKGRGGFVRDVLVSNIEMENVEVALRFDGNCGAHPDDRFNPEAFPAISR  383

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I ++++ G+K+   G + G++++PFT ICLSN+ L   S+  + PW CS+V G  + V P
Sbjct  384  ITVKNLVGQKIGLAGNLSGIEEAPFTAICLSNVSL---STNSDRPWACSNVVGYTLVVVP  440

Query  251  WPCSELATNH  222
              C EL T +
Sbjct  441  EACQELETQY  450



>emb|CBI36899.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 4/199 (2%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D + +KSGWDEYGIAYG+P+  + IRRV   SS  SG++ GSE SGGI D+L EHI+L
Sbjct  269  GYDAIVLKSGWDEYGIAYGKPTRNVHIRRVWLQSSSGSGLAFGSEMSGGISDILVEHIHL  328

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
             +   GI +KT  GRGG I+ I +S+V MEN    I   G    HPD++++P ALP+V G
Sbjct  329  QDSSTGIKLKTTKGRGGYIKGILISDVEMENVGLTIGATGQCRSHPDDKYDPGALPVVDG  388

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  VS  G   G+ +SPFT ICL NI L+  +S  + PW CS+V G++  VSP
Sbjct  389  ITFKDMVGTNVSIAGNFSGIYESPFTSICLFNISLS-ITSNSSKPWLCSNVFGSSECVSP  447

Query  251  WPCSELA--TNHRYGACSA  201
             PC  L   T++ +  CS+
Sbjct  448  EPCPNLQTKTSNSFSTCSS  466



>ref|XP_010241441.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=474

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 122/187 (65%), Gaps = 4/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSS-PFSGISVGSETSGGIVDVLAEHIN  615
            TGDDL+S+KSGWDEYGI+Y RPS  I IRR+ G +   SGI++GSE SGG+ +V AE + 
Sbjct  249  TGDDLISIKSGWDEYGISYARPSTNIIIRRIVGQTLSSSGIAIGSEMSGGVSEVHAEGLQ  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
             +N   GI IKT  GRGG +RNI VS+V + + +  I+  G  G+HPD  ++PNALPI++
Sbjct  309  FFNSKTGIRIKTAPGRGGYVRNIYVSDVKLTDVKMAIRFTGQYGEHPDEFYDPNALPIIN  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             +  +D+ G  +S  G + G++   F +ICLSNI LN  S+    PWKCS + G +  V 
Sbjct  369  NVTFKDIRGDNISIAGLLEGVEGESFQNICLSNITLNVTST---SPWKCSFIKGYSDLVY  425

Query  254  PWPCSEL  234
            P  C  L
Sbjct  426  PETCEPL  432



>ref|XP_004494475.1| PREDICTED: probable polygalacturonase-like isoform X2 [Cicer 
arietinum]
Length=466

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 121/187 (65%), Gaps = 3/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGIA+GRPS  I I R+ G +  S GI++GSE SGG+ +V AE I 
Sbjct  249  TGDDLIAIKSGWDEYGIAFGRPSTNIIIHRLVGKTHTSAGIAIGSEMSGGVSNVRAEDIR  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              +    I IKT  GRGG ++NI VSN+ + N    I+  G  GDHPD+ ++PNALP++ 
Sbjct  309  FDDSYTAIRIKTTPGRGGYVKNIYVSNMTLVNVDIAIRFTGLYGDHPDDGYDPNALPVIE  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I+DV G+ + + G I G++   F  ICLSNI LN  SS  N PW CS+V G +  V 
Sbjct  369  KITIKDVKGENIKKAGLIEGIEGDNFVDICLSNIILNNVSS--NYPWNCSNVRGYSDSVL  426

Query  254  PWPCSEL  234
            P  C  L
Sbjct  427  PEACEPL  433



>gb|ABG34278.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=307

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 120/186 (65%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDD++++KSGWDEYGI+YGRPS  I IRR+ G +  SGI++GSE SGG+ DV AE I  
Sbjct  88   TGDDVIAIKSGWDEYGISYGRPSKNIIIRRLIGETHSSGIAIGSEMSGGVSDVHAEDIVF  147

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N   GI IKT+ GRGG +RNI +SNV + N +  I+  G  G+HPD  ++P A+P +  
Sbjct  148  FNSTTGIRIKTSPGRGGYVRNIFISNVSLANVKVAIRFTGRYGEHPDESYDPKAMPKIER  207

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G+ ++  G + G++   F +ICL NI L+  S     PW CS+V G +  V P
Sbjct  208  ITFKDIHGENITVAGLMEGIEGDNFINICLYNITLSVNSI---SPWNCSNVQGFSSLVFP  264

Query  251  WPCSEL  234
              C  L
Sbjct  265  QTCELL  270



>gb|ABG34275.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=238

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 118/187 (63%), Gaps = 1/187 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG-ISVGSETSGGIVDVLAEHIN  615
            +GDD V+VKSGWDEYGI+YG P+  + IRR+T  SP+S  I++GSE SGGI DV AE I 
Sbjct  21   SGDDCVAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIALGSEMSGGIEDVRAEDIT  80

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              N   GI IKT +GRGG +++I V  + M   +    + G+ G HPD  ++P A PI++
Sbjct  81   AINTESGIRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNYGSHPDPHYDPKARPIIT  140

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
            GI  +D+  + V+    ++G+  +PFT IC+SN  +  A   +  PW CSD+HG    V+
Sbjct  141  GINYRDIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESKKEPWTCSDIHGITSGVT  200

Query  254  PWPCSEL  234
            P PC  L
Sbjct  201  PQPCGML  207



>ref|XP_009607671.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=472

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 121/187 (65%), Gaps = 1/187 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG-ISVGSETSGGIVDVLAEHIN  615
            +GDD ++VKSGWDEYGIA+G P+  + IRR+T  SP S  I++GSE SGGI DV AE+I 
Sbjct  256  SGDDCIAVKSGWDEYGIAFGMPTQHLIIRRLTCISPDSAVIALGSEMSGGIQDVRAENIT  315

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              +   G+ IKT IGRG  ++++ V  + ++  +    + GD G HPD+ F+P ALP++ 
Sbjct  316  AISSESGVRIKTAIGRGAYVKDVFVKGMTLQTMKYTFWMTGDYGSHPDDHFDPKALPVIQ  375

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
            GI  +DV  K V+  G + G+K   F+ IC+SN+ +  +   +  PW CSD+ G + QVS
Sbjct  376  GINFRDVVSKNVTIAGKLVGIKNDTFSGICISNVSIELSEHAKKQPWNCSDIQGVSSQVS  435

Query  254  PWPCSEL  234
            P PC+ L
Sbjct  436  PQPCALL  442



>ref|XP_004494474.1| PREDICTED: probable polygalacturonase-like isoform X1 [Cicer 
arietinum]
Length=467

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 121/187 (65%), Gaps = 3/187 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFS-GISVGSETSGGIVDVLAEHIN  615
            TGDDL+++KSGWDEYGIA+GRPS  I I R+ G +  S GI++GSE SGG+ +V AE I 
Sbjct  249  TGDDLIAIKSGWDEYGIAFGRPSTNIIIHRLVGKTHTSAGIAIGSEMSGGVSNVRAEDIR  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
              +    I IKT  GRGG ++NI VSN+ + N    I+  G  GDHPD+ ++PNALP++ 
Sbjct  309  FDDSYTAIRIKTTPGRGGYVKNIYVSNMTLVNVDIAIRFTGLYGDHPDDGYDPNALPVIE  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I I+DV G+ + + G I G++   F  ICLSNI LN  SS  N PW CS+V G +  V 
Sbjct  369  KITIKDVKGENIKKAGLIEGIEGDNFVDICLSNIILNNVSS--NYPWNCSNVRGYSDSVL  426

Query  254  PWPCSEL  234
            P  C  L
Sbjct  427  PEACEPL  433



>gb|KHN00242.1| Putative polygalacturonase [Glycine soja]
Length=472

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWD YGI++GRPS  I IRR+ G +  +GI++GSE SGG+ +V AE I +
Sbjct  257  TGDDLISIKSGWDGYGISFGRPSTNINIRRLIGKTTSAGIAIGSEMSGGVSEVHAEDIYI  316

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++    I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++P+ALP++  
Sbjct  317  FDSHSAIRIKTSPGRGGYVRNVYISNMILANVDIAIRFTGLYGEHPDDTYDPDALPVIER  376

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G KV   G I+G+K   F +ICLSNI LN +S     PW CS + G +  VSP
Sbjct  377  ITIKDVIGVKVKHAGLIQGIKGDNFVNICLSNITLNVSSK---LPWNCSYIKGFSDLVSP  433

Query  251  WPCSEL  234
              C  L
Sbjct  434  EACEPL  439



>ref|XP_003533248.1| PREDICTED: probable polygalacturonase isoform X1 [Glycine max]
Length=452

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 130/201 (65%), Gaps = 7/201 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWDEYGIAYGRP+  + IRRV   + FSG  ++ GS+ SGGI +VL EH +
Sbjct  244  GFDAISLKSGWDEYGIAYGRPTENVHIRRVQLHA-FSGSALAFGSDMSGGISNVLVEHAH  302

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP + 
Sbjct  303  LFNSNSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLD  362

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQV  258
             I ++DV G  ++  G + G+ +SPFT+ICLSNI L+  S SP    W CS+V G +  V
Sbjct  363  HITLKDVIGTNITIAGNLAGIDESPFTNICLSNITLSTNSVSPIT--WACSNVSGFSDSV  420

Query  257  SPWPCSELATNHRYGACSATL  195
             P PC EL  N  Y + S+  
Sbjct  421  LPEPCPELG-NTSYDSSSSCF  440



>ref|XP_003519731.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=464

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSGISVGSETSGGIVDVLAEHINL  612
            TGDDL+S+KSGWD YGI++GRPS  I IRR+ G +  +GI++GSE SGG+ +V AE I +
Sbjct  249  TGDDLISIKSGWDGYGISFGRPSTNINIRRLIGKTTSAGIAIGSEMSGGVSEVHAEDIYI  308

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            ++    I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++P+ALP++  
Sbjct  309  FDSHSAIRIKTSPGRGGYVRNVYISNMILANVDIAIRFTGLYGEHPDDTYDPDALPVIER  368

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I I+DV G KV   G I+G+K   F +ICLSNI LN +S     PW CS + G +  VSP
Sbjct  369  ITIKDVIGVKVKHAGLIQGIKGDNFVNICLSNITLNVSSK---LPWNCSYIKGFSDLVSP  425

Query  251  WPCSEL  234
              C  L
Sbjct  426  EACEPL  431



>ref|XP_004134229.1| PREDICTED: probable polygalacturonase isoform X2 [Cucumis sativus]
 ref|XP_011651066.1| PREDICTED: probable polygalacturonase isoform X2 [Cucumis sativus]
 gb|KGN57141.1| hypothetical protein Csa_3G165090 [Cucumis sativus]
Length=457

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 129/199 (65%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHIN  615
            TG D +++KSGWD+YGIAYGRPS  I IRRV   SS  S I+ GSE SGGI +VL EH+ 
Sbjct  248  TGYDAIALKSGWDQYGIAYGRPSKNIHIRRVHLQSSSGSSIAFGSEMSGGISNVLVEHVQ  307

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L N  +GI I+T  GRGG I+ I VS+V MEN  T    +G  G HPD+ ++PNALPIV 
Sbjct  308  LNNSFIGIQIRTTKGRGGYIKGIVVSDVEMENISTAFSASGHFGSHPDDEYDPNALPIVQ  367

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I +Q+V G  +   G   G+++SPFT I LSNI  +  SS  +  W CSDV G +  V 
Sbjct  368  DITLQNVRGTNIKIAGNFSGIQESPFTSIYLSNITFSINSS-SSTSWICSDVSGFSESVI  426

Query  254  PWPCSELATNHRYGACSAT  198
            P PCS+L+T +   + +A+
Sbjct  427  PPPCSDLSTPYSISSSAAS  445



>ref|XP_011651065.1| PREDICTED: probable polygalacturonase isoform X1 [Cucumis sativus]
Length=458

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 129/199 (65%), Gaps = 2/199 (1%)
 Frame = -3

Query  791  TGDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHIN  615
            TG D +++KSGWD+YGIAYGRPS  I IRRV   SS  S I+ GSE SGGI +VL EH+ 
Sbjct  249  TGYDAIALKSGWDQYGIAYGRPSKNIHIRRVHLQSSSGSSIAFGSEMSGGISNVLVEHVQ  308

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L N  +GI I+T  GRGG I+ I VS+V MEN  T    +G  G HPD+ ++PNALPIV 
Sbjct  309  LNNSFIGIQIRTTKGRGGYIKGIVVSDVEMENISTAFSASGHFGSHPDDEYDPNALPIVQ  368

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVS  255
             I +Q+V G  +   G   G+++SPFT I LSNI  +  SS  +  W CSDV G +  V 
Sbjct  369  DITLQNVRGTNIKIAGNFSGIQESPFTSIYLSNITFSINSS-SSTSWICSDVSGFSESVI  427

Query  254  PWPCSELATNHRYGACSAT  198
            P PCS+L+T +   + +A+
Sbjct  428  PPPCSDLSTPYSISSSAAS  446



>gb|KHN26517.1| Putative polygalacturonase [Glycine soja]
Length=473

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 130/201 (65%), Gaps = 7/201 (3%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRVTGSSPFSG--ISVGSETSGGIVDVLAEHIN  615
            G D +S+KSGWDEYGIAYGRP+  + IRRV   + FSG  ++ GS+ SGGI +VL EH +
Sbjct  265  GFDAISLKSGWDEYGIAYGRPTENVHIRRVQLHA-FSGSALAFGSDMSGGISNVLVEHAH  323

Query  614  LYNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVS  435
            L+N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP + 
Sbjct  324  LFNSNSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLD  383

Query  434  GIKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQV  258
             I ++DV G  ++  G + G+ +SPFT+ICLSNI L+  S SP    W CS+V G +  V
Sbjct  384  HITLKDVIGTNITIAGNLAGIDESPFTNICLSNITLSTNSVSPIT--WACSNVSGFSDSV  441

Query  257  SPWPCSELATNHRYGACSATL  195
             P PC EL  N  Y + S+  
Sbjct  442  LPEPCPELG-NTSYDSSSSCF  461



>emb|CDP17099.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = -3

Query  788  GDDLVSVKSGWDEYGIAYGRPSHGITIRRV-TGSSPFSGISVGSETSGGIVDVLAEHINL  612
            G D +++KSGWDEYGIAYG+P+  + IR +   S   SG++ GSE SGGI ++L EH+++
Sbjct  255  GYDAITLKSGWDEYGIAYGKPTTNVHIRGIRLQSGTGSGVAFGSEMSGGISNILVEHLDI  314

Query  611  YNIGVGIHIKTnigrggiirnITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSG  432
            +N  VGI +KT+IGRGG I+ I +S+V MEN + G+K  G    HPD++F+P ALP +S 
Sbjct  315  HNSFVGIELKTSIGRGGYIKYILISDVIMENVQIGLKATGQCDSHPDDKFDPLALPTISA  374

Query  431  IKIQDVWGKKVSQPGFIRGLKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  252
            I  +D+ G  ++  G   G+ +SPFT +CLSNI  +  S P +  W CS V G++  VSP
Sbjct  375  ITFEDIRGTNITVAGSFTGINESPFTSLCLSNISFSVTSDP-SASWICSSVSGSSDNVSP  433

Query  251  WPCSEL  234
             PC +L
Sbjct  434  EPCPDL  439



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1614230233668