BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12656

Length=874
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN68643.1|  hypothetical protein VITISV_030810                     304   1e-96   Vitis vinifera
ref|XP_002264678.3|  PREDICTED: beta-glucosidase 46-like                304   1e-95   Vitis vinifera
emb|CBI23186.3|  unnamed protein product                                303   3e-95   Vitis vinifera
gb|KDO75513.1|  hypothetical protein CISIN_1g0095352mg                  297   2e-94   Citrus sinensis [apfelsine]
gb|KDO75512.1|  hypothetical protein CISIN_1g0095352mg                  296   4e-94   Citrus sinensis [apfelsine]
ref|XP_006449067.1|  hypothetical protein CICLE_v100148872mg            295   3e-93   
ref|XP_007026017.1|  Beta glucosidase 46 isoform 1                      297   3e-93   
ref|XP_006468004.1|  PREDICTED: beta-glucosidase 46-like                298   5e-93   
ref|XP_007026020.1|  Beta glucosidase 46, putative                      292   4e-91   
gb|KJB67164.1|  hypothetical protein B456_010G178800                    291   5e-91   Gossypium raimondii
ref|XP_006449069.1|  hypothetical protein CICLE_v10017801mg             288   1e-89   
ref|XP_011037697.1|  PREDICTED: beta-glucosidase 46-like                288   1e-89   Populus euphratica
ref|XP_002305597.2|  glycosyl hydrolase family 1 family protein         288   1e-89   
gb|KHG24858.1|  Beta-glucosidase 46 -like protein                       284   2e-89   Gossypium arboreum [tree cotton]
ref|XP_010101461.1|  Beta-glucosidase 47                                280   7e-89   
gb|KHG29723.1|  Beta-glucosidase 46                                     286   8e-89   Gossypium arboreum [tree cotton]
ref|XP_008384040.1|  PREDICTED: beta-glucosidase 47-like isoform X2     284   3e-88   
ref|XP_002304950.2|  hypothetical protein POPTR_0004s01900g             284   3e-88   
ref|XP_006468000.1|  PREDICTED: beta-glucosidase 47-like isoform X1     284   4e-88   
ref|XP_008384039.1|  PREDICTED: beta-glucosidase 47-like isoform X1     284   4e-88   
gb|KJB67161.1|  hypothetical protein B456_010G178500                    284   5e-88   Gossypium raimondii
gb|KJB69320.1|  hypothetical protein B456_011G016100                    289   5e-88   Gossypium raimondii
ref|XP_009363823.1|  PREDICTED: beta-glucosidase 45-like isoform X2     283   5e-88   
ref|XP_009363745.1|  PREDICTED: beta-glucosidase 46-like isoform X1     283   9e-88   Pyrus x bretschneideri [bai li]
ref|XP_008364100.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    282   2e-87   
ref|XP_004293271.1|  PREDICTED: beta-glucosidase 47                     280   8e-87   Fragaria vesca subsp. vesca
gb|KCW75357.1|  hypothetical protein EUGRSUZ_E04103                     280   1e-86   Eucalyptus grandis [rose gum]
ref|XP_010057964.1|  PREDICTED: beta-glucosidase 46 isoform X3          280   1e-86   Eucalyptus grandis [rose gum]
ref|XP_008224799.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    280   1e-86   Prunus mume [ume]
ref|XP_008384043.1|  PREDICTED: beta-glucosidase 47-like                278   9e-86   
gb|KHG29724.1|  Beta-glucosidase 46                                     268   2e-85   Gossypium arboreum [tree cotton]
ref|XP_010267720.1|  PREDICTED: beta-glucosidase 46 isoform X3          277   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_010267719.1|  PREDICTED: beta-glucosidase 46 isoform X2          277   3e-85   Nelumbo nucifera [Indian lotus]
ref|XP_010057961.1|  PREDICTED: beta-glucosidase 46 isoform X1          276   3e-85   Eucalyptus grandis [rose gum]
gb|KHG29721.1|  Beta-glucosidase 46                                     276   9e-85   Gossypium arboreum [tree cotton]
ref|XP_008224797.1|  PREDICTED: beta-glucosidase 47-like                275   2e-84   Prunus mume [ume]
ref|XP_007211830.1|  hypothetical protein PRUPE_ppa004523mg             274   2e-84   
ref|XP_007212382.1|  hypothetical protein PRUPE_ppa005194mg             273   2e-84   
ref|XP_002304951.2|  glycosyl hydrolase family 1 family protein         274   2e-84   Populus trichocarpa [western balsam poplar]
ref|XP_004486131.1|  PREDICTED: beta-glucosidase 47-like                273   3e-84   
ref|XP_002305594.1|  glycosyl hydrolase family 1 family protein         273   3e-84   
ref|XP_007026016.1|  Beta-glucosidase 47 isoform 2                      271   3e-84   
ref|XP_007026015.1|  Beta-glucosidase 47 isoform 1                      271   4e-84   
gb|KEH36818.1|  glycoside hydrolase family 1 protein                    269   1e-83   Medicago truncatula
ref|XP_011037693.1|  PREDICTED: beta-glucosidase 46-like                272   2e-83   Populus euphratica
ref|XP_011037696.1|  PREDICTED: beta-glucosidase 47-like                271   5e-83   Populus euphratica
gb|AFK46781.1|  unknown                                                 270   1e-82   Medicago truncatula
ref|XP_003610400.1|  Beta-glucosidase                                   270   1e-82   
ref|XP_010267718.1|  PREDICTED: beta-glucosidase 46 isoform X1          277   1e-82   Nelumbo nucifera [Indian lotus]
gb|KEH36817.1|  glycoside hydrolase family 1 protein                    269   2e-82   Medicago truncatula
ref|XP_006468001.1|  PREDICTED: beta-glucosidase 47-like isoform X2     267   7e-82   
ref|XP_011037698.1|  PREDICTED: beta-glucosidase 46-like                264   7e-82   Populus euphratica
ref|XP_003529622.1|  PREDICTED: beta-glucosidase 46                     267   2e-81   Glycine max [soybeans]
ref|XP_002518516.1|  beta-glucosidase, putative                         266   2e-81   Ricinus communis
gb|AFK44109.1|  unknown                                                 266   2e-81   Medicago truncatula
gb|KHN33045.1|  Beta-glucosidase 47                                     266   2e-81   Glycine soja [wild soybean]
ref|XP_007147745.1|  hypothetical protein PHAVU_006G151400g             264   4e-81   Phaseolus vulgaris [French bean]
ref|XP_008441244.1|  PREDICTED: beta-glucosidase 47                     265   7e-81   Cucumis melo [Oriental melon]
ref|XP_009137214.1|  PREDICTED: beta-glucosidase 47-like                265   8e-81   Brassica rapa
ref|XP_004508228.1|  PREDICTED: uncharacterized protein LOC101501316    274   2e-80   
ref|XP_010665547.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    265   2e-80   
emb|CDX98704.1|  BnaA03g44890D                                          263   2e-80   
emb|CDY68226.1|  BnaCnng58130D                                          260   9e-80   Brassica napus [oilseed rape]
ref|XP_011652764.1|  PREDICTED: beta-glucosidase 47                     262   9e-80   Cucumis sativus [cucumbers]
ref|XP_009135228.1|  PREDICTED: beta-glucosidase 47 isoform X3          261   1e-79   Brassica rapa
ref|XP_006343294.1|  PREDICTED: beta-glucosidase 47-like                261   2e-79   
ref|XP_009135219.1|  PREDICTED: beta-glucosidase 47 isoform X2          261   2e-79   Brassica rapa
emb|CDO99725.1|  unnamed protein product                                261   2e-79   Coffea canephora [robusta coffee]
ref|XP_009135212.1|  PREDICTED: beta-glucosidase 47 isoform X1          261   2e-79   Brassica rapa
gb|KHG29722.1|  Beta-glucosidase 46                                     262   3e-79   Gossypium arboreum [tree cotton]
ref|XP_003547247.2|  PREDICTED: beta-glucosidase 47-like                268   5e-79   Glycine max [soybeans]
ref|XP_007026018.1|  Beta glucosidase 46 isoform 2                      259   1e-78   
ref|XP_006391958.1|  hypothetical protein EUTSA_v10024134mg             259   1e-78   Eutrema salsugineum [saltwater cress]
ref|XP_003610399.1|  Glucose-6-phosphate/phosphate translocator         268   2e-78   
gb|ACJ83780.1|  unknown                                                 250   2e-78   Medicago truncatula
emb|CDX94055.1|  BnaC07g36890D                                          259   2e-78   
gb|AES92596.2|  glucose 6-phosphate/phosphate translocator 1            268   2e-78   Medicago truncatula
emb|CDX98706.1|  BnaA03g44910D                                          252   2e-78   
ref|XP_004234482.1|  PREDICTED: beta-glucosidase 46-like                258   3e-78   Solanum lycopersicum
gb|KFK28775.1|  hypothetical protein AALP_AA7G045800                    257   4e-78   Arabis alpina [alpine rockcress]
ref|XP_007026019.1|  Beta glucosidase 46 isoform 3                      258   4e-78   
ref|XP_009770584.1|  PREDICTED: beta-glucosidase 18-like                258   5e-78   Nicotiana sylvestris
gb|KEH36812.1|  glycoside hydrolase family 1 protein                    254   1e-77   Medicago truncatula
ref|XP_006413734.1|  hypothetical protein EUTSA_v10024896mg             257   1e-77   
ref|XP_009137215.1|  PREDICTED: beta-glucosidase 47-like                256   2e-77   Brassica rapa
ref|XP_009105752.1|  PREDICTED: beta-glucosidase 45-like                256   2e-77   Brassica rapa
ref|XP_010430203.1|  PREDICTED: beta-glucosidase 45-like                256   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009794795.1|  PREDICTED: beta-glucosidase 46-like                247   2e-77   Nicotiana sylvestris
emb|CDY47163.1|  BnaA01g22890D                                          255   5e-77   Brassica napus [oilseed rape]
ref|XP_007153925.1|  hypothetical protein PHAVU_003G076700g             254   1e-76   Phaseolus vulgaris [French bean]
gb|KEH36806.1|  glycoside hydrolase family 1 protein                    254   1e-76   Medicago truncatula
ref|XP_006301036.1|  hypothetical protein CARUB_v10021428mg             254   1e-76   Capsella rubella
ref|XP_007147744.1|  hypothetical protein PHAVU_006G151300g             254   2e-76   Phaseolus vulgaris [French bean]
ref|XP_006348092.1|  PREDICTED: beta-glucosidase 47-like                254   2e-76   Solanum tuberosum [potatoes]
ref|XP_010418158.1|  PREDICTED: beta-glucosidase 45-like                253   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010273571.1|  PREDICTED: beta-glucosidase 18-like                253   3e-76   Nelumbo nucifera [Indian lotus]
ref|XP_006391959.1|  hypothetical protein EUTSA_v10023411mg             253   4e-76   Eutrema salsugineum [saltwater cress]
ref|XP_011628484.1|  PREDICTED: beta-glucosidase 18                     252   6e-76   Amborella trichopoda
ref|XP_009599228.1|  PREDICTED: beta-glucosidase 18-like                248   8e-76   Nicotiana tomentosiformis
ref|XP_009617373.1|  PREDICTED: beta-glucosidase 18-like                252   9e-76   Nicotiana tomentosiformis
ref|XP_009763871.1|  PREDICTED: beta-glucosidase 18-like                248   1e-75   Nicotiana sylvestris
ref|XP_006383935.1|  hypothetical protein POPTR_0004s01890g             250   2e-75   
gb|KFK40642.1|  hypothetical protein AALP_AA2G023000                    251   2e-75   Arabis alpina [alpine rockcress]
ref|XP_009608375.1|  PREDICTED: beta-glucosidase 18-like                250   3e-75   Nicotiana tomentosiformis
ref|XP_010316607.1|  PREDICTED: beta-glucosidase 18 isoform X2          248   3e-75   Solanum lycopersicum
ref|XP_002869865.1|  beta-glucosidase 47                                250   3e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_007153927.1|  hypothetical protein PHAVU_003G076800g             250   4e-75   Phaseolus vulgaris [French bean]
ref|XP_009105279.1|  PREDICTED: beta-glucosidase 46-like isoform X2     246   5e-75   Brassica rapa
ref|XP_010449006.1|  PREDICTED: beta-glucosidase 47-like                250   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010439426.1|  PREDICTED: beta-glucosidase 47-like                250   6e-75   Camelina sativa [gold-of-pleasure]
emb|CDX94056.1|  BnaC07g36900D                                          249   7e-75   
ref|XP_009774064.1|  PREDICTED: beta-glucosidase 18-like                248   2e-74   Nicotiana sylvestris
ref|XP_006348091.1|  PREDICTED: probable inactive beta-glucosidas...    248   2e-74   Solanum tuberosum [potatoes]
ref|XP_004976202.1|  PREDICTED: probable inactive beta-glucosidas...    248   2e-74   Setaria italica
ref|XP_010316605.1|  PREDICTED: beta-glucosidase 18 isoform X1          248   3e-74   Solanum lycopersicum
ref|XP_010316603.1|  PREDICTED: beta-glucosidase 18-like isoform X2     245   3e-74   
ref|XP_008801279.1|  PREDICTED: beta-glucosidase 18-like                240   3e-74   Phoenix dactylifera
ref|NP_974067.1|  beta glucosidase 46                                   243   4e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430204.1|  PREDICTED: beta-glucosidase 46-like isoform X1     248   4e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010533828.1|  PREDICTED: beta-glucosidase 45-like isoform X2     244   5e-74   Tarenaya hassleriana [spider flower]
ref|XP_006285457.1|  hypothetical protein CARUB_v10006876mg             247   6e-74   
ref|XP_009803936.1|  PREDICTED: beta-glucosidase 18-like                247   7e-74   Nicotiana sylvestris
ref|XP_009105270.1|  PREDICTED: beta-glucosidase 46-like isoform X1     246   1e-73   Brassica rapa
gb|AAU05454.1|  At1g61820                                               244   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473402.1|  PREDICTED: beta-glucosidase 46                     246   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006413735.1|  hypothetical protein EUTSA_v10024896mg             246   2e-73   
ref|XP_010023761.1|  PREDICTED: beta-glucosidase 18-like isoform X3     243   2e-73   Eucalyptus grandis [rose gum]
gb|KFK40644.1|  hypothetical protein AALP_AA2G023300                    246   2e-73   Arabis alpina [alpine rockcress]
ref|XP_010434129.1|  PREDICTED: beta-glucosidase 47-like                246   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010533827.1|  PREDICTED: beta-glucosidase 46-like isoform X1     245   4e-73   Tarenaya hassleriana [spider flower]
ref|XP_010316602.1|  PREDICTED: beta-glucosidase 18-like isoform X1     245   4e-73   Solanum lycopersicum
emb|CDY55219.1|  BnaA01g36270D                                          244   6e-73   Brassica napus [oilseed rape]
gb|KDP39385.1|  hypothetical protein JCGZ_01142                         241   8e-73   Jatropha curcas
ref|NP_176374.1|  beta-glucosidase 45                                   244   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850968.1|  beta glucosidase 46                                   243   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28502.1|  Similar to F4I1.26 putative beta-glucosidase gi|3...    244   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KCW60131.1|  hypothetical protein EUGRSUZ_H02856                     243   1e-72   Eucalyptus grandis [rose gum]
ref|XP_006348093.1|  PREDICTED: beta-glucosidase 18-like                243   2e-72   Solanum tuberosum [potatoes]
ref|XP_010023759.1|  PREDICTED: beta-glucosidase 18-like isoform X1     243   2e-72   Eucalyptus grandis [rose gum]
ref|XP_004976200.1|  PREDICTED: probable inactive beta-glucosidas...    243   2e-72   Setaria italica
ref|XP_010418157.1|  PREDICTED: beta-glucosidase 46                     243   3e-72   Camelina sativa [gold-of-pleasure]
gb|KFK40645.1|  hypothetical protein AALP_AA2G023400                    243   3e-72   Arabis alpina [alpine rockcress]
ref|XP_006300409.1|  hypothetical protein CARUB_v10021331mg             242   3e-72   Capsella rubella
ref|XP_006451937.1|  hypothetical protein CICLE_v10007996mg             242   4e-72   Citrus clementina [clementine]
ref|XP_012091391.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    240   5e-72   
ref|XP_010069050.1|  PREDICTED: beta-glucosidase 18-like                242   5e-72   Eucalyptus grandis [rose gum]
ref|XP_012071274.1|  PREDICTED: beta-glucosidase 18-like                241   6e-72   
ref|XP_003529623.1|  PREDICTED: beta-glucosidase 46                     243   7e-72   Glycine max [soybeans]
ref|XP_006302139.1|  hypothetical protein CARUB_v10020143mg             241   8e-72   Capsella rubella
ref|XP_006464712.1|  PREDICTED: beta-glucosidase 18-like isoform X3     239   9e-72   
ref|XP_010431678.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    239   9e-72   
ref|XP_010644219.1|  PREDICTED: beta-glucosidase 18 isoform X1          241   1e-71   Vitis vinifera
ref|XP_002888065.1|  hypothetical protein ARALYDRAFT_475148             241   1e-71   
ref|XP_010316604.1|  PREDICTED: beta-glucosidase 18-like                241   1e-71   Solanum lycopersicum
ref|XP_010920389.1|  PREDICTED: beta-glucosidase 18-like                239   1e-71   
ref|XP_010920356.1|  PREDICTED: beta-glucosidase 18-like                240   2e-71   Elaeis guineensis
gb|ERN19524.1|  hypothetical protein AMTR_s00062p00043120               241   2e-71   Amborella trichopoda
ref|XP_002448173.1|  hypothetical protein SORBIDRAFT_06g022450          239   5e-71   Sorghum bicolor [broomcorn]
ref|XP_010245701.1|  PREDICTED: beta-glucosidase 18-like                239   5e-71   Nelumbo nucifera [Indian lotus]
gb|KJB81915.1|  hypothetical protein B456_013G167400                    238   6e-71   Gossypium raimondii
emb|CDY25326.1|  BnaC01g29950D                                          243   6e-71   Brassica napus [oilseed rape]
ref|XP_009794052.1|  PREDICTED: beta-glucosidase 18-like                239   8e-71   Nicotiana sylvestris
ref|XP_006464710.1|  PREDICTED: beta-glucosidase 18-like isoform X1     239   1e-70   Citrus sinensis [apfelsine]
ref|NP_193907.2|  beta-glucosidase 47                                   239   1e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81916.1|  hypothetical protein B456_013G167400                    238   2e-70   Gossypium raimondii
ref|XP_008669177.1|  PREDICTED: probable inactive beta-glucosidas...    237   2e-70   Zea mays [maize]
ref|XP_009624454.1|  PREDICTED: beta-glucosidase 18                     238   2e-70   
ref|XP_002888064.1|  BGLU46                                             238   3e-70   
gb|KJB81911.1|  hypothetical protein B456_013G167400                    238   3e-70   Gossypium raimondii
ref|XP_010023758.1|  PREDICTED: beta-glucosidase 18-like                237   4e-70   
ref|XP_010240132.1|  PREDICTED: probable inactive beta-glucosidas...    234   5e-70   
ref|XP_010240133.1|  PREDICTED: probable inactive beta-glucosidas...    234   5e-70   
ref|XP_008454703.1|  PREDICTED: beta-glucosidase 18-like                234   1e-69   
ref|XP_003581423.1|  PREDICTED: probable inactive beta-glucosidas...    234   3e-69   
gb|EMS60351.1|  Beta-glucosidase 16                                     234   5e-69   Triticum urartu
gb|AFO12647.1|  beta-glucosidase                                        229   6e-69   Cucumis sativus [cucumbers]
gb|KDP39384.1|  hypothetical protein JCGZ_01141                         233   9e-69   Jatropha curcas
ref|XP_009397666.1|  PREDICTED: beta-glucosidase 18-like                233   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012071272.1|  PREDICTED: beta-glucosidase 18-like                233   1e-68   Jatropha curcas
gb|KEH38761.1|  glycoside hydrolase family 1 protein                    233   1e-68   Medicago truncatula
ref|XP_010430205.1|  PREDICTED: beta-glucosidase 46-like isoform X2     232   2e-68   Camelina sativa [gold-of-pleasure]
gb|ABC55715.1|  beta-mannosidase 4                                      232   2e-68   Oncidium hybrid cultivar
ref|XP_002448170.1|  hypothetical protein SORBIDRAFT_06g022420          238   3e-68   
ref|XP_002448166.1|  hypothetical protein SORBIDRAFT_06g022385          228   3e-68   
ref|XP_009413740.1|  PREDICTED: beta-glucosidase 18-like isoform X2     231   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006593298.1|  PREDICTED: beta-glucosidase 18-like                231   7e-68   
gb|KHN28048.1|  Beta-glucosidase 18                                     232   7e-68   Glycine soja [wild soybean]
gb|KGN59900.1|  hypothetical protein Csa_3G852490                       231   8e-68   Cucumis sativus [cucumbers]
gb|EMT31288.1|  Beta-glucosidase 1                                      232   9e-68   
ref|XP_011652391.1|  PREDICTED: beta-glucosidase 18 isoform X2          231   9e-68   Cucumis sativus [cucumbers]
ref|XP_004487691.1|  PREDICTED: beta-glucosidase 18-like                231   1e-67   
ref|XP_009413739.1|  PREDICTED: beta-glucosidase 18-like isoform X1     230   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT09723.1|  Beta-glucosidase 6                                      230   1e-67   
ref|XP_011652390.1|  PREDICTED: beta-glucosidase 18 isoform X1          231   2e-67   Cucumis sativus [cucumbers]
ref|XP_002448169.1|  hypothetical protein SORBIDRAFT_06g022410          230   2e-67   Sorghum bicolor [broomcorn]
ref|NP_001053302.1|  Os04g0513100                                       230   2e-67   
gb|EMS59801.1|  putative inactive beta-glucosidase 14                   231   2e-67   Triticum urartu
ref|XP_003541851.2|  PREDICTED: beta-glucosidase 18-like isoform X1     229   5e-67   Glycine max [soybeans]
ref|XP_006594785.1|  PREDICTED: beta-glucosidase 18-like isoform X2     229   5e-67   Glycine max [soybeans]
ref|XP_007021332.1|  Beta-glucosidase 45, putative                      231   9e-67   
ref|XP_002448174.1|  hypothetical protein SORBIDRAFT_06g022460          228   9e-67   
ref|XP_010473401.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    229   1e-66   
ref|XP_008669176.1|  PREDICTED: probable inactive beta-glucosidas...    228   1e-66   
gb|EMS46231.1|  Beta-glucosidase 16                                     228   1e-66   Triticum urartu
ref|XP_009378508.1|  PREDICTED: beta-glucosidase 18-like                228   1e-66   
gb|EYU26405.1|  hypothetical protein MIMGU_mgv1a004080mg                228   2e-66   Erythranthe guttata [common monkey flower]
ref|NP_001053305.1|  Os04g0513900                                       219   3e-66   
ref|XP_003541849.2|  PREDICTED: beta-glucosidase 18-like isoform X1     226   5e-66   Glycine max [soybeans]
gb|AID16401.1|  monolignol beta-glucosidase                             226   5e-66   synthetic construct
gb|KEH38756.1|  glycoside hydrolase family 1 protein                    226   7e-66   Medicago truncatula
gb|AFK42730.1|  unknown                                                 216   7e-66   Medicago truncatula
ref|XP_008226781.1|  PREDICTED: beta-glucosidase 18-like                222   9e-66   Prunus mume [ume]
sp|Q7XSK2.2|BGL16_ORYSJ  RecName: Full=Beta-glucosidase 16; Short...    226   9e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653596.1|  PREDICTED: beta-glucosidase 16-like                225   1e-65   
ref|NP_001185287.1|  beta-glucosidase 45                                226   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010644221.1|  PREDICTED: beta-glucosidase 18-like                225   2e-65   Vitis vinifera
gb|EMS66653.1|  Beta-glucosidase 16                                     225   2e-65   Triticum urartu
ref|XP_008669175.1|  PREDICTED: probable inactive beta-glucosidas...    224   3e-65   
ref|XP_004976206.1|  PREDICTED: beta-glucosidase 18-like isoform X3     221   5e-65   
emb|CDX79092.1|  BnaA01g11590D                                          222   6e-65   
gb|KHN28049.1|  Beta-glucosidase 18                                     224   6e-65   Glycine soja [wild soybean]
ref|XP_006594784.1|  PREDICTED: beta-glucosidase 18-like isoform X3     223   7e-65   Glycine max [soybeans]
ref|XP_006652510.1|  PREDICTED: beta-glucosidase 16-like                223   8e-65   Oryza brachyantha
ref|XP_006370302.1|  hypothetical protein POPTR_0001s41440g             223   8e-65   Populus trichocarpa [western balsam poplar]
ref|XP_003580124.2|  PREDICTED: beta-glucosidase 16-like                224   9e-65   
ref|XP_011098338.1|  PREDICTED: beta-glucosidase 18-like                223   1e-64   Sesamum indicum [beniseed]
ref|XP_006594783.1|  PREDICTED: beta-glucosidase 18-like isoform X2     223   2e-64   Glycine max [soybeans]
dbj|BAJ93784.1|  predicted protein                                      222   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007149594.1|  hypothetical protein PHAVU_005G082900g             222   3e-64   Phaseolus vulgaris [French bean]
gb|KGN59899.1|  hypothetical protein Csa_3G852480                       222   3e-64   Cucumis sativus [cucumbers]
ref|XP_011652389.1|  PREDICTED: beta-glucosidase 18-like                221   3e-64   Cucumis sativus [cucumbers]
gb|EMT28326.1|  Beta-glucosidase 1                                      213   5e-64   
ref|XP_004976205.1|  PREDICTED: beta-glucosidase 18-like isoform X2     221   5e-64   Setaria italica
ref|XP_004976204.1|  PREDICTED: beta-glucosidase 18-like isoform X1     221   5e-64   Setaria italica
ref|XP_009382650.1|  PREDICTED: beta-glucosidase 18-like                220   8e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009605772.1|  PREDICTED: beta-glucosidase 18-like isoform X2     218   8e-64   Nicotiana tomentosiformis
ref|XP_009605774.1|  PREDICTED: probable inactive beta-glucosidas...    218   9e-64   Nicotiana tomentosiformis
ref|XP_007149593.1|  hypothetical protein PHAVU_005G082800g             220   2e-63   Phaseolus vulgaris [French bean]
ref|XP_009768487.1|  PREDICTED: beta-glucosidase 18-like                220   2e-63   Nicotiana sylvestris
ref|XP_002448179.1|  hypothetical protein SORBIDRAFT_06g022510          219   2e-63   
ref|XP_008454668.1|  PREDICTED: beta-glucosidase 18-like                219   3e-63   
sp|Q7XSK0.2|BGL18_ORYSJ  RecName: Full=Beta-glucosidase 18; Short...    219   3e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007149591.1|  hypothetical protein PHAVU_005G082800g             219   3e-63   Phaseolus vulgaris [French bean]
ref|XP_008453064.1|  PREDICTED: beta-glucosidase 18-like                219   3e-63   
ref|XP_011042496.1|  PREDICTED: beta-glucosidase 18-like isoform X1     219   3e-63   Populus euphratica
ref|XP_009762322.1|  PREDICTED: beta-glucosidase 18-like                219   4e-63   Nicotiana sylvestris
dbj|BAJ92008.1|  predicted protein                                      218   5e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAO04172.1|  hypothetical protein                                   218   5e-63   Delphinium grandiflorum
ref|XP_009605771.1|  PREDICTED: beta-glucosidase 18-like isoform X1     219   5e-63   Nicotiana tomentosiformis
ref|XP_006348230.1|  PREDICTED: beta-glucosidase 18-like                218   6e-63   Solanum tuberosum [potatoes]
ref|XP_007145856.1|  hypothetical protein PHAVU_007G273800g             218   6e-63   Phaseolus vulgaris [French bean]
ref|XP_002448178.1|  hypothetical protein SORBIDRAFT_06g022500          218   7e-63   Sorghum bicolor [broomcorn]
ref|XP_006348383.1|  PREDICTED: beta-glucosidase 18-like                216   7e-63   
ref|XP_009605773.1|  PREDICTED: beta-glucosidase 18-like isoform X1     218   8e-63   Nicotiana tomentosiformis
gb|KFK28774.1|  hypothetical protein AALP_AA7G045600                    217   1e-62   Arabis alpina [alpine rockcress]
ref|XP_008226671.1|  PREDICTED: beta-glucosidase 18-like                218   1e-62   Prunus mume [ume]
ref|XP_008226673.1|  PREDICTED: beta-glucosidase 18-like isoform X2     217   1e-62   
ref|XP_008226672.1|  PREDICTED: beta-glucosidase 18-like isoform X1     217   2e-62   
emb|CDP05879.1|  unnamed protein product                                218   2e-62   Coffea canephora [robusta coffee]
ref|XP_004141366.1|  PREDICTED: beta-glucosidase 18-like                216   3e-62   Cucumis sativus [cucumbers]
ref|XP_010920385.1|  PREDICTED: beta-glucosidase 18-like                207   4e-62   
ref|NP_001148165.1|  beta-glucosidase precursor                         215   7e-62   
ref|XP_004976207.1|  PREDICTED: beta-glucosidase 18-like                216   1e-61   Setaria italica
ref|XP_006348229.1|  PREDICTED: beta-glucosidase 18-like                215   1e-61   Solanum tuberosum [potatoes]
gb|EAZ31332.1|  hypothetical protein OsJ_15449                          213   2e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KHN36807.1|  Beta-glucosidase 18                                     214   3e-61   Glycine soja [wild soybean]
ref|XP_011098340.1|  PREDICTED: beta-glucosidase 18-like                214   5e-61   Sesamum indicum [beniseed]
ref|XP_010274443.1|  PREDICTED: beta-glucosidase 18-like                213   6e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009378491.1|  PREDICTED: beta-glucosidase 18-like isoform X2     211   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_010324440.1|  PREDICTED: beta-glucosidase 18-like                212   1e-60   
emb|CDP05880.1|  unnamed protein product                                213   1e-60   Coffea canephora [robusta coffee]
gb|EMT03996.1|  Beta-glucosidase 1                                      211   2e-60   
ref|NP_001140717.1|  beta-glucosidase precursor                         211   2e-60   Zea mays [maize]
ref|XP_009630283.1|  PREDICTED: beta-glucosidase 18-like                212   2e-60   Nicotiana tomentosiformis
ref|XP_004244205.1|  PREDICTED: beta-glucosidase 18-like                211   4e-60   Solanum lycopersicum
ref|XP_009378490.1|  PREDICTED: beta-glucosidase 18-like isoform X1     211   5e-60   Pyrus x bretschneideri [bai li]
ref|XP_009772387.1|  PREDICTED: beta-glucosidase 18-like                210   8e-60   Nicotiana sylvestris
ref|XP_011098339.1|  PREDICTED: beta-glucosidase 18-like                210   1e-59   
gb|EAZ31331.1|  hypothetical protein OsJ_15448                          207   4e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AIP98403.1|  beta-glucosidase                                        207   7e-59   
ref|XP_008384041.1|  PREDICTED: beta-glucosidase 46-like isoform X3     206   1e-58   
ref|XP_010675613.1|  PREDICTED: beta-glucosidase 18-like                207   1e-58   
ref|XP_010099017.1|  putative inactive beta-glucosidase 14              199   1e-58   
ref|XP_008384042.1|  PREDICTED: beta-glucosidase 46-like isoform X4     204   3e-58   
gb|KDO75517.1|  hypothetical protein CISIN_1g0455342mg                  201   3e-58   
ref|XP_010910031.1|  PREDICTED: beta-glucosidase 25 isoform X3          203   4e-58   
ref|XP_008386133.1|  PREDICTED: beta-glucosidase 18-like isoform X2     206   5e-58   
ref|XP_008386132.1|  PREDICTED: beta-glucosidase 18-like isoform X1     205   6e-58   
sp|Q9ZT64.1|CBG_PINCO  RecName: Full=Coniferin beta-glucosidase; ...    204   7e-58   
ref|XP_010245330.1|  PREDICTED: beta-glucosidase 18-like                196   7e-58   
ref|XP_004976203.1|  PREDICTED: beta-glucosidase 16-like                204   8e-58   
ref|XP_008789190.1|  PREDICTED: putative beta-glucosidase 41 isof...    202   8e-58   
ref|XP_010675614.1|  PREDICTED: beta-glucosidase 18-like                205   9e-58   
emb|CDP05878.1|  unnamed protein product                                197   1e-57   
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          203   2e-57   
emb|CDP05539.1|  unnamed protein product                                204   2e-57   
ref|XP_002448177.1|  hypothetical protein SORBIDRAFT_06g022490          203   4e-57   
emb|CDP05536.1|  unnamed protein product                                204   4e-57   
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          202   4e-57   
gb|KFK24361.1|  hypothetical protein AALP_AAs73986U000100               198   7e-57   
emb|CDP05535.1|  unnamed protein product                                202   1e-56   
gb|KFK24362.1|  hypothetical protein AALP_AAs73986U000100               198   2e-56   
gb|EPS72713.1|  hypothetical protein M569_02044                         200   2e-56   
gb|ACN29297.1|  unknown                                                 192   6e-56   
emb|CDP11229.1|  unnamed protein product                                199   1e-55   
ref|NP_001132535.1|  hypothetical protein                               195   2e-55   
emb|CDP05537.1|  unnamed protein product                                198   3e-55   
sp|Q7XPY5.2|BGL15_ORYSJ  RecName: Full=Putative beta-glucosidase ...    194   3e-55   
gb|KFK40643.1|  hypothetical protein AALP_AA2G023200                    196   5e-55   
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          196   5e-55   
ref|NP_001167660.1|  beta-glucosidase precursor                         197   7e-55   
ref|XP_007214434.1|  hypothetical protein PRUPE_ppa025660mg             196   8e-55   
emb|CDY25325.1|  BnaC01g29940D                                          195   1e-54   
tpg|DAA36952.1|  TPA: hypothetical protein ZEAMMB73_325029              194   3e-54   
ref|XP_008661459.1|  PREDICTED: hypothetical protein isoform X1         195   3e-54   
ref|NP_001268161.1|  beta-glucosidase precursor                         194   4e-54   
ref|XP_006348385.1|  PREDICTED: beta-glucosidase 18-like                194   4e-54   
ref|XP_008658981.1|  PREDICTED: uncharacterized protein LOC100502...    192   5e-54   
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                194   6e-54   
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 194   9e-54   
gb|EMT00549.1|  Beta-glucosidase 6                                      194   9e-54   
ref|XP_010267847.1|  PREDICTED: putative beta-glucosidase 41 isof...    191   9e-54   
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             193   1e-53   
ref|XP_002987383.1|  hypothetical protein SELMODRAFT_235275             192   1e-53   
ref|XP_003563435.2|  PREDICTED: beta-glucosidase 25                     191   2e-53   
ref|XP_006656394.1|  PREDICTED: beta-glucosidase 25-like isoform X2     191   2e-53   
gb|KHG19061.1|  Beta-glucosidase 40 -like protein                       190   3e-53   
emb|CBI27264.3|  unnamed protein product                                193   3e-53   
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    192   3e-53   
emb|CBI33559.3|  unnamed protein product                                191   3e-53   
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     192   4e-53   
emb|CAN74265.1|  hypothetical protein VITISV_040977                     192   4e-53   
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    192   4e-53   
ref|XP_006656393.1|  PREDICTED: beta-glucosidase 25-like isoform X1     191   8e-53   
ref|XP_006464711.1|  PREDICTED: beta-glucosidase 18-like isoform X2     191   1e-52   
ref|XP_010242490.1|  PREDICTED: beta-glucosidase 4                      190   1e-52   
ref|XP_008226797.1|  PREDICTED: putative beta-glucosidase 41 isof...    189   1e-52   
gb|ACN41025.1|  unknown                                                 191   1e-52   
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41            191   1e-52   
gb|EEC77633.1|  hypothetical protein OsI_16625                          193   1e-52   
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                190   2e-52   
sp|Q0DA21.2|BGL25_ORYSJ  RecName: Full=Beta-glucosidase 25; Short...    190   2e-52   
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                191   2e-52   
gb|EEE58575.1|  hypothetical protein OsJ_09895                          190   2e-52   
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     190   3e-52   
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    189   3e-52   
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    189   3e-52   
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    189   3e-52   
ref|XP_008788338.1|  PREDICTED: beta-glucosidase 4                      188   3e-52   
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    189   3e-52   
ref|XP_006858818.1|  PREDICTED: beta-glucosidase 4                      189   4e-52   
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      189   4e-52   
gb|EMS61848.1|  Beta-glucosidase 25                                     192   5e-52   
ref|XP_004966274.1|  PREDICTED: beta-glucosidase 25-like                189   5e-52   
ref|XP_012070704.1|  PREDICTED: putative beta-glucosidase 41            189   5e-52   
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                189   5e-52   
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           189   5e-52   
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           189   6e-52   
ref|XP_006448534.1|  hypothetical protein CICLE_v10015030mg             187   6e-52   
ref|XP_007033096.1|  B-S glucosidase 44                                 189   6e-52   
ref|NP_001049358.1|  Os03g0212800                                       189   6e-52   
gb|KDO77121.1|  hypothetical protein CISIN_1g011145mg                   187   7e-52   
gb|KDP39010.1|  hypothetical protein JCGZ_00767                         189   9e-52   
ref|XP_007161525.1|  hypothetical protein PHAVU_001G076700g             189   9e-52   
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40                     188   9e-52   
gb|EEC74750.1|  hypothetical protein OsI_10506                          188   9e-52   
ref|XP_006448535.1|  hypothetical protein CICLE_v10015030mg             188   1e-51   
gb|KJB80347.1|  hypothetical protein B456_013G093000                    188   1e-51   
ref|XP_007038935.1|  Vicianin hydrolase, putative                       187   1e-51   
gb|KDO77122.1|  hypothetical protein CISIN_1g011145mg                   187   1e-51   
ref|XP_006468628.1|  PREDICTED: beta-glucosidase 42-like                187   1e-51   
dbj|BAJ98823.1|  predicted protein                                      187   2e-51   
gb|KEH30294.1|  glycoside hydrolase family 1 protein                    188   2e-51   
ref|XP_007045905.1|  Beta glucosidase 40                                188   2e-51   
ref|XP_004299546.1|  PREDICTED: beta-glucosidase 44-like                187   2e-51   
ref|XP_007029221.1|  Beta-glucosidase, putative                         187   2e-51   
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     187   2e-51   
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 187   2e-51   
gb|KHN20526.1|  Beta-glucosidase 40                                     187   2e-51   
ref|XP_003607795.1|  Beta-glucosidase                                   185   3e-51   
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             187   3e-51   
gb|KJB46131.1|  hypothetical protein B456_007G349700                    186   3e-51   
ref|XP_003539381.1|  PREDICTED: beta-glucosidase 12-like                187   3e-51   
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            187   4e-51   
gb|AES89992.2|  beta-glucosidase                                        184   4e-51   
gb|KCW52109.1|  hypothetical protein EUGRSUZ_J01543                     185   4e-51   
tpg|DAA44054.1|  TPA: hypothetical protein ZEAMMB73_095768              186   4e-51   
ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                186   4e-51   
gb|ERN06953.1|  hypothetical protein AMTR_s00005p00265850               186   5e-51   
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                186   5e-51   
ref|XP_010908744.1|  PREDICTED: beta-glucosidase 4 isoform X1           186   5e-51   
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             186   5e-51   
ref|XP_008218497.1|  PREDICTED: beta-glucosidase 42                     186   5e-51   
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      186   5e-51   
dbj|BAO04177.1|  hypothetical protein                                   186   5e-51   
gb|KHG13868.1|  Putative beta-glucosidase 41 -like protein              186   6e-51   
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                186   7e-51   
emb|CBI27265.3|  unnamed protein product                                186   8e-51   
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     186   8e-51   
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      186   9e-51   
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         186   9e-51   
ref|XP_007131971.1|  hypothetical protein PHAVU_011G0558000g            184   1e-50   
gb|EPS59761.1|  hypothetical protein M569_15044                         185   1e-50   
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      186   1e-50   
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     186   1e-50   
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                185   1e-50   
ref|XP_003564837.1|  PREDICTED: beta-glucosidase 4                      185   1e-50   
ref|XP_011623719.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    185   1e-50   
ref|XP_011018314.1|  PREDICTED: beta-glucosidase 40-like isoform X2     184   1e-50   
ref|XP_007131974.1|  hypothetical protein PHAVU_011G056100g             186   1e-50   
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                185   1e-50   
ref|XP_008352397.1|  PREDICTED: beta-glucosidase 12-like                182   1e-50   
ref|XP_008243590.1|  PREDICTED: beta-glucosidase 12-like                186   1e-50   
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     185   1e-50   
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                185   1e-50   
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             185   1e-50   
emb|CDX85027.1|  BnaC05g20280D                                          185   1e-50   
ref|XP_003607794.1|  Beta-glucosidase                                   185   1e-50   
ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                185   2e-50   
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             185   2e-50   
ref|XP_010686092.1|  PREDICTED: beta-glucosidase 44-like                185   2e-50   
gb|KFK39133.1|  beta-glucosidase 44                                     184   2e-50   
ref|XP_006582226.1|  PREDICTED: beta-glucosidase 25-like isoform X4     182   2e-50   
ref|XP_007131975.1|  hypothetical protein PHAVU_011G056200g             185   2e-50   
ref|XP_006384235.1|  hypothetical protein POPTR_0004s10900g             185   2e-50   
ref|NP_001146333.1|  hypothetical protein                               182   2e-50   
ref|NP_001078176.1|  beta glucosidase 43                                182   2e-50   
gb|KJB81859.1|  hypothetical protein B456_013G165100                    183   3e-50   
gb|KHG17589.1|  Beta-glucosidase 44 -like protein                       181   3e-50   
ref|XP_006582225.1|  PREDICTED: beta-glucosidase 25-like isoform X3     183   3e-50   
ref|XP_007033088.1|  Beta-glucosidase 44                                184   3e-50   
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                184   3e-50   
gb|AHC04401.1|  beta-glucosidase 1                                      184   3e-50   
ref|XP_002530914.1|  beta-glucosidase, putative                         184   3e-50   
ref|XP_006341563.1|  PREDICTED: beta-glucosidase 44-like                184   3e-50   
gb|AFZ78536.1|  beta-glucosidase                                        184   3e-50   
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          184   3e-50   
gb|AAM61600.1|  beta-glucosidase, putative                              184   4e-50   
ref|NP_173978.1|  beta glucosidase 40                                   184   4e-50   
gb|EEC66726.1|  hypothetical protein OsI_33062                          184   4e-50   
ref|NP_001064347.1|  Os10g0323500                                       184   4e-50   
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     184   4e-50   
ref|XP_006582224.1|  PREDICTED: beta-glucosidase 25-like isoform X2     183   5e-50   
ref|XP_007207700.1|  hypothetical protein PRUPE_ppa024193mg             184   5e-50   
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             183   5e-50   
ref|XP_011025247.1|  PREDICTED: beta-glucosidase 12-like                181   5e-50   
ref|XP_011013402.1|  PREDICTED: beta-glucosidase 12-like                184   5e-50   
emb|CDX95558.1|  BnaC01g34500D                                          183   6e-50   
ref|WP_020570938.1|  hypothetical protein                               182   6e-50   
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                183   6e-50   
gb|ERN06952.1|  hypothetical protein AMTR_s00005p00265710               182   6e-50   
ref|NP_001234620.1|  beta-mannosidase enzyme precursor                  183   7e-50   
gb|AFW69121.1|  hypothetical protein ZEAMMB73_597791                    182   7e-50   
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     183   7e-50   
ref|XP_006369420.1|  hypothetical protein POPTR_0001s23050g             183   7e-50   
ref|XP_011008770.1|  PREDICTED: beta-glucosidase 12-like                183   7e-50   
gb|KHN25275.1|  Beta-glucosidase 12                                     182   8e-50   
dbj|BAB02019.1|  beta-glucosidase                                       183   8e-50   
ref|XP_006651165.1|  PREDICTED: beta-glucosidase 6-like                 183   8e-50   
ref|XP_011014103.1|  PREDICTED: beta-glucosidase 12-like                183   8e-50   
gb|KJB81861.1|  hypothetical protein B456_013G165100                    183   9e-50   
ref|XP_009336228.1|  PREDICTED: beta-glucosidase 42-like                182   9e-50   
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             182   9e-50   
ref|XP_009113531.1|  PREDICTED: beta-glucosidase 43                     182   1e-49   
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 183   1e-49   
ref|XP_007048474.1|  Beta-glucosidase 44                                184   1e-49   
ref|NP_188435.2|  beta glucosidase 43                                   182   1e-49   
ref|XP_009346071.1|  PREDICTED: beta-glucosidase 42-like                182   1e-49   
ref|XP_002965185.1|  hypothetical protein SELMODRAFT_167232             182   1e-49   
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                182   1e-49   
ref|XP_008643498.1|  PREDICTED: hypothetical protein isoform X2         182   1e-49   
ref|XP_009349367.1|  PREDICTED: beta-glucosidase 42-like                182   1e-49   
ref|XP_011008769.1|  PREDICTED: beta-glucosidase 12-like isoform X2     182   1e-49   
ref|XP_002893397.1|  hypothetical protein ARALYDRAFT_472753             182   1e-49   
ref|XP_006369423.1|  linamarase family protein                          182   1e-49   
gb|AFZ78535.1|  beta-glucosidase                                        182   1e-49   
dbj|BAO04176.1|  hypothetical protein                                   182   1e-49   
ref|XP_011008768.1|  PREDICTED: beta-glucosidase 12-like isoform X1     182   1e-49   
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    182   1e-49   
emb|CDP04371.1|  unnamed protein product                                177   1e-49   
gb|KHN25273.1|  Beta-glucosidase 12                                     187   1e-49   
gb|ERN06954.1|  hypothetical protein AMTR_s00005p00266150               182   1e-49   
ref|XP_008799933.1|  PREDICTED: beta-glucosidase 12-like                183   1e-49   
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       182   1e-49   
ref|XP_011000474.1|  PREDICTED: beta-glucosidase 44-like                182   1e-49   
ref|XP_008655178.1|  PREDICTED: uncharacterized protein LOC100381...    182   2e-49   
ref|XP_006645170.1|  PREDICTED: beta-glucosidase 4-like                 182   2e-49   
gb|KEH33228.1|  glycoside hydrolase family 1 protein                    182   2e-49   
emb|CDY18494.1|  BnaA01g27010D                                          182   2e-49   
ref|XP_006369422.1|  hypothetical protein POPTR_0001s23070g             182   2e-49   
ref|XP_011623760.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    182   2e-49   
gb|KDO50113.1|  hypothetical protein CISIN_1g0406882mg                  178   2e-49   
ref|XP_010243804.1|  PREDICTED: beta-glucosidase 44-like                182   2e-49   
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    182   2e-49   
gb|KEH30766.1|  glycoside hydrolase family 1 protein                    182   2e-49   
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                182   2e-49   
ref|XP_003539051.1|  PREDICTED: beta-glucosidase 12-like                182   2e-49   
ref|XP_002883106.1|  beta-glucosidase                                   182   2e-49   
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                182   2e-49   
gb|EEE54664.1|  hypothetical protein OsJ_01954                          180   2e-49   



>emb|CAN68643.1| hypothetical protein VITISV_030810 [Vitis vinifera]
Length=444

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 179/236 (76%), Gaps = 3/236 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AA+RA SF  NWFLDPII+G YP++M  ILGS LPEFS  D +KL  A  LDFIG
Sbjct  206  TADKLAADRAQSFFMNWFLDPIIFGRYPEEMNTILGSILPEFSCNDRKKLNKA--LDFIG  263

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ YAQDC++S C+P   G +R EGF  Q+  KDG  IGE   L +L VYP GMEK
Sbjct  264  INHYTSLYAQDCIFSLCEPG-KGASRTEGFCRQTPEKDGVSIGESTALAWLHVYPQGMEK  322

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE++S IP+++TENGY D   PNS++E+ L D KRV+++A YL+ALST +RKGAD
Sbjct  323  MVTYVKERYSGIPMFITENGYVDENDPNSTIEEFLYDVKRVEYMAAYLDALSTAVRKGAD  382

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYF WSL DNFEW++GYTKR GL+  D  TLKRTPKLSA WYK FIA+   V +
Sbjct  383  VRGYFAWSLLDNFEWTYGYTKRFGLHHVDYGTLKRTPKLSATWYKLFIARYSLVKT  438



>ref|XP_002264678.3| PREDICTED: beta-glucosidase 46-like [Vitis vinifera]
Length=530

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 179/236 (76%), Gaps = 3/236 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AA+RA SF  NWFLDPII+G YP++M  ILGS LPEFS  D +KL  A  LDFIG
Sbjct  292  TADKLAADRAQSFFMNWFLDPIIFGRYPEEMNTILGSILPEFSCNDRKKLNKA--LDFIG  349

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ YAQDC++S C+P   G +R EGF  Q+  KDG  IGE   L +L VYP GMEK
Sbjct  350  INHYTSLYAQDCIFSLCEPG-KGASRTEGFCRQTPEKDGVSIGESTALAWLHVYPQGMEK  408

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE++S IP+++TENGY D   PNS++E+ L D KRV+++A YL+ALST +RKGAD
Sbjct  409  MVTYVKERYSGIPMFITENGYVDENDPNSTIEEFLYDVKRVEYMAAYLDALSTAVRKGAD  468

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYF WSL DNFEW++GYTKR GL+  D  TLKRTPKLSA WYK FIA+   V +
Sbjct  469  VRGYFAWSLLDNFEWTYGYTKRFGLHHVDYGTLKRTPKLSATWYKLFIARYSLVKT  524



>emb|CBI23186.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 177/230 (77%), Gaps = 3/230 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AA+RA SF  NWFLDPII+G YP++M  ILGS LPEFS  D +KL  A  LDFIG
Sbjct  292  TADKLAADRAQSFFMNWFLDPIIFGRYPEEMNTILGSILPEFSCNDRKKLNKA--LDFIG  349

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ YAQDC++S C+P   G +R EGF  Q+  KDG  IGE   L +L VYP GMEK
Sbjct  350  INHYTSLYAQDCIFSLCEPG-KGASRTEGFCRQTPEKDGVSIGESTALAWLHVYPQGMEK  408

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE++S IP+++TENGY D   PNS++E+ L D KRV+++A YL+ALST +RKGAD
Sbjct  409  MVTYVKERYSGIPMFITENGYVDENDPNSTIEEFLYDVKRVEYMAAYLDALSTAVRKGAD  468

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK  184
            VRGYF WSL DNFEW++GYTKR GL+  D  TLKRTPKLSA WYK FIA+
Sbjct  469  VRGYFAWSLLDNFEWTYGYTKRFGLHHVDYGTLKRTPKLSATWYKLFIAR  518



>gb|KDO75513.1| hypothetical protein CISIN_1g0095352mg [Citrus sinensis]
Length=426

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF  NWFLDPIIYG YP +M +I+GS LP+FSS D EKLK   GLDFIG
Sbjct  182  TADKLAAERAQSFYMNWFLDPIIYGKYPAEMMNIVGSTLPKFSSRDKEKLKQ--GLDFIG  239

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ Y QDC++S C P   G ++ EGF  Q+  K G  +GE   L +L VYP GM K
Sbjct  240  INHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWLNVYPQGMWK  298

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+KE++ N P+++TENGY +   PNSS ED+LND KRV+++A YL+AL T +R GAD
Sbjct  299  IIKYIKERYKNTPMFITENGYGEICMPNSSTEDLLNDVKRVEYMASYLDALITAVRDGAD  358

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            VRGYF+WSL D+FEW++GYT R GL+  D  TLKRTPKLSA WYK FIAK++ + S+
Sbjct  359  VRGYFVWSLLDSFEWTYGYTARFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIKSQ  415



>gb|KDO75512.1| hypothetical protein CISIN_1g0095352mg, partial [Citrus sinensis]
Length=431

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF  NWFLDPIIYG YP +M +I+GS LP+FSS D EKLK   GLDFIG
Sbjct  187  TADKLAAERAQSFYMNWFLDPIIYGKYPAEMMNIVGSTLPKFSSRDKEKLKQ--GLDFIG  244

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ Y QDC++S C P   G ++ EGF  Q+  K G  +GE   L +L VYP GM K
Sbjct  245  INHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWLNVYPQGMWK  303

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+KE++ N P+++TENGY +   PNSS ED+LND KRV+++A YL+AL T +R GAD
Sbjct  304  IIKYIKERYKNTPMFITENGYGEICMPNSSTEDLLNDVKRVEYMASYLDALITAVRDGAD  363

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            VRGYF+WSL D+FEW++GYT R GL+  D  TLKRTPKLSA WYK FIAK++ + S+
Sbjct  364  VRGYFVWSLLDSFEWTYGYTARFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIKSQ  420



>ref|XP_006449067.1| hypothetical protein CICLE_v100148872mg, partial [Citrus clementina]
 gb|ESR62307.1| hypothetical protein CICLE_v100148872mg, partial [Citrus clementina]
Length=431

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF  NWFLDPII+G YP +M +I+GS LP+FSS D EKLK   GLDFIG
Sbjct  187  TADKLAAERAQSFYMNWFLDPIIHGKYPAEMMNIVGSTLPKFSSRDKEKLKQ--GLDFIG  244

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ Y QDC++S C P   G ++ EGF  Q+  K G  +GE   L +  VYP GM K
Sbjct  245  INHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWQNVYPQGMWK  303

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y++E++ N P+++TENGY + + PNSS ED+LND KRVK++A YL+AL T +R GAD
Sbjct  304  IIKYIQERYKNTPMFITENGYGEISMPNSSTEDLLNDVKRVKYMASYLDALITAVRDGAD  363

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            VRGYF+WSL D+FEW++GYT R GL+  D  TLKRTPKLSA WYK FIAK++ + S+
Sbjct  364  VRGYFVWSLLDSFEWTYGYTSRFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIKSQ  420



>ref|XP_007026017.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
 gb|EOY28639.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
Length=529

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 181/236 (77%), Gaps = 3/236 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF   WFLDPII+G YP +M++ILGS LPEFS+ + EKL    GLDFIG+
Sbjct  285  ADKLAAERAQSFTMKWFLDPIIFGRYPPEMQNILGSILPEFSTTEKEKLNK--GLDFIGV  342

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY++YY +DC++S C+P  TG ++ EGF GQS  K+G  IGE+  L++L VYP GMEK+
Sbjct  343  NHYSSYYVKDCMFSVCEPG-TGTSKTEGFWGQSSQKNGIPIGELTDLDWLNVYPQGMEKI  401

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTY+KE + NIP+ +TENGY + +  NS+ E+ L+D KRV++LA YL+ LST IRKGADV
Sbjct  402  VTYLKETYHNIPMIITENGYGEVSKANSTTEEFLHDVKRVEYLAGYLDQLSTAIRKGADV  461

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            RGYF+WSL DNFEW+FGYT R GL+  D  TLKRTPK SA WYK FI+++ +V  +
Sbjct  462  RGYFVWSLLDNFEWNFGYTVRFGLHHVDFKTLKRTPKSSATWYKNFISEHGQVKDQ  517



>ref|XP_006468004.1| PREDICTED: beta-glucosidase 46-like [Citrus sinensis]
Length=558

 Score =   298 bits (762),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF  NWFLDPIIYG YP +M +I+GS LP+FSS D EKLK   GLDFIG
Sbjct  314  TADKLAAERAQSFYMNWFLDPIIYGKYPAEMMNIVGSTLPKFSSRDKEKLKQ--GLDFIG  371

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ Y QDC++S C P   G ++ EGF  Q+  K G  +GE   L +L VYP GM K
Sbjct  372  INHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWLNVYPQGMWK  430

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+KE++ N P+++TENGY +   PNSS ED+LND KRV+++A YL+AL T +R GAD
Sbjct  431  IIKYIKERYKNTPMFITENGYGEICMPNSSTEDLLNDVKRVEYMASYLDALITAVRDGAD  490

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            VRGYF+WSL D+FEW++GYT R GL+  D  TLKRTPKLSA WYK FIAK++ + S+
Sbjct  491  VRGYFVWSLLDSFEWTYGYTARFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIKSQ  547



>ref|XP_007026020.1| Beta glucosidase 46, putative [Theobroma cacao]
 gb|EOY28642.1| Beta glucosidase 46, putative [Theobroma cacao]
Length=529

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 178/240 (74%), Gaps = 3/240 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  NWFLDPII+G YP +M++ILGS LPEFS  + EKL+   GLDFIGI
Sbjct  285  ADKLAAERAQSFSINWFLDPIIFGRYPIEMQNILGSILPEFSITEKEKLQK--GLDFIGI  342

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY++ Y QDC++S C+P  TG ++ EGF  Q+  K+G  IGE   L++L VYP GMEK+
Sbjct  343  NHYSSSYVQDCMFSACEPG-TGTSKTEGFWRQTSQKNGIPIGESTDLDWLYVYPGGMEKI  401

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTY+K+++ NIP+ +TENGY +    N+++ED L D KR +++A YL+ALST IRKGADV
Sbjct  402  VTYLKKRYHNIPMIITENGYGEEGKANATIEDFLQDVKRAEYMAGYLDALSTAIRKGADV  461

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLR  151
            RGYF WSL DNFEW +GYT+R GL+  D  TLKRTPK SA WYK+FIA   KV  +   R
Sbjct  462  RGYFAWSLLDNFEWQYGYTRRFGLHHVDYKTLKRTPKFSASWYKEFIAVQGKVKYQTTER  521



>gb|KJB67164.1| hypothetical protein B456_010G178800 [Gossypium raimondii]
Length=516

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 178/235 (76%), Gaps = 3/235 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA  F +NWFLDPI++G YP +M+ ILGS LPEFS  + E LK   GLDFIGI
Sbjct  285  ADKLAAERAQCFTTNWFLDPIVFGRYPPEMQSILGSILPEFSKTEKEMLKK--GLDFIGI  342

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY++YY QDC+++ C+P  TG ++ EGF  QS+ K+G  IGE   +++L VYP GMEK+
Sbjct  343  NHYSSYYVQDCMFTACEPG-TGTSKTEGFWAQSYQKNGIPIGEPIDVDWLYVYPGGMEKI  401

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            +TYVK++F+N P+ +TENGY + T  NS++ED L D  R K++A YL++LST IRKGADV
Sbjct  402  ITYVKKRFNNTPMIITENGYGEVTKANSTIEDSLQDVNRAKYMAGYLDSLSTAIRKGADV  461

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            RGYF WSL DNF+W +G+T+R GL+  D  TLKRTPK SA WYK FIA+++  +S
Sbjct  462  RGYFAWSLLDNFDWEYGFTRRFGLHHVDFKTLKRTPKFSATWYKNFIAESKIPDS  516



>ref|XP_006449069.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
 gb|ESR62309.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
Length=523

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 182/229 (79%), Gaps = 3/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA +F  NWFLDPII+G YPK+M +ILGS+LP FS  DLEKLK   GLDF+GIN
Sbjct  288  DKLAAERAQAFYLNWFLDPIIFGKYPKEMYEILGSSLPSFSKYDLEKLK--NGLDFVGIN  345

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+P   GN++ EG + ++  ++G LIGE   +++L VYP GM ++V
Sbjct  346  HYTSFYVKDCIFSVCEPG-PGNSKTEGSILRTAKRNGVLIGEPTDVDWLFVYPQGMSEIV  404

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+KE+++NIP+Y+TENG+ +   P++S+ED+LNDT+RV++++++L++L+  +R GADVR
Sbjct  405  TYIKERYNNIPMYITENGFGERDNPHTSIEDLLNDTRRVRYMSNHLDSLAIAVRNGADVR  464

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF WSL DNFEW+ GYT R GL+  D  TL+RT +LSA WYKQ+IAK+
Sbjct  465  GYFAWSLLDNFEWNDGYTIRFGLHHVDYATLERTKRLSANWYKQYIAKH  513



>ref|XP_011037697.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=515

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 179/238 (75%), Gaps = 3/238 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TA++ A ERA +FL  WFLDPII+G YP++MK +LGS LPEFS  D+ KL+   GLDFIG
Sbjct  281  TANKLAVERAQAFLLRWFLDPIIFGRYPEEMKKVLGSTLPEFSRNDMNKLRK--GLDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT+YY QDC+ S C+P   G+TR EG    +  KDG  IG+ + +++L VYP GMEK
Sbjct  339  MNHYTSYYVQDCILSVCEPG-KGSTRTEGSSLLTQEKDGVPIGKPSEVDWLHVYPQGMEK  397

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE++ NIP+ +TENGY   +  N ++E+ L+DT RV++++ YL+AL T ++KGAD
Sbjct  398  MVTYVKERYHNIPMIITENGYSQVSNSNRNIEEFLHDTGRVEYMSGYLDALLTAMKKGAD  457

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            VRGYF WS  DNFEW+FGYT+R GLY  D  T+KRTP+LSA WYK+FIA+ +   S+M
Sbjct  458  VRGYFAWSFLDNFEWTFGYTRRFGLYHVDYTTMKRTPRLSATWYKEFIARYKVDKSQM  515



>ref|XP_002305597.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86108.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 179/238 (75%), Gaps = 3/238 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TA++ A ERAH+F   WFLDPII+G YP++MK +LGS LPEFS  D+ KL+   GLDFIG
Sbjct  281  TANKLAVERAHAFFLRWFLDPIIFGRYPEEMKKVLGSTLPEFSRNDMNKLRK--GLDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT+YY QDC+ S C+P   G+TR EG    +  KDG  IG+ + +++L VYP GMEK
Sbjct  339  MNHYTSYYVQDCILSVCEPG-KGSTRTEGSSLLTQEKDGVPIGKPSEVDWLHVYPQGMEK  397

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE+++N P+ +TENGY   +  N ++E+ L+DT RV++++ YL+AL T ++KGAD
Sbjct  398  MVTYVKERYNNTPMIITENGYAQVSNSNGNIEEFLHDTGRVEYMSGYLDALLTAMKKGAD  457

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            VRGYF WS  DNFEW+FGYT+R GLY  D  T+KRTP+LSA WYK+FIA+ +   S+M
Sbjct  458  VRGYFAWSFLDNFEWTFGYTRRFGLYHVDYTTMKRTPRLSATWYKEFIARYKVDKSQM  515



>gb|KHG24858.1| Beta-glucosidase 46 -like protein [Gossypium arboreum]
Length=417

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 175/231 (76%), Gaps = 3/231 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD+ AAERA SF  NWFLDPII+G YP++M+DILGS LPEFS  + +KL    GLDFIG
Sbjct  186  VADKLAAERAQSFSINWFLDPIIFGRYPQEMQDILGSILPEFSKTEKQKLNK--GLDFIG  243

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT++Y +DC+ +TC+P   G ++ EG+  QS  K+G  IGE   L  + VYP GMEK
Sbjct  244  INHYTSFYVRDCMLTTCEPG-KGTSKTEGYWAQSSQKNGIDIGEPTELAGMNVYPQGMEK  302

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K+++ N+P+ +TENGY D   PNS+ E +L+D +R+K+LA YL+ALST I+KGAD
Sbjct  303  IVTYLKDRYHNVPMIITENGYGDMNKPNSTTESLLHDVERIKYLAGYLDALSTAIKKGAD  362

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            VRGYF+WSL DNFEW+ GYT R GL+  D  TL+RTPK SA WY+ FI+++
Sbjct  363  VRGYFVWSLLDNFEWNDGYTIRFGLHHVDYKTLRRTPKSSATWYRNFISQH  413



>ref|XP_010101461.1| Beta-glucosidase 47 [Morus notabilis]
 gb|EXB88444.1| Beta-glucosidase 47 [Morus notabilis]
Length=340

 Score =   280 bits (716),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 170/231 (74%), Gaps = 3/231 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A ERA SF  NWFLDPII G YP +MK+ILG +LP FS  D+EKLK   GLDFIGIN
Sbjct  101  DKLAVERALSFYMNWFLDPIILGKYPAEMKEILGDHLPAFSKDDMEKLK--NGLDFIGIN  158

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++YA+DC +STC+P   G ++ EG   +   KDG  IGE + ++++ VYP GMEK++
Sbjct  159  HYTSFYAKDCKFSTCEPK-AGASKTEGLSLRIAQKDGLFIGEPSEVDWIYVYPQGMEKII  217

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+K++++N P+++TENGY     PN   ED+LND KRV ++  YL+A++T +RKGADVR
Sbjct  218  TYIKDRYNNTPMFITENGYGYKEKPNFKREDLLNDVKRVDYMRSYLDAIATAVRKGADVR  277

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK  175
            GYF WSL DNFEW  GYT+R GLY  D  TLKR+ +LSA WY+QFIA   K
Sbjct  278  GYFAWSLLDNFEWISGYTERFGLYHVDYATLKRSARLSADWYRQFIANETK  328



>gb|KHG29723.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=529

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 174/238 (73%), Gaps = 3/238 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AAERA SF  NWFL+PI+YG YP+ M++ILGS LPEFS+ + +KLK   GLDFIGI
Sbjct  293  VDKLAAERARSFTINWFLEPILYGRYPRQMQNILGSILPEFSATEKQKLKQ--GLDFIGI  350

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+YY QDC++S C+P   G ++ EG+  QS  K+G  IGE   L    VYP G+EK+
Sbjct  351  NHYTSYYVQDCMFSACEPG-PGTSKMEGYCAQSSQKNGTPIGEPTELAGKNVYPEGIEKI  409

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTY+K ++ NIP+ +TENGY D   PNS+ E  L+D KRV++ A YL+ALST IRKGADV
Sbjct  410  VTYLKNRYHNIPIIITENGYGDMNKPNSTTEARLHDEKRVEYFARYLDALSTAIRKGADV  469

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            RGYFIWSL DNFEW+ GYT R GL+  D  TLKRTPK SA WYK FI+++     K++
Sbjct  470  RGYFIWSLLDNFEWNNGYTVRYGLHHVDYETLKRTPKSSATWYKNFISQHMVKEPKVE  527



>ref|XP_008384040.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Malus domestica]
Length=497

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 176/236 (75%), Gaps = 3/236 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPI+ G YP +M+++LGS+LP FS  D+E LK   GLDFIGIN
Sbjct  262  DRLAAERAISFYMNWFLDPILQGKYPAEMRELLGSDLPAFSKSDVEMLKM-NGLDFIGIN  320

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y++DC++S C+P   G +R EGF  ++  KDG  IGE   ++ L VYP GMEK+V
Sbjct  321  HYTSFYSKDCMFSACEPG-PGASRTEGFALRTAQKDGVFIGEPTSVDXLYVYPQGMEKMV  379

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +   PNSS E++LND KRV++L  YL+ALS  IRKGADVR
Sbjct  380  TYVKDRYNNTPIFITENGFGEVENPNSSNEELLNDVKRVEYLRSYLHALSEGIRKGADVR  439

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            GY +WSL DNFEW+ GYT R GL+  D  TLKR  +LSA WYKQF++ N  V + +
Sbjct  440  GYLVWSLLDNFEWTSGYTVRFGLHHVDYATLKRNQRLSAAWYKQFVS-NHTVQTHL  494



>ref|XP_002304950.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
 gb|EEE85461.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
Length=501

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 179/238 (75%), Gaps = 3/238 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TA++ A ERA +F   WFLDPII+G YP++MK++LGS LPEFS  D+ KL+   GLDFIG
Sbjct  267  TANKLAVERALAFFLRWFLDPIIFGRYPEEMKEVLGSTLPEFSRNDMNKLRK--GLDFIG  324

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT+YY QDC+ S C+P   G+TR EG    +  KDG  IG+ + +++L VYP GMEK
Sbjct  325  MNHYTSYYVQDCILSVCEPG-KGSTRTEGSSLLTQEKDGVPIGKPSEVDWLHVYPQGMEK  383

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE+++N P+ +TENGY   +  N ++E+ L+DT RV++++ YL+AL T ++KGAD
Sbjct  384  MVTYVKERYNNTPMIITENGYSQVSNSNGNIEEFLHDTGRVEYMSGYLDALLTAMKKGAD  443

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            VRGYF WS  DNFEW+FGYT+R GLY  D  T+KRTP+LSA WYK+FIA+ +   S+M
Sbjct  444  VRGYFAWSFLDNFEWTFGYTRRFGLYHVDYTTMKRTPRLSATWYKEFIARYKVDKSQM  501



>ref|XP_006468000.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Citrus sinensis]
Length=519

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 181/230 (79%), Gaps = 3/230 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AAERA +F  NWFLDPII+G YPK+M +ILGS+LP  S  DLEKLK   GLDFIGI
Sbjct  283  GDKLAAERAQAFYLNWFLDPIIFGKYPKEMYEILGSSLPSLSKYDLEKLK--NGLDFIGI  340

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+Y+++Y +DC++S C+P   GN++ EG + ++  ++G LIGE   +++L VYP GM ++
Sbjct  341  NYYSSFYVKDCIFSVCEPG-PGNSKTEGSILRTAKRNGVLIGEPTDVDWLFVYPQGMSEI  399

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTY+KE+++NIP+Y+TENG+ +   P++S+ED+LNDT+RV++++++L++L+  +R GADV
Sbjct  400  VTYIKERYNNIPMYITENGFGERDNPHTSIEDLLNDTRRVRYMSNHLDSLAIAVRNGADV  459

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYF WSL DNFEW+ GYT R GL+  D  TLKRT +LSA WYKQ+IAK+
Sbjct  460  RGYFAWSLLDNFEWNDGYTIRFGLHHVDYATLKRTKRLSANWYKQYIAKH  509



>ref|XP_008384039.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Malus domestica]
Length=518

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 176/236 (75%), Gaps = 3/236 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPI+ G YP +M+++LGS+LP FS  D+E LK   GLDFIGIN
Sbjct  283  DRLAAERAISFYMNWFLDPILQGKYPAEMRELLGSDLPAFSKSDVEMLKM-NGLDFIGIN  341

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y++DC++S C+P   G +R EGF  ++  KDG  IGE   ++ L VYP GMEK+V
Sbjct  342  HYTSFYSKDCMFSACEPG-PGASRTEGFALRTAQKDGVFIGEPTSVDXLYVYPQGMEKMV  400

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +   PNSS E++LND KRV++L  YL+ALS  IRKGADVR
Sbjct  401  TYVKDRYNNTPIFITENGFGEVENPNSSNEELLNDVKRVEYLRSYLHALSEGIRKGADVR  460

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            GY +WSL DNFEW+ GYT R GL+  D  TLKR  +LSA WYKQF++ N  V + +
Sbjct  461  GYLVWSLLDNFEWTSGYTVRFGLHHVDYATLKRNQRLSAAWYKQFVS-NHTVQTHL  515



>gb|KJB67161.1| hypothetical protein B456_010G178500 [Gossypium raimondii]
Length=527

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 174/229 (76%), Gaps = 2/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA +F  NWFLDPII G YPK+M++IL SNLP FS+ D EKL + G LDFIGIN
Sbjct  278  DKQAAERAQAFYMNWFLDPIIMGKYPKEMQEILDSNLPSFSNHDQEKLNSTG-LDFIGIN  336

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+    GNT+ EGF  ++ +K+G  IGE   L++L V+P GMEK++
Sbjct  337  HYTSFYTKDCMFSVCEQG-PGNTKTEGFALRTATKNGVFIGESTALDWLFVHPQGMEKII  395

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVKE+++NIP+++TENG+C+    +S  E+ +ND  RV++++ Y+ AL   +RKGADVR
Sbjct  396  TYVKERYNNIPMFITENGFCENDKSDSLTEETVNDVNRVEYISGYMVALGAALRKGADVR  455

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ G+T R GL+  D  TLKRTP+ SA WYKQFIA +
Sbjct  456  GYFLWSLLDNFEWTLGFTIRFGLHHVDFSTLKRTPRGSATWYKQFIANH  504



>gb|KJB69320.1| hypothetical protein B456_011G016100 [Gossypium raimondii]
Length=724

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 174/231 (75%), Gaps = 3/231 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD+ AAERA SF  NWFLDPII+G YP++M+DILGS LPEFS+ + +KL    GLDFIG
Sbjct  188  VADKLAAERAQSFSINWFLDPIIFGRYPQEMQDILGSILPEFSTTEKQKLNK--GLDFIG  245

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+YY QDC++S C+P   G ++ EG+  QS  K+G  IGE   L    VYP GMEK
Sbjct  246  INHYTSYYVQDCMFSACEPG-PGTSKMEGYCAQSSQKNGTPIGEPTELAGKNVYPQGMEK  304

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K+++ N+P+ +TENGY D   PNS+ E +L+D +R+K+LA YL+ALST IRKGAD
Sbjct  305  IVTYLKDRYHNVPMIITENGYGDMNKPNSTTESLLHDVERIKYLAGYLDALSTAIRKGAD  364

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            VRGYF+WSL DNFEW+ GYT R GL+  D  TL+RTPK S  WY+ FI+++
Sbjct  365  VRGYFVWSLLDNFEWNSGYTIRFGLHHVDYETLRRTPKSSGTWYRNFISQH  415



>ref|XP_009363823.1| PREDICTED: beta-glucosidase 45-like isoform X2 [Pyrus x bretschneideri]
Length=497

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 178/236 (75%), Gaps = 3/236 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDP++ G YP +M++ILG++LP FS  D+E LK +G LDFIGIN
Sbjct  262  DKLAAERAISFYMNWFLDPVLQGKYPAEMREILGADLPAFSKSDVEMLKKSG-LDFIGIN  320

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y++DC++S C+P   G +R EGF  ++  KDG  IGE   +++L VYP GMEK+V
Sbjct  321  HYTSFYSKDCMFSACEPG-PGTSRTEGFALRTAQKDGVFIGEPTAVDWLYVYPQGMEKIV  379

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +   PNS  E++LND KRV+++  YLNAL+  IRKGADVR
Sbjct  380  TYVKDRYNNTPIFITENGFGEVENPNSCNEELLNDVKRVEYMKSYLNALAEGIRKGADVR  439

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            GY +WSL DNFEW+ G   R GL++ D  TLKRT +LSA WYKQF++ NQ V + +
Sbjct  440  GYVVWSLLDNFEWTSGLRVRFGLHRVDYATLKRTQRLSAAWYKQFVS-NQTVQTHL  494



>ref|XP_009363745.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Pyrus x bretschneideri]
Length=518

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 178/236 (75%), Gaps = 3/236 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDP++ G YP +M++ILG++LP FS  D+E LK +G LDFIGIN
Sbjct  283  DKLAAERAISFYMNWFLDPVLQGKYPAEMREILGADLPAFSKSDVEMLKKSG-LDFIGIN  341

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y++DC++S C+P   G +R EGF  ++  KDG  IGE   +++L VYP GMEK+V
Sbjct  342  HYTSFYSKDCMFSACEPG-PGTSRTEGFALRTAQKDGVFIGEPTAVDWLYVYPQGMEKIV  400

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +   PNS  E++LND KRV+++  YLNAL+  IRKGADVR
Sbjct  401  TYVKDRYNNTPIFITENGFGEVENPNSCNEELLNDVKRVEYMKSYLNALAEGIRKGADVR  460

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            GY +WSL DNFEW+ G   R GL++ D  TLKRT +LSA WYKQF++ NQ V + +
Sbjct  461  GYVVWSLLDNFEWTSGLRVRFGLHRVDYATLKRTQRLSAAWYKQFVS-NQTVQTHL  515



>ref|XP_008364100.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 47-like [Malus 
domestica]
Length=518

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 178/236 (75%), Gaps = 3/236 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D++AAERA SF  NWFLDP++ G YP +M++ILG++LP FS  D+E LK   GLDFIGI 
Sbjct  283  DKSAAERAMSFYMNWFLDPVLQGKYPAEMREILGADLPAFSKSDVEMLKK-NGLDFIGIK  341

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y++DC++S C+P   G +R EGF  ++  KDG  IGE   +++L VYP GMEK+V
Sbjct  342  HYTSFYSKDCMFSACEPG-PGXSRTEGFALRTAQKDGVFIGEPTSVDWLYVYPQGMEKIV  400

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +   PNS  E++LND KRV+++  YL+AL+  IRKGADVR
Sbjct  401  TYVKDRYNNTPIFITENGFGEVGNPNSCNEELLNDVKRVEYMRSYLHALAEGIRKGADVR  460

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            GY +WSL DNFEW+ GYT R GL++ D  TLKRT +LSA WYKQF++ N  V + +
Sbjct  461  GYLVWSLLDNFEWTSGYTVRFGLHRVDYATLKRTQRLSAAWYKQFVS-NHTVQTHL  515



>ref|XP_004293271.1| PREDICTED: beta-glucosidase 47 [Fragaria vesca subsp. vesca]
Length=514

 Score =   280 bits (717),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 173/230 (75%), Gaps = 4/230 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPI++G YP +M ++LG +LPEFS  D+E LK   GLDFIGIN
Sbjct  279  DKLAAERAQSFYINWFLDPIVHGRYPAEMHELLGDDLPEFSMFDMEMLK--NGLDFIGIN  336

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y++DC+ S C+P   G +R EG+  ++  KDG  IGE   +++L V+P GMEK+V
Sbjct  337  HYTSFYSKDCMISPCEPG-PGVSRTEGYALRTAQKDGIYIGEPTAVDWLYVHPQGMEKMV  395

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIR-KGADV  331
            TY+KE+++N P+++TENGY +    N++ E+  ND KRV+++  YL AL+ T+R KGADV
Sbjct  396  TYIKERYNNTPMFITENGYAEEANSNTTNEEQFNDVKRVEYMRSYLQALADTMRTKGADV  455

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYF+WSL DNFEW+ GYT + GL+  D VTLKRTP+LSA WY+QFI  N
Sbjct  456  RGYFVWSLLDNFEWTSGYTVQFGLHHVDNVTLKRTPRLSADWYRQFIVNN  505



>gb|KCW75357.1| hypothetical protein EUGRSUZ_E04103 [Eucalyptus grandis]
Length=524

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 170/230 (74%), Gaps = 3/230 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  +WFLDPII+G YP +M +ILGS LPEFS  D EKLK   GLDFIGI
Sbjct  281  ADELAAERAMSFFMSWFLDPIIFGKYPAEMIEILGSILPEFSRSDQEKLKK--GLDFIGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+YY QDC+ S C+P   G T+ EG+  QS  K+G  IG+   LE+L VYP GME +
Sbjct  339  NHYTSYYVQDCILSICEPG-KGITKTEGYYKQSSEKNGVPIGQPTDLEWLNVYPQGMEYM  397

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTYVKE+++N P+++TENGY +        E  L D KRV+++A +L+AL + +RKGADV
Sbjct  398  VTYVKERYNNTPMFITENGYGEKDDLKLKDEKPLEDLKRVEYMASHLSALLSAVRKGADV  457

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYF WSL DNFEW FGYT+R GL+  +  TLKRTPKLSA WYKQFIA++
Sbjct  458  RGYFAWSLLDNFEWQFGYTERFGLHHVNFTTLKRTPKLSASWYKQFIAEH  507



>ref|XP_010057964.1| PREDICTED: beta-glucosidase 46 isoform X3 [Eucalyptus grandis]
Length=523

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 170/230 (74%), Gaps = 3/230 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  +WFLDPII+G YP +M +ILGS LPEFS  D EKLK   GLDFIGI
Sbjct  280  ADELAAERAMSFFMSWFLDPIIFGKYPAEMIEILGSILPEFSRSDQEKLKK--GLDFIGI  337

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+YY QDC+ S C+P   G T+ EG+  QS  K+G  IG+   LE+L VYP GME +
Sbjct  338  NHYTSYYVQDCILSICEPG-KGITKTEGYYKQSSEKNGVPIGQPTDLEWLNVYPQGMEYM  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTYVKE+++N P+++TENGY +        E  L D KRV+++A +L+AL + +RKGADV
Sbjct  397  VTYVKERYNNTPMFITENGYGEKDDLKLKDEKPLEDLKRVEYMASHLSALLSAVRKGADV  456

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYF WSL DNFEW FGYT+R GL+  +  TLKRTPKLSA WYKQFIA++
Sbjct  457  RGYFAWSLLDNFEWQFGYTERFGLHHVNFTTLKRTPKLSASWYKQFIAEH  506



>ref|XP_008224799.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45-like [Prunus 
mume]
Length=513

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 174/229 (76%), Gaps = 2/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPI++G YP +M++ILG++LP FS  D+E L+    LDFIGIN
Sbjct  278  DKLAAERAQSFYMNWFLDPIVHGKYPAEMQEILGADLPIFSESDVEMLRK-NRLDFIGIN  336

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+P   G +R EGF  ++  KDG  +GE   +++L VYP GM+K+V
Sbjct  337  HYTSFYIKDCIFSECEPG-PGASRTEGFALRTAEKDGVFLGEPTSVDWLYVYPQGMDKIV  395

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+  T   NS+ E++LND KRVK++  YL+AL+  +RKGADVR
Sbjct  396  TYVKDRYNNTPIFITENGFGKTDNSNSTNEELLNDVKRVKYMRSYLHALAEAMRKGADVR  455

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ GYT R GL+  D  TLKRT +LSA WYKQFI+ +
Sbjct  456  GYFVWSLLDNFEWTSGYTVRFGLHHVDYATLKRTKRLSADWYKQFISNH  504



>ref|XP_008384043.1| PREDICTED: beta-glucosidase 47-like [Malus domestica]
Length=522

 Score =   278 bits (711),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 174/229 (76%), Gaps = 2/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPI+ G YP +M+++LG++LP FS  D+E LK  G LDFIG+N
Sbjct  287  DKLAAERAISFYMNWFLDPIVLGRYPAEMQELLGADLPAFSKSDVEMLKKTG-LDFIGLN  345

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT+ Y++DC++S C+ S TG +R EG+  ++F KDG  IGE   +++L VYP GMEK+V
Sbjct  346  HYTSCYSKDCMFSVCE-SGTGASRTEGYALRTFEKDGVFIGEPTTIDWLYVYPQGMEKIV  404

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVKE+++N P+++TENG+ +    NSS  ++L+D KR++++  YL AL+  +RKGADVR
Sbjct  405  TYVKERYNNTPMFITENGFGEIENSNSSSAELLHDVKRLEYMGSYLQALAKAMRKGADVR  464

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GY +WSL DNFEW+ GYT R GLY+ D  TLKRT +LSA WYKQFI+ +
Sbjct  465  GYLVWSLLDNFEWTSGYTIRFGLYRVDYTTLKRTQRLSAAWYKQFISNH  513



>gb|KHG29724.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=236

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 165/226 (73%), Gaps = 3/226 (1%)
 Frame = -2

Query  834  LSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGINHYTTYYAQDCL  655
            L+  FL+PI+YG YP+ M++ILGS LPEFS+ + +KLK   GLDFIGINHYT+YY QDC+
Sbjct  12   LTYRFLEPILYGRYPRQMQNILGSILPEFSATEKQKLKQ--GLDFIGINHYTSYYVQDCM  69

Query  654  YSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVVTYVKEKFSNIP  475
            +S C+P   G ++ EG+  QS  K+G  IGE   L    VYP G+EK+VTY+K ++ NIP
Sbjct  70   FSACEPG-PGTSKMEGYCAQSSQKNGTPIGEPTELAGKNVYPEGIEKIVTYLKNRYHNIP  128

Query  474  LYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVRGYFIWSLFDNF  295
            + +TENGY D   PNS+ E  L+D KRV++ A YL+ALST IRKGADVRGYFIWSL DNF
Sbjct  129  IIITENGYGDMNKPNSTTEARLHDEKRVEYFARYLDALSTAIRKGADVRGYFIWSLLDNF  188

Query  294  EWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            EW+ GYT R GL+  D  TLKRTPK SA WYK FI+++     K++
Sbjct  189  EWNNGYTVRYGLHHVDYETLKRTPKSSATWYKNFISQHMVKEPKVE  234



>ref|XP_010267720.1| PREDICTED: beta-glucosidase 46 isoform X3 [Nelumbo nucifera]
Length=522

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  NWFLDPII+G YP +M +ILGS LPEFS  + E L+   GLDFIGI
Sbjct  281  ADRLAAERAQSFYLNWFLDPIIFGKYPPEMHEILGSILPEFSRNEWEILQT--GLDFIGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+ Y +DC+ S C P  TG ++ EG   ++  KDG  IGE  G+++  V+P GMEK+
Sbjct  339  NHYTSLYVKDCISSMCKPG-TGGSKTEGLAIRTGRKDGVPIGEPTGMDWFYVHPQGMEKI  397

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + YVKE+++N P+++TENGY +    + S E+   D KRV +L  YL+AL   +RKGADV
Sbjct  398  IIYVKERYNNTPIFITENGYGEENNASFSTENFQYDIKRVNYLNGYLSALQRAMRKGADV  457

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLR  151
            RGYFIWSL DNFEW  GYTKR GLY  D  T++RTPKLSA WYKQFIA+ + + + + L 
Sbjct  458  RGYFIWSLLDNFEWICGYTKRFGLYHVDYKTMERTPKLSATWYKQFIARQKPIKAIIPLS  517

Query  150  N  148
            N
Sbjct  518  N  518



>ref|XP_010267719.1| PREDICTED: beta-glucosidase 46 isoform X2 [Nelumbo nucifera]
Length=544

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  NWFLDPII+G YP +M +ILGS LPEFS  + E L+   GLDFIGI
Sbjct  303  ADRLAAERAQSFYLNWFLDPIIFGKYPPEMHEILGSILPEFSRNEWEILQT--GLDFIGI  360

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+ Y +DC+ S C P  TG ++ EG   ++  KDG  IGE  G+++  V+P GMEK+
Sbjct  361  NHYTSLYVKDCISSMCKPG-TGGSKTEGLAIRTGRKDGVPIGEPTGMDWFYVHPQGMEKI  419

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + YVKE+++N P+++TENGY +    + S E+   D KRV +L  YL+AL   +RKGADV
Sbjct  420  IIYVKERYNNTPIFITENGYGEENNASFSTENFQYDIKRVNYLNGYLSALQRAMRKGADV  479

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLR  151
            RGYFIWSL DNFEW  GYTKR GLY  D  T++RTPKLSA WYKQFIA+ + + + + L 
Sbjct  480  RGYFIWSLLDNFEWICGYTKRFGLYHVDYKTMERTPKLSATWYKQFIARQKPIKAIIPLS  539

Query  150  N  148
            N
Sbjct  540  N  540



>ref|XP_010057961.1| PREDICTED: beta-glucosidase 46 isoform X1 [Eucalyptus grandis]
 ref|XP_010057963.1| PREDICTED: beta-glucosidase 46 isoform X2 [Eucalyptus grandis]
Length=524

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 170/231 (74%), Gaps = 4/231 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  +WFLDPII+G YP +M +ILGS LPEFS  D EKLK   GLDFIGI
Sbjct  280  ADELAAERAMSFFMSWFLDPIIFGKYPAEMIEILGSILPEFSRSDQEKLKK--GLDFIGI  337

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGE-MAGLEYLVVYPPGMEK  514
            NHYT+YY QDC+ S C+P   G T+ EG+  QS  K+G  IG+    LE+L VYP GME 
Sbjct  338  NHYTSYYVQDCILSICEPG-KGITKTEGYYKQSSEKNGVPIGQPQTDLEWLNVYPQGMEY  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE+++N P+++TENGY +        E  L D KRV+++A +L+AL + +RKGAD
Sbjct  397  MVTYVKERYNNTPMFITENGYGEKDDLKLKDEKPLEDLKRVEYMASHLSALLSAVRKGAD  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            VRGYF WSL DNFEW FGYT+R GL+  +  TLKRTPKLSA WYKQFIA++
Sbjct  457  VRGYFAWSLLDNFEWQFGYTERFGLHHVNFTTLKRTPKLSASWYKQFIAEH  507



>gb|KHG29721.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=536

 Score =   276 bits (705),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 176/239 (74%), Gaps = 3/239 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD+ AAERA SF  NWFL+PIIYG YP++M++ILGS LPEF++ + +KL    GLDFIG
Sbjct  290  VADKLAAERAQSFSINWFLEPIIYGRYPREMQNILGSILPEFTTSEKQKLNQ--GLDFIG  347

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT++Y +DC++S C+P  +G ++ EGF  QS  K+G  IGE   L +L VYP GM+K
Sbjct  348  VNHYTSFYVKDCMFSACEPG-SGTSKTEGFWAQSSQKNGIPIGEPTELSWLNVYPQGMDK  406

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K K+ NIP+ +TENGY D    +S+++++L+D KR+ F+  +L+ALST I+KGA+
Sbjct  407  IVTYLKHKYHNIPMIITENGYGDVIKADSTIDELLHDEKRIDFMDRHLDALSTAIKKGAN  466

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            V+GYF WSL DNFEW+ GYT R GL+  D  TL R PK+SA WYK  IA+++K     Q
Sbjct  467  VKGYFAWSLLDNFEWNSGYTVRFGLHHVDHKTLMRRPKMSATWYKNLIAEHRKCKGPDQ  525



>ref|XP_008224797.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
 ref|XP_008224798.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
Length=519

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 171/229 (75%), Gaps = 2/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NW LDPI++G YP +M +ILG++LP FS  D+E L+    LDFIGIN
Sbjct  284  DKLAAERAQSFYMNWLLDPIVHGRYPAEMHEILGADLPIFSESDVEMLRK-NRLDFIGIN  342

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+P   G +R EGF  Q+  KDG  +GE   +++L VYP GM+ +V
Sbjct  343  HYTSFYVKDCIFSACEPG-PGASRTEGFTLQTAEKDGVFLGEPTSVDWLYVYPQGMDNIV  401

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +T   NS+ E++LND KR +++  YL+AL+  +RKGADVR
Sbjct  402  TYVKDRYNNTPIFITENGFGETEISNSTHEELLNDAKRAEYMRSYLHALAEAMRKGADVR  461

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ GYT R GL+  D  TLKRT +LSA WYK+FI+ +
Sbjct  462  GYFVWSLLDNFEWTSGYTVRFGLHHVDYATLKRTQRLSAAWYKKFISNH  510



>ref|XP_007211830.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
 gb|EMJ13029.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
Length=505

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 173/229 (76%), Gaps = 2/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPI++G YP +M++ILG++LP FS  D+E L+    LDFIGIN
Sbjct  270  DKLAAERAQSFYLNWFLDPIVHGKYPAEMREILGADLPIFSESDVEMLRK-NRLDFIGIN  328

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+P   G +R EGF  ++  KDG  +GE   +++L VYP GM+K+V
Sbjct  329  HYTSFYIKDCIFSECEPG-PGASRTEGFALRTAEKDGVFLGEPTTVDWLYVYPQGMDKIV  387

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +T   N + E++LND KRVK++  YL+AL+  +RKGADVR
Sbjct  388  TYVKDRYNNTPIFITENGFGETEVSNFTNEELLNDVKRVKYMRSYLHALAEAMRKGADVR  447

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ GYT R GL+  D  TLKRT +LS  WYKQFI+ +
Sbjct  448  GYFVWSLLDNFEWTSGYTVRFGLHYVDYATLKRTQRLSVDWYKQFISNH  496



>ref|XP_007212382.1| hypothetical protein PRUPE_ppa005194mg [Prunus persica]
 gb|EMJ13581.1| hypothetical protein PRUPE_ppa005194mg [Prunus persica]
Length=473

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 171/229 (75%), Gaps = 2/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NW LDPI++G YP +M +ILG++LP FS  D+E L+    LDFIGIN
Sbjct  238  DKLAAERAQSFYMNWLLDPIVHGRYPAEMHEILGADLPIFSESDVEMLRK-NRLDFIGIN  296

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+P   G +R EGF  Q+  KDG  +GE   +++L VYP GM+K+V
Sbjct  297  HYTSFYVKDCIFSECEPG-PGASRTEGFTLQTAEKDGVFLGEPTSVDWLYVYPQGMDKIV  355

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVK++++N P+++TENG+ +T   NS+ E++LND KRV+++  YL+AL+  +RKGADVR
Sbjct  356  TYVKDRYNNTPIFITENGFGETEISNSTNEELLNDAKRVEYMRSYLHALAEAMRKGADVR  415

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ GYT   GL+  D  TLKRT +LSA WYK FI+ +
Sbjct  416  GYFVWSLLDNFEWTSGYTVCFGLHHVDYATLKRTQRLSAAWYKTFISNH  464



>ref|XP_002304951.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE85462.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 172/234 (74%), Gaps = 3/234 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A ERA++F  NWFLDPII G YP +M++ LGS+LP FS  +LEKLK+  G+DFIGIN
Sbjct  283  DKLAVERANAFYMNWFLDPIILGKYPTEMRETLGSDLPVFSKYELEKLKS--GVDFIGIN  340

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
             YT++Y +DC++STC+    G ++ EG   ++  KDG  IG+   L++L VYP GMEK+V
Sbjct  341  QYTSFYVKDCMFSTCEQG-PGVSKTEGLYLRTAQKDGFFIGQPTALDWLHVYPQGMEKLV  399

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY K++++NIP+Y+TENGYCD    N + + VL D +RV++++ YL+AL T +RKGADVR
Sbjct  400  TYFKDRYNNIPMYITENGYCDEENVNVTTKAVLKDVQRVEYMSSYLDALETAVRKGADVR  459

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            GYF WSL DNFEW+ GYT R GLY  D  TLKRT KLSA WYK +IA  + V +
Sbjct  460  GYFAWSLLDNFEWTSGYTIRFGLYHVDFSTLKRTRKLSATWYKDYIANYKAVRT  513



>ref|XP_004486131.1| PREDICTED: beta-glucosidase 47-like [Cicer arietinum]
Length=496

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 174/232 (75%), Gaps = 3/232 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D+ AAERA SF  NWFLDPII G YPK+M DILG +L  FS  DLEKLK+  GLDF+G
Sbjct  261  SEDKLAAERAQSFNMNWFLDPIILGKYPKEMHDILGPDLLPFSKYDLEKLKS--GLDFVG  318

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+YY +DC++STC+    G+++ EGF   S   +G  IGE   L +L V+P GMEK
Sbjct  319  INHYTSYYVKDCIFSTCEQG-KGSSKTEGFALTSPQMNGLNIGEPTALAWLYVHPQGMEK  377

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K++++NIP+++TENG+  T     + +DVLND KRV++L+ YL++L+T IRKGAD
Sbjct  378  IVTYIKDRYNNIPMFITENGFGMTENSYPTSKDVLNDVKRVEYLSGYLDSLATAIRKGAD  437

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            VRGYF+WSL DNFEW+ GY+ R GL+  D  TL RTP++SA WYK FI +++
Sbjct  438  VRGYFLWSLLDNFEWNHGYSIRFGLHHVDFETLNRTPRVSAFWYKNFIVEHK  489



>ref|XP_002305594.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86105.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=504

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 175/238 (74%), Gaps = 5/238 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AA+RA  F  NWFLDPII+G+YP +M  ILGS LP+FSS D EKLK   GLDFIG
Sbjct  272  TADKLAADRAQDFFLNWFLDPIIFGNYPAEMSKILGSTLPKFSSNDKEKLK--NGLDFIG  329

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ Y QDC++S C+P  TG +R EG   +S  KDG  IG    +++L  YP GMEK
Sbjct  330  INHYTSEYVQDCIFSVCEPG-TGASRTEGLARRSQEKDGVPIGIPTDVDWLHFYPQGMEK  388

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K++++N P+ +TENGY     PN ++  V +D +RV+F+++Y ++L T + KGAD
Sbjct  389  MVTYIKKRYNNKPMIITENGYGQQNNPNLTI--VCHDIERVEFMSNYWDSLLTAMEKGAD  446

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            VRGYF WSL DNFEW++GYT+R GLY  D  TLKRTPKLSA W+K+FIA+ +   S+M
Sbjct  447  VRGYFAWSLLDNFEWTYGYTQRYGLYHVDFTTLKRTPKLSAAWFKEFIARYKVDKSQM  504



>ref|XP_007026016.1| Beta-glucosidase 47 isoform 2 [Theobroma cacao]
 gb|EOY28638.1| Beta-glucosidase 47 isoform 2 [Theobroma cacao]
Length=417

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 174/229 (76%), Gaps = 3/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPII G YP +M++ILGS+LP FS+ D +KLK+  GLDFIG+N
Sbjct  184  DKQAAERAQSFYMNWFLDPIILGKYPLEMQEILGSDLPVFSNHDQKKLKS--GLDFIGVN  241

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+    G+++ EGF  ++  KDG  IG+   +++L VYP GM+K+V
Sbjct  242  HYTSFYIRDCMFSVCEQG-PGSSKTEGFALRTALKDGIFIGKSTAVDWLYVYPQGMDKIV  300

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+KE++++IP+++TENG+ +    +S  E+ LND  RV++++ YL+ L+  +RKGADVR
Sbjct  301  TYIKERYNSIPMFITENGFGENDKADSPTEESLNDVNRVEYISGYLDTLAAALRKGADVR  360

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ GYT R GL+  D  TL+RTP+ SA WYKQFIA +
Sbjct  361  GYFLWSLLDNFEWTSGYTIRFGLHHVDYATLERTPRASAIWYKQFIANH  409



>ref|XP_007026015.1| Beta-glucosidase 47 isoform 1 [Theobroma cacao]
 gb|EOY28637.1| Beta-glucosidase 47 isoform 1 [Theobroma cacao]
Length=427

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 174/229 (76%), Gaps = 3/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPII G YP +M++ILGS+LP FS+ D +KLK+  GLDFIG+N
Sbjct  194  DKQAAERAQSFYMNWFLDPIILGKYPLEMQEILGSDLPVFSNHDQKKLKS--GLDFIGVN  251

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT++Y +DC++S C+    G+++ EGF  ++  KDG  IG+   +++L VYP GM+K+V
Sbjct  252  HYTSFYIRDCMFSVCEQG-PGSSKTEGFALRTALKDGIFIGKSTAVDWLYVYPQGMDKIV  310

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+KE++++IP+++TENG+ +    +S  E+ LND  RV++++ YL+ L+  +RKGADVR
Sbjct  311  TYIKERYNSIPMFITENGFGENDKADSPTEESLNDVNRVEYISGYLDTLAAALRKGADVR  370

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ GYT R GL+  D  TL+RTP+ SA WYKQFIA +
Sbjct  371  GYFLWSLLDNFEWTSGYTIRFGLHHVDYATLERTPRASAIWYKQFIANH  419



>gb|KEH36818.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=418

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 166/231 (72%), Gaps = 3/231 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A ERA SF +NW LDPII+G YP  M+ ILG  LP+FS+ + EKLK+  GLDFIGI
Sbjct  183  ADKLATERARSFTNNWLLDPIIFGEYPPVMQKILGDILPKFSNNNKEKLKS--GLDFIGI  240

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY +YY +DC+YS C+P   G TR EG   QS  KDG  IG+   +++  VYP GMEK+
Sbjct  241  NHYASYYIKDCIYSKCEPG-PGITRTEGLFQQSAEKDGVPIGKPTSIDWQYVYPQGMEKI  299

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTYVK +++N P+++TENGY +   PN++ E  LND  R  ++A +L +L   IRKGADV
Sbjct  300  VTYVKTRYNNTPMFITENGYGELDNPNNTEEQYLNDFDRKNYMAGHLLSLLEAIRKGADV  359

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R GL+  D  TLKRTP+LSA WYK+FIAK++
Sbjct  360  RGYFAWSLLDNFEWLQGYTVRFGLHHVDYATLKRTPRLSANWYKEFIAKHK  410



>ref|XP_011037693.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=516

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 174/238 (73%), Gaps = 5/238 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AA+RA  F  NWFLDPII+G+YP +M  ILGS LP+FSS D EKLK   GLDFIG
Sbjct  284  TADKLAADRAQDFFLNWFLDPIIFGNYPAEMSKILGSTLPKFSSNDKEKLK--NGLDFIG  341

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+ Y QDC++S C+P  TG +R EG   +S  KDG  IG    +++L  YP GMEK
Sbjct  342  INHYTSEYVQDCIFSVCEPG-TGASRTEGLARRSQEKDGAPIGIPTDVDWLHFYPQGMEK  400

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K++++N P+ +TENGY     PN ++  V +D +RV+F++ Y ++L + + KGAD
Sbjct  401  MVTYIKKRYNNKPMIITENGYGQLNNPNLTI--VCHDIERVEFMSSYWDSLLSAMEKGAD  458

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            VRGYF WSL DNFEW++GYT+R GLY  D  TLKRTPKLSA W+K+FIA+ +   S+M
Sbjct  459  VRGYFSWSLLDNFEWTYGYTQRYGLYHVDFTTLKRTPKLSATWFKEFIARYKVDKSQM  516



>ref|XP_011037696.1| PREDICTED: beta-glucosidase 47-like [Populus euphratica]
Length=535

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 170/234 (73%), Gaps = 3/234 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A ERA++F  NWFLDPII G YP  M++ILGS+LP FS  +LEKLK+  G DFIGIN
Sbjct  303  DKLAVERANAFYMNWFLDPIILGKYPTQMREILGSDLPVFSKYELEKLKS--GADFIGIN  360

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
             YT +Y +DC +STC+    G ++ EG   ++  KDG  IG+   L++L VYP GMEK+V
Sbjct  361  QYTGFYVKDCAFSTCEQG-PGVSKTEGLYLRTAQKDGFFIGQPTALDWLHVYPQGMEKLV  419

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY K++++NIP+Y+TENGYC+    N + + VL D +RV++++ YL+AL T +RKGADVR
Sbjct  420  TYFKDRYNNIPMYITENGYCEEENVNVTTKAVLKDIQRVEYMSSYLDALETAVRKGADVR  479

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            GYF WSL DNFEW+ GYT R GLY  D  TLKRT KLSA WYK +IA ++ V +
Sbjct  480  GYFAWSLLDNFEWTSGYTIRFGLYHVDFSTLKRTRKLSATWYKDYIAHHKVVRT  533



>gb|AFK46781.1| unknown [Medicago truncatula]
Length=521

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 165/228 (72%), Gaps = 3/228 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  NW LDPII+G YPK+M+++LGS LP+FSS   EK K   GLDFIGI
Sbjct  280  ADKLAAERARSFTFNWILDPIIFGKYPKEMENVLGSLLPKFSSN--EKKKLMKGLDFIGI  337

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+YT++Y QDC+Y+ CD S +G +R EG    S  ++G  IGE     +  +YP GMEK 
Sbjct  338  NYYTSFYVQDCIYTKCD-SRSGTSRTEGSYMTSGYRNGVSIGEATPFTWFNIYPQGMEKT  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTYVK++++N P+++TENGY      N ++ED LND KR+K++  ++ ALST IRKGADV
Sbjct  397  VTYVKDRYNNTPMFITENGYGQQDDQNLTLEDQLNDFKRIKYMKSHIEALSTAIRKGADV  456

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            RGYF WSL DNFEW +GYT R G +  D  TLKRTP+LSA WYKQFI 
Sbjct  457  RGYFAWSLLDNFEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQFIV  504



>ref|XP_003610400.1| Beta-glucosidase [Medicago truncatula]
 gb|AES92597.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 165/228 (72%), Gaps = 3/228 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  NW LDPII+G YPK+M+++LGS LP+FSS   EK K   GLDFIGI
Sbjct  280  ADKLAAERARSFTFNWILDPIIFGKYPKEMENVLGSLLPKFSSN--EKKKLMKGLDFIGI  337

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+YT++Y QDC+Y+ CD S +G +R EG    S  ++G  IGE     +  +YP GMEK 
Sbjct  338  NYYTSFYVQDCIYTKCD-SRSGTSRTEGSYMTSGYRNGVSIGEATPFTWFNIYPQGMEKT  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTYVK++++N P+++TENGY      N ++ED LND KR+K++  ++ ALST IRKGADV
Sbjct  397  VTYVKDRYNNTPMFITENGYGQQDDQNLTLEDQLNDFKRIKYMKSHIEALSTAIRKGADV  456

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            RGYF WSL DNFEW +GYT R G +  D  TLKRTP+LSA WYKQFI 
Sbjct  457  RGYFAWSLLDNFEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQFIV  504



>ref|XP_010267718.1| PREDICTED: beta-glucosidase 46 isoform X1 [Nelumbo nucifera]
Length=857

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  NWFLDPII+G YP +M +ILGS LPEFS  + E L+   GLDFIGI
Sbjct  616  ADRLAAERAQSFYLNWFLDPIIFGKYPPEMHEILGSILPEFSRNEWEILQT--GLDFIGI  673

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+ Y +DC+ S C P  TG ++ EG   ++  KDG  IGE  G+++  V+P GMEK+
Sbjct  674  NHYTSLYVKDCISSMCKPG-TGGSKTEGLAIRTGRKDGVPIGEPTGMDWFYVHPQGMEKI  732

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + YVKE+++N P+++TENGY +    + S E+   D KRV +L  YL+AL   +RKGADV
Sbjct  733  IIYVKERYNNTPIFITENGYGEENNASFSTENFQYDIKRVNYLNGYLSALQRAMRKGADV  792

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLR  151
            RGYFIWSL DNFEW  GYTKR GLY  D  T++RTPKLSA WYKQFIA+ + + + + L 
Sbjct  793  RGYFIWSLLDNFEWICGYTKRFGLYHVDYKTMERTPKLSATWYKQFIARQKPIKAIIPLS  852

Query  150  N  148
            N
Sbjct  853  N  853



>gb|KEH36817.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 166/231 (72%), Gaps = 3/231 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A ERA SF +NW LDPII+G YP  M+ ILG  LP+FS+ + EKLK+  GLDFIGI
Sbjct  286  ADKLATERARSFTNNWLLDPIIFGEYPPVMQKILGDILPKFSNNNKEKLKS--GLDFIGI  343

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY +YY +DC+YS C+P   G TR EG   QS  KDG  IG+   +++  VYP GMEK+
Sbjct  344  NHYASYYIKDCIYSKCEPG-PGITRTEGLFQQSAEKDGVPIGKPTSIDWQYVYPQGMEKI  402

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTYVK +++N P+++TENGY +   PN++ E  LND  R  ++A +L +L   IRKGADV
Sbjct  403  VTYVKTRYNNTPMFITENGYGELDNPNNTEEQYLNDFDRKNYMAGHLLSLLEAIRKGADV  462

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R GL+  D  TLKRTP+LSA WYK+FIAK++
Sbjct  463  RGYFAWSLLDNFEWLQGYTVRFGLHHVDYATLKRTPRLSANWYKEFIAKHK  513



>ref|XP_006468001.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Citrus sinensis]
Length=509

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 174/230 (76%), Gaps = 13/230 (6%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AAERA +F  NWFLDPII+G YPK+M +ILGS+LP  S  DLEKLK   GLDFIGI
Sbjct  283  GDKLAAERAQAFYLNWFLDPIIFGKYPKEMYEILGSSLPSLSKYDLEKLK--NGLDFIGI  340

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+Y+++Y +DC++S C+P   GN++ EG + ++  ++G LIGE          P  M ++
Sbjct  341  NYYSSFYVKDCIFSVCEPG-PGNSKTEGSILRTAKRNGVLIGE----------PVRMSEI  389

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTY+KE+++NIP+Y+TENG+ +   P++S+ED+LNDT+RV++++++L++L+  +R GADV
Sbjct  390  VTYIKERYNNIPMYITENGFGERDNPHTSIEDLLNDTRRVRYMSNHLDSLAIAVRNGADV  449

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYF WSL DNFEW+ GYT R GL+  D  TLKRT +LSA WYKQ+IAK+
Sbjct  450  RGYFAWSLLDNFEWNDGYTIRFGLHHVDYATLKRTKRLSANWYKQYIAKH  499



>ref|XP_011037698.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=405

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 168/240 (70%), Gaps = 3/240 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD  A +RA  F  NWFLDPII+G YP +M  ILGS LP+FSS D E+LK   GLDFIG
Sbjct  165  TADNLATDRAQDFFMNWFLDPIIFGKYPAEMTKILGSALPKFSSNDRERLKK--GLDFIG  222

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT +Y QDC +  C P   G +R EG   Q   KDG  IG+ + ++++ VYP GMEK
Sbjct  223  INHYTGFYIQDCSFVVCKPGQ-GGSRTEGLAQQVQEKDGVPIGKSSEVDWIHVYPQGMEK  281

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++TY+KE+++N P+ VTENG+   +  N ++E+ L D +RV++++ YL++L T + KGAD
Sbjct  282  MITYLKERYNNTPMIVTENGFGQESYLNRTIEEYLQDRERVEYMSGYLDSLMTAMLKGAD  341

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            VRGYF WSL DNFEW  GYT+R GL+  D  TLKR P+LSA W+K+FIA+ +  +   +L
Sbjct  342  VRGYFAWSLLDNFEWGHGYTRRFGLHHVDYTTLKRIPRLSATWFKEFIARYKITSHSCRL  401



>ref|XP_003529622.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03066.1| Beta-glucosidase 46 [Glycine soja]
Length=524

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 168/233 (72%), Gaps = 3/233 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ A+ERA +F  NWFLDPII+G YP +M+++LGS LP+FSS + EKLK   GLDFIG
Sbjct  277  TADKLASERARAFNFNWFLDPIIFGKYPTEMENVLGSLLPKFSSYEKEKLKR--GLDFIG  334

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +N+YT +Y QDC+YS C P   G +R EG   +S  K+G  IGE     +  +YP GMEK
Sbjct  335  VNYYTAFYVQDCMYSACKPG-PGISRTEGSYKKSGEKNGVPIGEPTPFSWFNIYPDGMEK  393

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
             VTYV+++++N P+++TENGY +   PN + E+ LND KR+K++ D++ AL   IRKGAD
Sbjct  394  TVTYVRDRYNNTPIFLTENGYAEEVDPNFTSEEHLNDFKRIKYMVDHIEALLAAIRKGAD  453

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK  175
            VRGYF W+L D+FEW +GYT R G +  D  TLKRTP+LSA WYKQ + + +K
Sbjct  454  VRGYFAWTLIDSFEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQLLVQYKK  506



>ref|XP_002518516.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF43903.1| beta-glucosidase, putative [Ricinus communis]
Length=511

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 170/234 (73%), Gaps = 3/234 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A ERA +F   WFLDPII G YP +M +ILG +LP FS+ +LEKLK+A  LDFIGIN
Sbjct  279  DKLAVERAQAFYLYWFLDPIILGKYPSEMHEILGVDLPAFSNHELEKLKSA--LDFIGIN  336

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY+++Y +DC++S C+    G T+ EGF  ++  KD   IGE   +++L +YP GME +V
Sbjct  337  HYSSFYIKDCIFSVCNQG-PGITKAEGFALRTAEKDSFFIGEPTSIDWLYIYPKGMENIV  395

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+KE+++NIP+++TENG+ +    ++SM  +LND KRV++L+ YL +L T +RKGAD+R
Sbjct  396  TYIKERYNNIPMFITENGFGEKENHSTSMNFLLNDVKRVEYLSSYLESLETAVRKGADIR  455

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            GYF WSL DNFEW  GYT R GLY  D  TLKRT KLSA WYK +I+ ++  NS
Sbjct  456  GYFAWSLLDNFEWRDGYTVRFGLYHVDFSTLKRTQKLSATWYKDYISTHRANNS  509



>gb|AFK44109.1| unknown [Medicago truncatula]
Length=521

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 163/228 (71%), Gaps = 3/228 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF  NW LDPII+G YPK+M+++LGS LP+FSS   EK K   GLDFIGI
Sbjct  280  ADKLAAERARSFTFNWILDPIIFGKYPKEMENVLGSLLPKFSSN--EKKKLMKGLDFIGI  337

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+YT++Y QDC+Y+ CD S +G +R EG    S  ++G  IGE     +  +YP GMEK 
Sbjct  338  NYYTSFYVQDCIYTKCD-SRSGTSRTEGSYMTSGYRNGVSIGEATPFTWFNIYPQGMEKT  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTYVK++++N P+++TENGY      N + ED LND KR+K++  ++ ALST IRKGADV
Sbjct  397  VTYVKDRYNNTPMFITENGYGQQDDQNLTSEDQLNDFKRIKYMKSHIEALSTAIRKGADV  456

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            RGYF WSL DN EW +GYT R G +  D  TLKRTP+LSA WYKQFI 
Sbjct  457  RGYFAWSLLDNLEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQFIV  504



>gb|KHN33045.1| Beta-glucosidase 47 [Glycine soja]
Length=525

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 169/227 (74%), Gaps = 3/227 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPII G YP +M +ILG +LP FS  D+EKLK+  GLDFIG+N
Sbjct  287  DKLAAERAQSFYMNWFLDPIIIGEYPAEMHEILGQDLPTFSRYDVEKLKS--GLDFIGVN  344

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT+ +A+DC++S C+    G++R EGF  +S   +G  IGE   L++L V+P GMEK++
Sbjct  345  HYTSAFAKDCIFSACEQG-RGSSRTEGFTLRSPQMNGISIGEPTALDWLYVHPQGMEKIL  403

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+K +++NIP+++TENG       N + ++++ND +RV++L  YL++L+T IRKGADVR
Sbjct  404  TYLKHRYNNIPMFITENGIGMRENSNHATKEIINDVERVEYLRGYLDSLATAIRKGADVR  463

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            GYF+WSL DNFEW+ GY+ R GL+  D  TL RTP++SA WYK FIA
Sbjct  464  GYFVWSLLDNFEWTDGYSIRFGLHHVDYATLNRTPRMSAFWYKNFIA  510



>ref|XP_007147745.1| hypothetical protein PHAVU_006G151400g [Phaseolus vulgaris]
 gb|ESW19739.1| hypothetical protein PHAVU_006G151400g [Phaseolus vulgaris]
Length=451

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 171/229 (75%), Gaps = 4/229 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D+ AAERA SF  NWFLDP+I G YP++M++ILG +LP     +LEKLK A  +DFIG
Sbjct  212  SEDKIAAERAQSFFMNWFLDPVIRGEYPREMREILGEDLPPVP-YNLEKLKPA--IDFIG  268

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT+Y+ +DC++S C+P + G+TR EGF  +    +G  IGE   L +L VYP GMEK
Sbjct  269  VNHYTSYFVKDCIHSVCEPGL-GSTRTEGFALKLAKMNGMSIGEPTSLHWLYVYPQGMEK  327

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+KE+++NIP+++TENG       N + ++++ND +RV++L  YL++L+T IRKGAD
Sbjct  328  IVTYIKERYNNIPMFITENGVGMRENSNLTTKEMINDVERVEYLRAYLDSLATAIRKGAD  387

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            VRGYF+WSL DNFEW+ G + R GL++ D  TL+RTP++SA WYK FIA
Sbjct  388  VRGYFLWSLLDNFEWTEGSSIRFGLHRVDYDTLQRTPRMSASWYKNFIA  436



>ref|XP_008441244.1| PREDICTED: beta-glucosidase 47 [Cucumis melo]
Length=522

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 167/228 (73%), Gaps = 4/228 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  A ERA SF  NWFLDPI++G+YP  M++ILG +LP FS+ D +KLK   G DFIGIN
Sbjct  284  DILATERAFSFYMNWFLDPIVFGNYPAVMEEILGLDLPHFSTEDQKKLK--NGADFIGIN  341

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT+YYA+DCL+S C+P   G+++ EGF   + +K+   IGE   + ++ VYP GM K+V
Sbjct  342  HYTSYYAKDCLHSFCEPGQ-GSSKIEGFTFWTPTKEETSIGEPTEISWIYVYPQGMNKMV  400

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+KE++ N+P++VTENGY     PN+  ED+L+DT+RV ++  YL AL T++R+GADVR
Sbjct  401  TYIKERY-NVPIFVTENGYGQKNKPNNQTEDLLDDTRRVDYMRSYLGALETSMREGADVR  459

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK  184
            GYF WSL DNFEW  GYT+R GL   D  TLKRTPKLS  WYK FIA+
Sbjct  460  GYFAWSLLDNFEWMNGYTERFGLCHVDYTTLKRTPKLSTFWYKNFIAQ  507



>ref|XP_009137214.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=520

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 167/230 (73%), Gaps = 8/230 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YP++MKDILG +LPEF+  DL++ K   GLDFIGI
Sbjct  289  ADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPEFTKDDLKRSK--NGLDFIGI  346

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL++ C+P   G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  347  NQYTSRYAKDCLHTACEPGQ-GGSRAEGFVYSNALKDGLPLGEPTGVNWFNVYPQGMEEM  405

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ +  T       +LND +RV+F+++YL+AL T +RKGADV
Sbjct  406  LMYATERYRNIPLYVTENGFGENNTGV-----LLNDYRRVEFMSNYLDALKTAMRKGADV  460

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI KN
Sbjct  461  RGYFTWSLLDNFEWISGYTIRFGMYHVDFDTLERTPRLSASWYKNFIFKN  510



>ref|XP_004508228.1| PREDICTED: uncharacterized protein LOC101501316 [Cicer arietinum]
Length=1078

 Score =   274 bits (701),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 170/236 (72%), Gaps = 3/236 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ A ERA SF  NWFLDPII+G YPK+M++ILG  LP+FS+ + +KL    GLDFIG
Sbjct  289  TADKLATERARSFTFNWFLDPIIFGKYPKEMENILGCLLPKFSTNEKKKLNK--GLDFIG  346

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y QDC+Y+TCD S  G +R EG   +S  K+G  IGE     +  +YP GMEK
Sbjct  347  INYYTASYVQDCIYTTCD-SRFGISRTEGSYMKSGGKNGVSIGEQTAFSWFNIYPQGMEK  405

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
             VTYVK++++N P+++TENGY     PN ++ED L+D  R+K+++++L ALST IRKGAD
Sbjct  406  TVTYVKDRYNNTPMFITENGYAQQDDPNFTLEDQLHDFTRIKYMSNHLEALSTAIRKGAD  465

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYF WSL DNFEW +GYT R G +  D  TLKRTP+LSA WYKQFIA   K  S
Sbjct  466  VRGYFAWSLLDNFEWIYGYTVRYGFHYVDFATLKRTPRLSASWYKQFIANYYKETS  521



>ref|XP_010665547.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 46-like [Beta 
vulgaris subsp. vulgaris]
Length=573

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 167/229 (73%), Gaps = 3/229 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NW LDPI++G YP++M+ ILG NLP FS  + + L  A  LDFIGIN
Sbjct  327  DKLAAERAQSFFLNWILDPIMFGEYPEEMRKILGPNLPRFSKKEKKILNNA--LDFIGIN  384

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY++YYAQDC++S C     G +  EG   ++ SK+G LIGE   +++L + P GMEK+V
Sbjct  385  HYSSYYAQDCMFSRCKAG-PGVSWTEGLYLRTPSKNGILIGEPTAMDWLYISPQGMEKMV  443

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TYVKE+++N P+++TENGY   +  N  + ++L+DTKRV+++A YL++L   I++GADVR
Sbjct  444  TYVKERYNNTPMFITENGYAQESNQNCVLNELLSDTKRVEYMAGYLDSLLRAIKQGADVR  503

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF WSL DNFEW +GYTKR GLY  D  TLKR+PKLS  WY+ FIA +
Sbjct  504  GYFAWSLLDNFEWLYGYTKRFGLYHVDYHTLKRSPKLSVAWYRNFIANH  552



>emb|CDX98704.1| BnaA03g44890D [Brassica napus]
Length=505

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 166/230 (72%), Gaps = 8/230 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YP++MKDILG +LPEF+  DL++ K   GLDFIGI
Sbjct  274  ADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPEFTKDDLKRSK--NGLDFIGI  331

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL++ C+P   G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  332  NQYTSRYAKDCLHTACEPGQ-GGSRAEGFVYSNALKDGLPLGEPTGVNWFNVYPQGMEEM  390

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ +  T       +LND +RV+F+++YL+AL T +RKGADV
Sbjct  391  LMYATERYRNIPLYVTENGFGENNTGV-----LLNDYRRVEFMSNYLDALKTAMRKGADV  445

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYF WSL DNFEW  GYT R G+Y  D   L+RTP+LSA WYK FI KN
Sbjct  446  RGYFTWSLLDNFEWISGYTIRFGMYHVDFDNLERTPRLSASWYKNFIFKN  495



>emb|CDY68226.1| BnaCnng58130D, partial [Brassica napus]
Length=438

 Score =   260 bits (664),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 166/236 (70%), Gaps = 8/236 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YPK+M+ ILG +LP+F+  DL+  K   GLDFIGI
Sbjct  208  ADRLAAERAQAFYLTWFLDPLVFGRYPKEMQKILGKDLPKFTRDDLKSSK--NGLDFIGI  265

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE  G+ +  VYP GM+++
Sbjct  266  NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNAIKDGLALGEPTGVNWFNVYPQGMKEM  324

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ + +T       +LND +RV+F+++YL+A    +RKGADV
Sbjct  325  LMYATERYKNIPLYVTENGFGENSTGV-----LLNDYRRVQFMSNYLDAFKRAMRKGADV  379

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            RGYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI K+    SK
Sbjct  380  RGYFTWSLLDNFEWISGYTVRFGMYHVDSNTLERTPRLSASWYKNFIFKHTSSQSK  435



>ref|XP_011652764.1| PREDICTED: beta-glucosidase 47 [Cucumis sativus]
 gb|KGN64542.1| hypothetical protein Csa_1G064150 [Cucumis sativus]
Length=523

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 168/228 (74%), Gaps = 4/228 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  A+ERA SF  NWFLDPI++G+YP  M++ILG +LP FS+ D +KLK   G DFIGIN
Sbjct  284  DILASERALSFYMNWFLDPIVFGNYPAVMEEILGLDLPNFSTEDQKKLK--NGADFIGIN  341

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT+YYA+DCL+S+C+P   G+++ EGFV  +  K+  LIGE   + ++ V P GM K+V
Sbjct  342  HYTSYYAKDCLHSSCEPGQ-GSSKIEGFVFWTPMKEEILIGEPTEISWIYVNPQGMNKMV  400

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+KE++ N+P++VTENGY     PN+  ED+L+DT R+ ++  YL AL T++R+GADVR
Sbjct  401  TYIKERY-NVPIFVTENGYGQKNKPNNQTEDLLDDTGRIDYMRSYLGALETSMREGADVR  459

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK  184
            GYF WSL DNFEW  GYT+R GL   D  TLKRTPKLS  WYK FIA+
Sbjct  460  GYFAWSLLDNFEWMNGYTERFGLCHVDYTTLKRTPKLSTFWYKNFIAQ  507



>ref|XP_009135228.1| PREDICTED: beta-glucosidase 47 isoform X3 [Brassica rapa]
Length=508

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 167/236 (71%), Gaps = 8/236 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AAERA +F   WFLDPI++G YP++M++ILG +LP+F+  DL+  K   GLDFIGI
Sbjct  278  ADSLAAERAQAFYLTWFLDPIVFGRYPREMQEILGQDLPKFTRDDLKSSK--NGLDFIGI  335

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  336  NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLALGEPTGVNWFNVYPQGMEEM  394

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ + +T       +LND +RVKF+++YL+AL   +RKGADV
Sbjct  395  LMYATEQYKNIPLYVTENGFGENSTGV-----LLNDYRRVKFMSNYLDALKRAMRKGADV  449

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
             GYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI+K+    SK
Sbjct  450  GGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHMSSQSK  505



>ref|XP_006343294.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=499

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 166/228 (73%), Gaps = 3/228 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D  A +RA SF+ NWFLDPIIYG YP++M+ ILG NLP FS  D++KLK   GLDFIG
Sbjct  262  SQDNYATQRARSFVYNWFLDPIIYGKYPEEMQKILGKNLPIFSRNDIKKLK--NGLDFIG  319

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT  Y +DCLYS C+     ++  EG   ++  KDG  IGE   +++L VYP GMEK
Sbjct  320  LNHYTAAYIKDCLYSVCEHGQY-SSWSEGSYFRATEKDGVYIGEPTAVDWLFVYPQGMEK  378

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  ++  PNSS+ED LNDT+RV+++ +YLN+L+  +R+GAD
Sbjct  379  LVMYMKDRFNNTPVIITENGIAESDHPNSSLEDALNDTQRVEYMHNYLNSLANAMREGAD  438

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF WSL DNFEW  GYTKR GL+  +   L+RTPKLSA  YK+ I
Sbjct  439  VRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRYKELI  486



>ref|XP_009135219.1| PREDICTED: beta-glucosidase 47 isoform X2 [Brassica rapa]
Length=522

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 167/236 (71%), Gaps = 8/236 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AAERA +F   WFLDPI++G YP++M++ILG +LP+F+  DL+  K   GLDFIGI
Sbjct  292  ADSLAAERAQAFYLTWFLDPIVFGRYPREMQEILGQDLPKFTRDDLKSSK--NGLDFIGI  349

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  350  NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLALGEPTGVNWFNVYPQGMEEM  408

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ + +T       +LND +RVKF+++YL+AL   +RKGADV
Sbjct  409  LMYATEQYKNIPLYVTENGFGENSTGV-----LLNDYRRVKFMSNYLDALKRAMRKGADV  463

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
             GYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI+K+    SK
Sbjct  464  GGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHMSSQSK  519



>emb|CDO99725.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 171/236 (72%), Gaps = 3/236 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D+ AAERA SF  NWFLDPII G YP +M+ ILGS LP F   ++ ++K   GLDFIG
Sbjct  264  SEDKLAAERAQSFFLNWFLDPIICGRYPAEMQQILGSQLPNFQRQEVSEIKL--GLDFIG  321

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT++YA+DC+YSTC+    G +R EG+  ++  KDG  IGE   +++L V+P GM K
Sbjct  322  INHYTSFYAKDCIYSTCEQG-PGVSRSEGYYLRTAFKDGVPIGETTAVDWLYVHPQGMYK  380

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++++N P+++TENGY +    NSS++D + D +RV+++  YL +L+  IR GA+
Sbjct  381  IVMYIKDRYNNTPMFITENGYGELNKLNSSVKDFIKDYRRVEYMNSYLASLALAIRNGAN  440

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYF WSL DNFEW+ GYT R GL+  D  TL+RTPKLSA W+KQ I+ ++ ++S
Sbjct  441  VRGYFAWSLLDNFEWTSGYTIRFGLHHVDFATLERTPKLSADWFKQLISYHRSLSS  496



>ref|XP_009135212.1| PREDICTED: beta-glucosidase 47 isoform X1 [Brassica rapa]
Length=528

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 167/236 (71%), Gaps = 8/236 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AAERA +F   WFLDPI++G YP++M++ILG +LP+F+  DL+  K   GLDFIGI
Sbjct  298  ADSLAAERAQAFYLTWFLDPIVFGRYPREMQEILGQDLPKFTRDDLKSSK--NGLDFIGI  355

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  356  NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLALGEPTGVNWFNVYPQGMEEM  414

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ + +T       +LND +RVKF+++YL+AL   +RKGADV
Sbjct  415  LMYATEQYKNIPLYVTENGFGENSTGV-----LLNDYRRVKFMSNYLDALKRAMRKGADV  469

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
             GYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI+K+    SK
Sbjct  470  GGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHMSSQSK  525



>gb|KHG29722.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=561

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 176/264 (67%), Gaps = 28/264 (11%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD+ AAERA SF  NWFL+PIIYG YP++M++ILGS LPEF++ + +KL    GLDFIG
Sbjct  290  VADKLAAERAQSFSINWFLEPIIYGRYPREMQNILGSILPEFTTSEKQKLNQ--GLDFIG  347

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT++Y +DC++S C+P  +G ++ EGF  QS  K+G  IGE   L +L VYP GM+K
Sbjct  348  VNHYTSFYVKDCMFSACEPG-SGTSKTEGFWAQSSQKNGIPIGEPTELSWLNVYPQGMDK  406

Query  513  VVTYVKEKFSNIPLYVTENG-------------------------YCDTTTPNSSMEDVL  409
            +VTY+K K+ NIP+ +TENG                         Y D    +S+++++L
Sbjct  407  IVTYLKHKYHNIPMIITENGRRKTEALMHKETYLYTHNVSCFYIGYGDVIKADSTIDELL  466

Query  408  NDTKRVKFLADYLNALSTTIRKGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKR  229
            +D KR+ F+  +L+ALST I+KGA+V+GYF WSL DNFEW+ GYT R GL+  D  TL R
Sbjct  467  HDEKRIDFMDRHLDALSTAIKKGANVKGYFAWSLLDNFEWNSGYTVRFGLHHVDHKTLMR  526

Query  228  TPKLSAKWYKQFIAKNQKVNSKMQ  157
             PK+SA WYK  IA+++K     Q
Sbjct  527  RPKMSATWYKNLIAEHRKCKGPDQ  550



>ref|XP_003547247.2| PREDICTED: beta-glucosidase 47-like [Glycine max]
Length=929

 Score =   268 bits (686),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 169/227 (74%), Gaps = 3/227 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF  NWFLDPII G YP +M +ILG +LP FS  D+EKLK+  GLDFIG+N
Sbjct  691  DKLAAERAQSFYMNWFLDPIIIGEYPAEMHEILGQDLPTFSRYDVEKLKS--GLDFIGVN  748

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYT+ +A+DC++S C+    G++R EGF  +S   +G  IGE   L++L V+P GMEK++
Sbjct  749  HYTSAFAKDCIFSACEQG-RGSSRTEGFTLRSPQMNGISIGEPTALDWLYVHPQGMEKIL  807

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+K +++NIP+++TENG       N + ++++ND +RV++L  YL++L+T IRKGADVR
Sbjct  808  TYLKHRYNNIPMFITENGIGMRENSNHATKEIINDVERVEYLRGYLDSLATAIRKGADVR  867

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            GYF+WSL DNFEW+ GY+ R GL+  D  TL RTP++SA WYK FIA
Sbjct  868  GYFVWSLLDNFEWTDGYSIRFGLHHVDYATLNRTPRMSAFWYKNFIA  914



>ref|XP_007026018.1| Beta glucosidase 46 isoform 2, partial [Theobroma cacao]
 gb|EOY28640.1| Beta glucosidase 46 isoform 2, partial [Theobroma cacao]
Length=497

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 157/201 (78%), Gaps = 3/201 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF   WFLDPII+G YP +M++ILGS LPEFS+ + EKL    GLDFIG+
Sbjct  242  ADKLAAERAQSFTMKWFLDPIIFGRYPPEMQNILGSILPEFSTTEKEKLNK--GLDFIGV  299

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY++YY +DC++S C+P  TG ++ EGF GQS  K+G  IGE+  L++L VYP GMEK+
Sbjct  300  NHYSSYYVKDCMFSVCEPG-TGTSKTEGFWGQSSQKNGIPIGELTDLDWLNVYPQGMEKI  358

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTY+KE + NIP+ +TENGY + +  NS+ E+ L+D KRV++LA YL+ LST IRKGADV
Sbjct  359  VTYLKETYHNIPMIITENGYGEVSKANSTTEEFLHDVKRVEYLAGYLDQLSTAIRKGADV  418

Query  330  RGYFIWSLFDNFEWSFGYTKR  268
            RGYF+WSL DNFEW+FGYT +
Sbjct  419  RGYFVWSLLDNFEWNFGYTVK  439



>ref|XP_006391958.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
 gb|ESQ29244.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
Length=518

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 170/230 (74%), Gaps = 4/230 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF SNW LDPIIYG YPK+M  ILGSNLP FS +++E ++ +G LDF+GIN
Sbjct  286  DREAAERAQSFYSNWILDPIIYGKYPKEMVTILGSNLPRFSRMEMENIRKSG-LDFVGIN  344

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEKV  511
            HYT+Y+ QDCL+STC+    G  + EGF  +   + GN+ IGE+  + +  ++P G +K+
Sbjct  345  HYTSYFVQDCLFSTCNAG-DGAFKAEGFALK-LDRKGNVSIGELTDVNWQHIHPEGFQKM  402

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K ++ NI +++TENG+ D   P ++++++LNDTKR+++++ YL+AL + IR GA+V
Sbjct  403  LNYLKNRYHNITMFITENGFGDLQKPETTVKELLNDTKRIQYMSGYLDALQSAIRDGANV  462

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            +GYF WSL DNFEW +GY  R GL+  D  TL+RTPKLSA WYK +I ++
Sbjct  463  KGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLERTPKLSASWYKNYIEEH  512



>ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula]
Length=1051

 Score =   268 bits (686),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 165/232 (71%), Gaps = 3/232 (1%)
 Frame = -2

Query  873   TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
              AD+ AAERA SF  NW LDPI +G YPK+M+ ILGS LP+FSS D  KL    GLDFIG
Sbjct  786   VADKLAAERAQSFSMNWILDPIFFGKYPKEMEVILGSTLPKFSSNDKAKLNR--GLDFIG  843

Query  693   INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
             INHY  YY +DC+ S C+ S  G +  EG   Q+  KDG  IGE+   ++L VYP GM+K
Sbjct  844   INHYAGYYVKDCISSVCE-SGPGTSATEGLYQQTAQKDGVPIGELTPFDFLNVYPQGMKK  902

Query  513   VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
              +TYVK++++N P+++TENGY +   PN++ E+ LND KR+ +++ +LN L  +IR+GAD
Sbjct  903   TLTYVKDRYNNTPMFITENGYGNFYDPNNTKEEYLNDIKRINYMSGHLNNLGESIREGAD  962

Query  333   VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
             VRGYF WSL DNFEW +G+T R GLY  D  T KRTPKLSA WYK FI K++
Sbjct  963   VRGYFAWSLLDNFEWLYGFTVRFGLYHVDFATQKRTPKLSASWYKHFIEKHK  1014



>gb|ACJ83780.1| unknown [Medicago truncatula]
Length=241

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 155/217 (71%), Gaps = 3/217 (1%)
 Frame = -2

Query  828  NWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGINHYTTYYAQDCLYS  649
            NW LDPI +G YPK+M+ ILGS LP+FSS D  KL    GLDFIGINHY  YY +DC+ S
Sbjct  2    NWILDPIFFGKYPKEMEVILGSTLPKFSSNDKAKLNR--GLDFIGINHYAGYYVKDCISS  59

Query  648  TCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVVTYVKEKFSNIPLY  469
             C+ S  G +  EG   Q+  KDG  IGE+   ++L VYP GM+K +TYVK++++N P++
Sbjct  60   VCE-SGPGTSATEGLYQQTAQKDGVPIGELTPFDFLNVYPQGMKKTLTYVKDRYNNTPMF  118

Query  468  VTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVRGYFIWSLFDNFEW  289
            +TENGY +   PN++ E+ LND KR+ +++ +LN L  +IR+GADVRGYF WSL DNFEW
Sbjct  119  ITENGYGNFYDPNNTKEEYLNDIKRINYMSGHLNNLGESIREGADVRGYFAWSLLDNFEW  178

Query  288  SFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
             +G+T R GLY  D  T KRTPKLSA WYK FI K++
Sbjct  179  LYGFTVRFGLYHVDFATQKRTPKLSASWYKHFIEKHK  215



>emb|CDX94055.1| BnaC07g36890D [Brassica napus]
Length=519

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 163/231 (71%), Gaps = 8/231 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD  AAERA +F   WFLDP+++G YP++MKDILG +LPEF+  DL+  K   GLDFIG
Sbjct  287  VADSLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPEFTKDDLKSSK--NGLDFIG  344

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN YT+ YA+DCL++ C+P   G +R EGFV  +  K+G  +GE   + +  VYP GME+
Sbjct  345  INQYTSRYAKDCLHTACEPGQ-GGSRAEGFVYSNALKNGLPLGERTRVNWFNVYPQGMEE  403

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y  E++ NIPLYVTENG+ +  T       +LND +RVKF+++YL+AL   +RKGAD
Sbjct  404  MLMYATERYRNIPLYVTENGFGENNTGV-----LLNDYRRVKFMSNYLDALKRAMRKGAD  458

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            VRGYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI KN
Sbjct  459  VRGYFTWSLLDNFEWISGYTIRFGMYHVDFDTLERTPRLSASWYKNFIFKN  509



>gb|AES92596.2| glucose 6-phosphate/phosphate translocator 1 [Medicago truncatula]
Length=1029

 Score =   268 bits (684),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 165/232 (71%), Gaps = 3/232 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD+ AAERA SF  NW LDPI +G YPK+M+ ILGS LP+FSS D  KL    GLDFIG
Sbjct  764  VADKLAAERAQSFSMNWILDPIFFGKYPKEMEVILGSTLPKFSSNDKAKLNR--GLDFIG  821

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY  YY +DC+ S C+ S  G +  EG   Q+  KDG  IGE+   ++L VYP GM+K
Sbjct  822  INHYAGYYVKDCISSVCE-SGPGTSATEGLYQQTAQKDGVPIGELTPFDFLNVYPQGMKK  880

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
             +TYVK++++N P+++TENGY +   PN++ E+ LND KR+ +++ +LN L  +IR+GAD
Sbjct  881  TLTYVKDRYNNTPMFITENGYGNFYDPNNTKEEYLNDIKRINYMSGHLNNLGESIREGAD  940

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            VRGYF WSL DNFEW +G+T R GLY  D  T KRTPKLSA WYK FI K++
Sbjct  941  VRGYFAWSLLDNFEWLYGFTVRFGLYHVDFATQKRTPKLSASWYKHFIEKHK  992



>emb|CDX98706.1| BnaA03g44910D [Brassica napus]
Length=296

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 163/230 (71%), Gaps = 11/230 (5%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YP++MKDILG +LP+F+  DL+  K   GLDFIGI
Sbjct  62   ADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPKFTKDDLKSSK--NGLDFIGI  119

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL++TC+    G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  120  NQYTSRYAKDCLHTTCELGQ-GGSRAEGFVYSNALKDGLPLGEPTGVNWFNVYPQGMEEM  178

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYL---NALSTTIRKG  340
            + Y  E++ NIPLYVTENG+ +  T       +LND +RVKF+++YL   +AL   +RKG
Sbjct  179  LMYATERYRNIPLYVTENGFGENNTGV-----LLNDYRRVKFMSNYLGPVHALKRAMRKG  233

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            ADVRGYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI
Sbjct  234  ADVRGYFTWSLLDNFEWISGYTIRFGMYHVDFDTLERTPRLSASWYKNFI  283



>ref|XP_004234482.1| PREDICTED: beta-glucosidase 46-like [Solanum lycopersicum]
Length=517

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 168/228 (74%), Gaps = 3/228 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D  A +RA SF+ NWFLDPII+G YP++M+ ILG+NLP+FS  D++KLK   GLDFIG
Sbjct  281  SEDNYATQRARSFVYNWFLDPIIFGKYPEEMQKILGNNLPKFSRNDIKKLK--NGLDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT  Y +DCL+S C+     ++  EG   ++  KDG  IGE   +++L VYP GMEK
Sbjct  339  LNHYTAAYIKDCLFSVCEHGQY-SSWSEGSYFRATEKDGVYIGEPTTMDWLFVYPQGMEK  397

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  ++  PNSS+ED LNDT+RV+++ +YLN+L+  +R+GA+
Sbjct  398  LVMYMKDRFNNTPIIITENGIAESDNPNSSLEDALNDTQRVEYMHNYLNSLANAMREGAN  457

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF WSL DNFEW  GYTKR GL+  +   L+RTPKLSA  YK+ I
Sbjct  458  VRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRYKELI  505



>gb|KFK28775.1| hypothetical protein AALP_AA7G045800 [Arabis alpina]
Length=492

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 164/231 (71%), Gaps = 8/231 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A ERA +F   WFLDPI++G YP++M+DILG +LP+F+  DL+  K+  GLDFIGI
Sbjct  261  ADRLAVERAQAFYLTWFLDPIVFGRYPREMQDILGKDLPKFTKDDLKSSKS--GLDFIGI  318

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G TR EGFV  +  KDG  +GE  G+++  +YP GMEK+
Sbjct  319  NQYTSRYAKDCLHSKCEPG-KGGTRVEGFVYANAHKDGLPLGEPTGVDWFNIYPQGMEKM  377

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ +  T       +LND +RV F++ YL+AL   +RKGADV
Sbjct  378  LMYATERYKNIPLYVTENGFGENNTGV-----LLNDYRRVNFMSSYLDALKRAMRKGADV  432

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R GLY  D  T +RTP+LSA WYK FI +++
Sbjct  433  RGYFTWSLLDNFEWISGYTIRFGLYHVDFDTQERTPRLSASWYKNFIFQHR  483



>ref|XP_007026019.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
 gb|EOY28641.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
Length=540

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 157/201 (78%), Gaps = 3/201 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF   WFLDPII+G YP +M++ILGS LPEFS+ + EKL    GLDFIG+
Sbjct  285  ADKLAAERAQSFTMKWFLDPIIFGRYPPEMQNILGSILPEFSTTEKEKLNK--GLDFIGV  342

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY++YY +DC++S C+P  TG ++ EGF GQS  K+G  IGE+  L++L VYP GMEK+
Sbjct  343  NHYSSYYVKDCMFSVCEPG-TGTSKTEGFWGQSSQKNGIPIGELTDLDWLNVYPQGMEKI  401

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            VTY+KE + NIP+ +TENGY + +  NS+ E+ L+D KRV++LA YL+ LST IRKGADV
Sbjct  402  VTYLKETYHNIPMIITENGYGEVSKANSTTEEFLHDVKRVEYLAGYLDQLSTAIRKGADV  461

Query  330  RGYFIWSLFDNFEWSFGYTKR  268
            RGYF+WSL DNFEW+FGYT +
Sbjct  462  RGYFVWSLLDNFEWNFGYTVK  482



>ref|XP_009770584.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=538

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 167/232 (72%), Gaps = 5/232 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D+ AA+RA SF+ NWFLDPII+G YP++M+ ILG+NLP FSS DL+KL    GLDFIG
Sbjct  304  SEDKYAAQRARSFVYNWFLDPIIFGRYPEEMQQILGNNLPVFSSNDLKKLN--NGLDFIG  361

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT  Y +DCLYS C+    G +  EG   ++  KDG  IG+   +++L VYP GMEK
Sbjct  362  INHYTAAYIKDCLYSACE---HGTSWSEGSYFRTTEKDGVYIGQPTTMDWLFVYPQGMEK  418

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  ++  PNSS+ D LNDT RV+++  +LN+L+  IR+GAD
Sbjct  419  LVMYMKDRFNNTPIIITENGIAESDNPNSSLADSLNDTPRVEYMHSHLNSLANAIREGAD  478

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            VRGYF WSL DNFEW  GYTKR GL+  +   L+RTPKLSA   K+ ++  Q
Sbjct  479  VRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRCKELMSNFQ  530



>gb|KEH36812.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=420

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 165/234 (71%), Gaps = 3/234 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D+ AAER  SF  NWFLDPII G YP +M +ILG +L  FS  D EK K   GLDFIG
Sbjct  182  TEDKLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK--NGLDFIG  239

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+YY +DC++S C+    G+++ EGF   S   +   IGE   L +  V+P GME 
Sbjct  240  INHYTSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMEN  298

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K++++NIP+++TENG+  + +   + E  LND KRV++L+ YL++L+T IRKGAD
Sbjct  299  IVTYIKDRYNNIPMFITENGFGTSESSYPTTEYELNDVKRVEYLSSYLDSLATAIRKGAD  358

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            V+GYF+WS+ DNFEW+ GY+ R GL+  D  TL RTP+ SA WYK FI++++ +
Sbjct  359  VKGYFVWSILDNFEWNHGYSIRFGLHHVDFATLNRTPRGSAFWYKNFISEHKNL  412



>ref|XP_006413734.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 ref|XP_006413736.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55187.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55189.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=524

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 165/231 (71%), Gaps = 8/231 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YP++M++I G +LP+F+  DL+  K   GLDFIGI
Sbjct  294  ADRLAAERAQAFYLTWFLDPVVFGRYPREMQEIFGEDLPQFTKDDLKSSK--NGLDFIGI  351

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE  G+++  VYP GME++
Sbjct  352  NQYTSRYAKDCLHSACEPGQ-GGSRAEGFVNANALKDGLALGEPTGVDWFNVYPQGMEEM  410

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ +  T       ++ND +RVK+++ YL+AL   +RKGAD+
Sbjct  411  LMYATERYKNIPLYVTENGFGENNTGV-----LVNDYRRVKYMSSYLDALKRAMRKGADI  465

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R GLY  D  TL+RTP+LSA WYK FI +++
Sbjct  466  RGYFTWSLLDNFEWISGYTIRFGLYHVDFNTLERTPRLSASWYKNFIFQHR  516



>ref|XP_009137215.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=521

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YP++MKDILG +LP+F+  DL+  K   GLDFIGI
Sbjct  290  ADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPKFTKDDLKSSK--NGLDFIGI  347

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL++TC+    G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  348  NQYTSRYAKDCLHTTCELGQ-GGSRAEGFVYSNALKDGLPLGEPTGVNWFNVYPQGMEEM  406

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ +  T       +LND +RVKF+++YL+AL   +RKGADV
Sbjct  407  LMYATERYRNIPLYVTENGFGENNTGV-----LLNDYRRVKFMSNYLDALKRAMRKGADV  461

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            RGYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI
Sbjct  462  RGYFTWSLLDNFEWISGYTIRFGMYHVDFDTLERTPRLSASWYKNFI  508



>ref|XP_009105752.1| PREDICTED: beta-glucosidase 45-like [Brassica rapa]
Length=516

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 167/231 (72%), Gaps = 4/231 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDPIIYG YPK+M ++LGS LP FS  ++E LK    LDFIGI
Sbjct  283  ADREAAERAQSFYSNWILDPIIYGKYPKEMVNVLGSALPRFSRKEMENLKQLR-LDFIGI  341

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL+STC+    G ++ +GF  +   + GN+ IGE+  + +  ++P G  K
Sbjct  342  NHYTSYFIQDCLFSTCNAG-DGASKAQGFALK-LDRKGNVSIGELTDVNWQHIHPEGFRK  399

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
             + Y+K ++ NIP+++TENG+ D   P +++ ++LNDTKR+++++ YL+AL + +R GA+
Sbjct  400  TLNYLKNRYHNIPMFITENGFGDLQKPETTLTELLNDTKRIQYMSGYLDALQSAMRDGAN  459

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            V+GYF WSL DNFEW +GY  R GL+  D  +LKRTPKLSA WYK +I ++
Sbjct  460  VKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTSLKRTPKLSASWYKNYIGEH  510



>ref|XP_010430203.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 169/232 (73%), Gaps = 4/232 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+AAAERA +F SNW LDP+IYG YPK+M +ILGS LP FS  ++E LK +   DF+G
Sbjct  284  TADKAAAERAQAFYSNWILDPVIYGKYPKEMVNILGSALPRFSKKEVEYLKESQS-DFVG  342

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGME  517
            INHYT+Y+ QDCL S+C+    G ++ EG+      + GNL IGE+  + +  ++P G  
Sbjct  343  INHYTSYFIQDCLLSSCNIGF-GASKVEGY-ALKLDRKGNLTIGELTDVNWQHIHPEGFR  400

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            K++ Y+K+++ NIP+++TENG+ D   P ++++++LND KR+++++ YL+AL + +R GA
Sbjct  401  KMLNYLKDRYHNIPMFITENGFGDLQKPETTVKELLNDAKRIQYMSGYLDALQSAMRDGA  460

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            +V+GYF WSL DNFEW +GY  R GLY  D VTLKRTPK SA WY+ +I +N
Sbjct  461  NVKGYFAWSLLDNFEWLYGYKLRFGLYHVDPVTLKRTPKRSASWYRNYIGEN  512



>ref|XP_009794795.1| PREDICTED: beta-glucosidase 46-like, partial [Nicotiana sylvestris]
Length=239

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 159/228 (70%), Gaps = 8/228 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA  RA SF  +WFLDPII G YPK+M  ILGSNLPE S  DL KL  + GLDFIG
Sbjct  6    SEDIAATHRARSFYDSWFLDPIILGRYPKEMVQILGSNLPELSMNDLSKL--SYGLDFIG  63

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+  Y +DCLYS C+    GN+  EG   ++  +DG  IGE   +++  VYP G+EK
Sbjct  64   INHYSAVYIKDCLYSACE---HGNSWSEGSYFRTTQRDGIYIGEPGEVDWQFVYPQGIEK  120

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            VV Y+K+KF+N P+++TENG+   +   SS+ED LND +RVK+L   LN+L+  IRKGAD
Sbjct  121  VVMYLKDKFNNTPMFITENGFAGNS---SSIEDALNDVRRVKYLHSNLNSLANAIRKGAD  177

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY+ R GLY  +   L+RTPKLSA  Y++ +
Sbjct  178  VRGYFVWSLLDNFEWLDGYSIRFGLYYVNYTNLQRTPKLSATKYQELM  225



>emb|CDY47163.1| BnaA01g22890D [Brassica napus]
Length=516

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 166/231 (72%), Gaps = 4/231 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDPIIYG YPK+M ++LGS LP FS  ++E LK    LDFIGI
Sbjct  283  ADREAAERAQSFYSNWILDPIIYGKYPKEMVNVLGSALPRFSRKEMENLKQLR-LDFIGI  341

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL+STC+    G +  +GF  +   + GN+ IGE+  + +  ++P G  K
Sbjct  342  NHYTSYFIQDCLFSTCNAG-DGASEAQGFALK-LDRKGNVSIGELTDVNWQHIHPEGFRK  399

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
             + Y+K ++ NIP+++TENG+ D   P +++ ++LNDTKR+++++ YL+AL + +R GA+
Sbjct  400  TLNYLKNRYHNIPMFITENGFGDLQKPETTLTELLNDTKRIQYMSGYLDALQSAMRDGAN  459

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            V+GYF WSL DNFEW +GY  R GL+  D  +LKRTPKLSA WYK +I ++
Sbjct  460  VKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTSLKRTPKLSASWYKNYIGEH  510



>ref|XP_007153925.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
 gb|ESW25919.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
Length=517

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 166/228 (73%), Gaps = 3/228 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ A ERA SF +NW LDPI++G YPK+M+ ILG+ LP+FSS D  KL+   GLDFIG
Sbjct  264  TADKLATERAQSFSTNWILDPILFGKYPKEMEMILGTILPKFSSNDKAKLRR--GLDFIG  321

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+Y +YY +DC+ S C     G T+ EG   Q+  K+G  IGE+   ++L VYP GM+ 
Sbjct  322  INYYASYYVRDCISSVCGYG-KGVTKTEGSYEQTVLKNGVPIGELTPFDWLNVYPQGMKN  380

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            V+ Y+K++++N P+++TENGY     P+ + E+ LND KR++F++ +L+ L   I++GAD
Sbjct  381  VLIYLKDRYNNTPMFITENGYATLYDPDVTEEEYLNDYKRIEFMSGHLDNLMAAIKEGAD  440

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW +G++ + GL+  D VTLKRTPKLSA WYK+FI
Sbjct  441  VRGYFVWSLLDNFEWKYGFSAKFGLHHIDHVTLKRTPKLSASWYKRFI  488



>gb|KEH36806.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 165/234 (71%), Gaps = 3/234 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D+ AAER  SF  NWFLDPII G YP +M +ILG +L  FS  D EK K   GLDFIG
Sbjct  283  TEDKLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK--NGLDFIG  340

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+YY +DC++S C+    G+++ EGF   S   +   IGE   L +  V+P GME 
Sbjct  341  INHYTSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMEN  399

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+K++++NIP+++TENG+  + +   + E  LND KRV++L+ YL++L+T IRKGAD
Sbjct  400  IVTYIKDRYNNIPMFITENGFGTSESSYPTTEYELNDVKRVEYLSSYLDSLATAIRKGAD  459

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            V+GYF+WS+ DNFEW+ GY+ R GL+  D  TL RTP+ SA WYK FI++++ +
Sbjct  460  VKGYFVWSILDNFEWNHGYSIRFGLHHVDFATLNRTPRGSAFWYKNFISEHKNL  513



>ref|XP_006301036.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
 gb|EOA33934.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
Length=520

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 168/232 (72%), Gaps = 1/232 (0%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F SNW LDP+I+G YPK+M ++LGS LP FS  ++E LK +   DF+GI
Sbjct  286  ADKEAAERAQAFYSNWILDPVIHGKYPKEMVNLLGSALPRFSKKEVENLKESRS-DFVGI  344

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+Y+ QDCL S+C+ +  G ++ EG+  +   K    IGE+  + +  ++P G  K+
Sbjct  345  NHYTSYFIQDCLLSSCNNTGNGGSKVEGYALKLNRKGNVTIGELTDVVWQHIHPEGFRKM  404

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K+++ NIP+++TENG+ D   P ++++++L+D+KRV++++ YL+AL + +R GA+V
Sbjct  405  LNYLKDRYHNIPMFITENGFGDLQKPETTVKELLDDSKRVQYMSGYLDALQSAMRDGANV  464

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK  175
            +GYF WSL DNFEW +GY  R GLY  D VTLKRTPK SA WY+ +I +N +
Sbjct  465  KGYFAWSLLDNFEWLYGYKLRFGLYHVDNVTLKRTPKRSASWYRNYIGENLR  516



>ref|XP_007147744.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
 gb|ESW19738.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
Length=521

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 167/229 (73%), Gaps = 4/229 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D+ AAERA +F  NWFLDP I G YP++M++ILG +LP     +LEKLK +  +DFIG
Sbjct  282  SEDKIAAERAQAFYMNWFLDPAIRGEYPREMREILGKDLPPVP-YELEKLKPS--IDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHYT+Y+ +DC++S C+P + G+TR EG+       +G  IG+   LE+L +YP G+EK
Sbjct  339  VNHYTSYFVKDCIHSECEPGL-GSTRTEGYALTWAHINGMTIGKPTSLEWLFIYPEGLEK  397

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTY+KE+F+NIP+Y+TENG       N + ++++ND  R+ +L  YL++L+  IRKGAD
Sbjct  398  IVTYIKERFNNIPIYLTENGVGGKENANMTTKEIINDVDRIDYLRAYLDSLARAIRKGAD  457

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            VRGYF+WSL DNFEW+ G + R GL++ D  TL+RTP++SA WYK FIA
Sbjct  458  VRGYFLWSLLDNFEWTDGSSIRFGLHRVDYDTLQRTPRMSASWYKNFIA  506



>ref|XP_006348092.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=517

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 156/228 (68%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA ERA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  281  SEDIAATERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY--GLDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCLYS C+    GNT  EG    +  KDG  IG+  G+E+L +YP GM+K
Sbjct  339  INYYTANYIKDCLYSACE---HGNTWSEGSYFATIEKDGVFIGQPTGVEWLFLYPQGMKK  395

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K+KF+N P+ +TENG  +    N S+ D LND  RV ++  YLN+L+  IR+GAD
Sbjct  396  IVMYMKDKFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANAIREGAD  455

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YKQ +
Sbjct  456  VRGYFVWSLLDNFEWLDGYKLRFGLHFVNYTNLQRTPKLSATRYKQLM  503



>ref|XP_010418158.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 169/231 (73%), Gaps = 4/231 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+AAAERA +F SNW LDP+IYG YPK+M +ILGS LP FS  ++E LK +   DF+GI
Sbjct  285  ADKAAAERAQAFYSNWILDPVIYGKYPKEMVNILGSALPRFSRKEVECLKESQS-DFVGI  343

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL S+C+  + G ++ EG+  +   + GNL IGE   + +  ++P G  K
Sbjct  344  NHYTSYFIQDCLLSSCNIGV-GASKVEGYALK-LDRKGNLTIGEPTDINWQHIHPEGFRK  401

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K+++ NIP+++TENG+ D   P ++++++LND KR+++++ YL+AL + +R GA+
Sbjct  402  MLNYLKDRYHNIPMFITENGFGDLQKPETTVKELLNDAKRIQYMSGYLDALQSAMRDGAN  461

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            V+GYF WSL DNFEW +GY  R GLY  D VTLKRTPK SA WY+ +I +N
Sbjct  462  VKGYFAWSLLDNFEWLYGYKLRFGLYHVDPVTLKRTPKRSASWYRNYIGEN  512



>ref|XP_010273571.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=513

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 159/232 (69%), Gaps = 5/232 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  A +RA +F + WFLDPIIYG YP +M+ ILGS LP FS  D +KL     LDFIG+N
Sbjct  271  DNFAVQRALAFDTAWFLDPIIYGEYPPEMRQILGSRLPTFSLEDKKKL--GNKLDFIGVN  328

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT Y +DC++S C+ S +         G+   KDG+ IG    +  L V P GMEK++
Sbjct  329  HYTTLYVKDCMFSQCESSTSLGEASVYITGE---KDGHPIGHPTAMPSLYVVPYGMEKII  385

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y KE+++NIP+++TENGY   + PN+S  D+LND  RV++L  YL +++  ++ GADVR
Sbjct  386  MYFKERYNNIPMFITENGYAQASNPNTSKRDILNDNGRVEYLKSYLASVNLAMKHGADVR  445

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            GYFIWSL DNFEW +GYT R G+Y  D  TL+RTPKLSA WYKQF+A  +K+
Sbjct  446  GYFIWSLIDNFEWLYGYTLRFGIYYVDYNTLERTPKLSAMWYKQFLAGREKI  497



>ref|XP_006391959.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
 gb|ESQ29245.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
Length=520

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 167/231 (72%), Gaps = 4/231 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP++YG YP++M DILGS LP FSS ++  LK     DF+GI
Sbjct  282  ADKKAAERAQSFYSNWILDPVVYGRYPQEMVDILGSALPRFSSNEMMNLKRYKS-DFLGI  340

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDC+ S C+ S  G ++ EGF  +   ++GN+ IGE+  + +L + P G  K
Sbjct  341  NHYTSYFIQDCMTSACN-SGDGASKSEGFALK-LDRNGNVSIGELTDVSWLHIDPEGFRK  398

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K+++ NIP+++TENGY D   P ++++++LNDT+R+ +++ YL+AL   +R GA+
Sbjct  399  MLNYLKDRYPNIPMFITENGYGDLQKPETTVKELLNDTRRIHYMSGYLDALKDAMRDGAN  458

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            V+GYF WSL DNFEW +GYT R GLY  D  TLKRTPK SA WYK FI ++
Sbjct  459  VKGYFAWSLLDNFEWLYGYTLRFGLYHVDYTTLKRTPKQSALWYKNFIEQH  509



>ref|XP_011628484.1| PREDICTED: beta-glucosidase 18 [Amborella trichopoda]
Length=518

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 163/243 (67%), Gaps = 5/243 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA+RA +F S WFLDPI++G YP +M+ ILGS LP FS  +  KL+   GLDFIGI
Sbjct  273  VDRIAAQRALAFESAWFLDPIVFGDYPPEMRQILGSRLPRFSKEERRKLQ--NGLDFIGI  330

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+ Y +DCL+S C     G +  EGF      ++G  IGE   +    VYP GMEK+
Sbjct  331  NHYTSLYVKDCLFSEC---TYGMSSIEGFYSMILEREGIPIGEPTAMTTFYVYPQGMEKI  387

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+KE+++N+P+++TENGY   +TP +  E+ ++D +RVK+L  YL +L+  IRKGA+V
Sbjct  388  VMYMKERYNNLPMFITENGYAQGSTPKAKAEEFVDDAERVKYLGSYLESLANAIRKGANV  447

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLR  151
            +GY +WSL DNFEW  GY  R GLY  D  T KRTPKLSA WYK FI   +K ++    +
Sbjct  448  KGYMVWSLLDNFEWLNGYNMRFGLYHVDFSTFKRTPKLSADWYKGFIQNYKKHHNISYTQ  507

Query  150  NMI  142
            ++I
Sbjct  508  SLI  510



>ref|XP_009599228.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=388

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 161/229 (70%), Gaps = 9/229 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA  RA SF  +WFLDPII G+YPK+M  ILGSNLPEFS  DL KL    GLDFIG
Sbjct  154  SEDIAATHRARSFYDSWFLDPIILGTYPKEMVQILGSNLPEFSMNDLSKLSY--GLDFIG  211

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+  Y +DCLYS C+    GN+  EG   ++  +DG  IGE   +++  VYP G+EK
Sbjct  212  INHYSACYIKDCLYSACE---NGNSWSEGSYFRTTQRDGIYIGEPGEVDWQFVYPQGIEK  268

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            VV Y+KEKF+N P+++TENG+   +   SS+ED+LND +RVK+L   LN+L+  IRKGAD
Sbjct  269  VVMYLKEKFNNTPMFITENGFAGNS---SSIEDILNDVRRVKYLHSNLNSLANAIRKGAD  325

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRV-TLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GYT R GLY  +    L+RTPKLSA  Y++ +
Sbjct  326  VRGYFVWSLLDNFEWLDGYTIRFGLYYVNYTNNLQRTPKLSATKYQELM  374



>ref|XP_009617373.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=531

 Score =   252 bits (644),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 165/232 (71%), Gaps = 5/232 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D++AA+RA SF+ NWFLDPII+G YP++M+ ILG+NLP FSS DL+KL    GLDFIG
Sbjct  296  SEDKSAAQRARSFVYNWFLDPIIFGRYPEEMQQILGTNLPAFSSNDLKKLN--NGLDFIG  353

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN YT  Y +DCLYS C+    G +  EG   ++  KDG  IG+   +++L VYP GMEK
Sbjct  354  INLYTAAYIKDCLYSACE---NGTSWSEGSYFRTTEKDGVYIGKPTTMDWLFVYPQGMEK  410

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  ++  PNSS+ D L DT+RV+++  +L  L+  +R+GAD
Sbjct  411  IVMYMKDRFNNTPIIITENGIAESDNPNSSLADALIDTQRVEYMHSHLKFLANAMREGAD  470

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            VRGYF WSL DNFEW  GYTKR GL+  +   L+RTPKLSA  YK+  +  Q
Sbjct  471  VRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRYKELTSNFQ  522



>ref|XP_009763871.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=374

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 158/228 (69%), Gaps = 8/228 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA  RA SF  +WFLDPII G YPK+M  ILGSNLPE S  DL KL    GLDFIG
Sbjct  141  SEDIAATHRARSFYDSWFLDPIILGRYPKEMVQILGSNLPELSMNDLSKLSY--GLDFIG  198

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+  Y +DCLYS C+    GN+  EG   ++  +DG  IGE   +++  VYP G+EK
Sbjct  199  INHYSAVYIKDCLYSACE---HGNSWSEGSYFRTTQRDGIYIGEPGEVDWQFVYPQGIEK  255

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            VV Y+K+KF+N P+++TENG+   +   SS+ED LND +RVK+L   LN+L+  IRKGAD
Sbjct  256  VVMYLKDKFNNTPMFITENGFAGNS---SSIEDALNDVRRVKYLHSNLNSLANAIRKGAD  312

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY+ R GLY  +   L+RTPKLSA  Y++ +
Sbjct  313  VRGYFVWSLLDNFEWLDGYSIRFGLYYVNYTNLQRTPKLSATKYQELM  360



>ref|XP_006383935.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
 gb|ERP61732.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
Length=503

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 161/238 (68%), Gaps = 15/238 (6%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD  A +RA  FL NWFLDPII+G YP +M  ILGS +P+FSS D EKL    GLDFIG
Sbjct  281  TADNLATDRAQDFLMNWFLDPIIFGKYPAEMTKILGSAIPKFSSNDREKLNK--GLDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT +Y QDC +  C P   G +R EG   QS             ++++ VYP GMEK
Sbjct  339  INHYTGFYIQDCSFVVCKPGQ-GGSRTEGLAQQS------------EVDWIHVYPQGMEK  385

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++TY+KE+++N P+ +TENG+   +  N ++E+ L D  RV++++ YL++L T + KGAD
Sbjct  386  IITYLKERYNNTPMIITENGFGQESYLNRTIEEYLQDRDRVEYMSGYLDSLMTAMLKGAD  445

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            VRGYF WSL DNFEW  GYT+R GL+  D  TLKR P+LSA W+K+FIA+ +   S+M
Sbjct  446  VRGYFAWSLLDNFEWGRGYTRRFGLHHVDYTTLKRIPRLSATWFKEFIARYKVDKSQM  503



>gb|KFK40642.1| hypothetical protein AALP_AA2G023000 [Arabis alpina]
Length=516

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 168/236 (71%), Gaps = 6/236 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP++YG YPK+M  ILGS LP+FSS ++  LK     DF+GI
Sbjct  284  ADKKAAERAQSFYSNWILDPVVYGRYPKEMVHILGSALPQFSSNEMNNLKNLKS-DFLGI  342

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ +DCL S C  S  G ++ EGF  +   + GN+ IGE+  +++  ++P G  K
Sbjct  343  NHYTSYFIRDCLSSAC-ISGDGASKIEGFALK-LDRKGNVSIGELTDVDWQHIHPEGFRK  400

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K+++ NIP+++TENGY  T  P +++E++LNDTKR++F++ YL+AL   +R GA+
Sbjct  401  MLNYLKDRYPNIPIFITENGYGQTQKPETAVEEILNDTKRIQFMSGYLDALQGAMRDGAN  460

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            V+GYF WSL D FEW +GY  R GL+  D  TLKRTPK SA WYK+FI   Q +NS
Sbjct  461  VKGYFAWSLLDGFEWFYGYKLRFGLFHVDYTTLKRTPKQSASWYKKFI--EQHLNS  514



>ref|XP_009608375.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=512

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 156/230 (68%), Gaps = 8/230 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA  RA SF  NWFLDPII G YPK+M  ILGSNLPEFS  DL  L    GLDFIG
Sbjct  279  SEDIAATHRARSFYGNWFLDPIILGRYPKEMVQILGSNLPEFSMSDLSLLSY--GLDFIG  336

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+  Y +DCLYS C+    GN+  EG    +  +DG  IGE   +++  VYP G+EK
Sbjct  337  INHYSAVYIKDCLYSACE---HGNSWSEGSYLTTTQRDGIYIGEPGEVDWQFVYPQGIEK  393

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            VV Y+KE+F+N P+++TENG+   +   SS+ED LND  RVK+L  YL +L+  I+KGAD
Sbjct  394  VVMYMKERFNNTPMFITENGFAGNS---SSIEDTLNDVHRVKYLHSYLYSLANAIKKGAD  450

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK  184
            VRGYFIWSL DNFEW  GYT R GLY  +   L+RTPKLSA  Y+Q I  
Sbjct  451  VRGYFIWSLLDNFEWLDGYTIRFGLYYVNYTNLQRTPKLSATKYQQLICN  500



>ref|XP_010316607.1| PREDICTED: beta-glucosidase 18 isoform X2 [Solanum lycopersicum]
Length=425

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 155/228 (68%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AAAERA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  189  SEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY--GLDFIG  246

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCLYS C+    GNT  EG    +  KDG  IG+  G  ++ +YP GM+K
Sbjct  247  INYYTAKYIKDCLYSACE---HGNTWSEGSYLATTEKDGVYIGQPTGAPWIFLYPQGMKK  303

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y++E+F+N P+ +TENG  +    N S+ D LND+ RV +L   LN+L+  IR+GAD
Sbjct  304  IVMYMRERFNNTPVVITENGIAENDNLNPSITDTLNDSHRVNYLYSCLNSLANAIREGAD  363

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YKQ +
Sbjct  364  VRGYFVWSLLDNFEWLHGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  411



>ref|XP_002869865.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46124.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 163/231 (71%), Gaps = 8/231 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YP++M++ILG +LPEF++ DL+  K    LDFIGI
Sbjct  295  ADRLAAERAQAFYLTWFLDPVVFGRYPREMREILGEDLPEFTTDDLKSSKNT--LDFIGI  352

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL S C+P   G +R EGFV     KDG  +GE  G+ +  VYP GME++
Sbjct  353  NQYTSRYAEDCLDSVCEPG-KGGSRAEGFVYAKALKDGLPLGEPTGVNWFSVYPQGMEEM  411

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  +++ NIPLYVTENG+ +  T       +LND +R+KF+++YL+AL   +RKGADV
Sbjct  412  LMYATKRYKNIPLYVTENGFGENNTGV-----LLNDYRRLKFMSNYLDALKRAMRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R G+Y  D  T +RTP+LSA WYK FI +++
Sbjct  467  RGYFAWSLLDNFEWISGYTIRFGMYHVDFNTQERTPRLSASWYKNFIFQHR  517



>ref|XP_007153927.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
 gb|ESW25921.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
Length=528

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 167/236 (71%), Gaps = 3/236 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF  NWFLDPII G YP +M+++LGS LP+ SS + EKLK    LDFIG
Sbjct  281  TADKLAAERARSFTFNWFLDPIILGKYPTEMENLLGSLLPKISSKEKEKLKKG--LDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +N+YT +Y QDC+YS C     GN+R EG   +S  ++G  IGE     +  +YP GMEK
Sbjct  339  VNYYTAFYVQDCMYSRCKTGQ-GNSRTEGLYMKSGVRNGFPIGEPTTFSWFNIYPDGMEK  397

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
             VTYVK++++N P+++TENGY     PN ++E+ LND+KR+K++ D++ A+   IRKGAD
Sbjct  398  AVTYVKDRYNNTPMFITENGYGQEDDPNFTLEEHLNDSKRIKYMVDHIEAMVAAIRKGAD  457

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGY  WSL D+FEW +GYT R G +  D  TLKRTP+LSA W+KQF+ K ++  S
Sbjct  458  VRGYLAWSLLDSFEWIYGYTVRYGFHHVDFATLKRTPRLSASWFKQFLVKYKETFS  513



>ref|XP_009105279.1| PREDICTED: beta-glucosidase 46-like isoform X2 [Brassica rapa]
Length=406

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 162/228 (71%), Gaps = 2/228 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF SNW LDP++YG YP++M ++LGS LP+FS  +++ LK     DF+G
Sbjct  168  TADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSIKEMKNLKRYKS-DFLG  226

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+Y+ QDCL S C+ S  G +R EGF  +   K    +GE+  + +L + P G  K
Sbjct  227  INHYTSYFIQDCLISACN-SGDGASRSEGFALKLIQKGNVSVGEVTDVSWLNIDPEGFRK  285

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+ +++ NIP+++TENG  +   P ++++++LNDTKRV++L+ YL+AL T +R GA+
Sbjct  286  MLNYLTDRYPNIPMFITENGLGELQKPETTVKELLNDTKRVRYLSGYLDALQTAMRDGAN  345

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            V+GYF WSL DNFEW +GY  R G++  D  TLKRTPK SA WYK FI
Sbjct  346  VKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTTLKRTPKQSAYWYKNFI  393



>ref|XP_010449006.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 161/227 (71%), Gaps = 8/227 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A ERA +F   WFLDP+++G YPK+M++IL  +LPEF+  DL+   ++  LDFIGI
Sbjct  295  ADKLATERAQAFFVTWFLDPVVFGRYPKEMQEILNEDLPEFTKDDLKS--SSNKLDFIGI  352

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+STC+P   G +R EG+V  +  KDG  +GE  G+ +   YP GME++
Sbjct  353  NQYTSRYAKDCLHSTCEPG-KGGSRAEGYVNANALKDGLHLGEPTGVNWFSTYPQGMEEM  411

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ +IPLYVTENG+ +  T       +LND +RVKF+++YL+A+   +RKGADV
Sbjct  412  LMYATERYKDIPLYVTENGFGENNTGV-----LLNDYRRVKFMSNYLDAVKRAMRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            RGYF WSL DNFEW  GYT R G+Y  D +T +RTP+LSA WYK FI
Sbjct  467  RGYFAWSLLDNFEWISGYTIRFGMYHVDFITQERTPRLSAFWYKNFI  513



>ref|XP_010439426.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 162/231 (70%), Gaps = 8/231 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A ERA +F   WFLDP+++G YP++M++ILG +LP+F+  DL+    +  LDFIGI
Sbjct  295  ADKLATERAQAFFVTWFLDPVVFGRYPREMQEILGEDLPQFTKDDLKSF--SNKLDFIGI  352

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EG+V  +  KDG  +GE  G+ +   YP GME++
Sbjct  353  NQYTSRYAKDCLHSACEPG-KGGSRAEGYVNANALKDGLHLGEPTGVNWFATYPQGMEEM  411

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ +IPLYVTENG+ +  T       +LND +RVKF+++YL+A+   +RKGADV
Sbjct  412  LMYATERYKDIPLYVTENGFGENNTGA-----LLNDYRRVKFMSNYLDAVKRAMRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R G+Y  D +T +RTP+LSA WYK FI  ++
Sbjct  467  RGYFAWSLLDNFEWISGYTVRFGMYHVDFITQERTPRLSAFWYKNFIFHHR  517



>emb|CDX94056.1| BnaC07g36900D [Brassica napus]
Length=529

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 158/227 (70%), Gaps = 8/227 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDP+++G YP++MKDILG  LP+F+    +  K   GLDFIGI
Sbjct  298  ADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEYLPKFTKDGFKSSK--NGLDFIGI  355

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL++ C P   G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  356  NQYTSRYAKDCLHTACKPGQ-GGSRAEGFVYSNALKDGLPLGEPTGVNWFKVYPQGMEEM  414

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG+ +  T       +LND + VKF+++YL+AL   +RKGADV
Sbjct  415  LMYATERYRNIPLYVTENGFGENNTGV-----LLNDYRSVKFMSNYLDALKRAMRKGADV  469

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            RGYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI
Sbjct  470  RGYFTWSLLDNFEWISGYTVRFGMYHVDFDTLERTPRLSASWYKNFI  516



>ref|XP_009774064.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=509

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 157/230 (68%), Gaps = 8/230 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA +RA SF +NWFLDPII G YP++M  ILGSNLPEFS  DL  L    GLDFIG
Sbjct  276  SEDIAATQRARSFYTNWFLDPIILGRYPEEMVQILGSNLPEFSVSDLRMLSY--GLDFIG  333

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+  Y +DCLYS C+    GN+  EG    +  +DG  IGE   +++  VYP G+EK
Sbjct  334  INHYSAVYIKDCLYSACE---HGNSWSEGSYLTTTQRDGVYIGEPGEVDWQFVYPQGIEK  390

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            VV Y+K++F+N P+++TENG+   +   SS+ED LND  RVK++  YLN+L+  IRKGAD
Sbjct  391  VVMYIKDRFNNTPMFITENGFAGNS---SSIEDALNDVHRVKYMHSYLNSLANAIRKGAD  447

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK  184
            VRGYF WSL DNFEW  GYT R GLY  +   L+RTPKLSA  Y + +  
Sbjct  448  VRGYFAWSLLDNFEWLDGYTIRFGLYYVNYTNLQRTPKLSATKYPELMCN  497



>ref|XP_006348091.1| PREDICTED: probable inactive beta-glucosidase 14-like [Solanum 
tuberosum]
Length=517

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 155/228 (68%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AAAERA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  281  SEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY--GLDFIG  338

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCL+S C+    GNT  EG    +  KDG  IG+  G  ++ +YP GM+K
Sbjct  339  INYYTAKYIKDCLFSACE---HGNTWSEGSYLATTEKDGVYIGQPTGAPWIFLYPQGMKK  395

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y++++F+N PL +TENG  +    N S+ D LND  RV +L  YLN+L+  IR+GAD
Sbjct  396  IVMYMRDRFNNTPLVITENGVSENDNLNPSITDTLNDIHRVNYLHSYLNSLANAIREGAD  455

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YKQ +
Sbjct  456  VRGYFVWSLLDNFEWLNGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  503



>ref|XP_004976202.1| PREDICTED: probable inactive beta-glucosidase 14-like [Setaria 
italica]
Length=521

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 163/244 (67%), Gaps = 7/244 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A ERA +F   WFLDPII+G YP  M++ILG NLPEF+S   +KLKA   LDFIG
Sbjct  274  TVDILAVERALAFDGPWFLDPIIFGDYPTKMREILGPNLPEFTSQQKKKLKATK-LDFIG  332

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            ++HYTT Y +DC++S C  DP + G+ R          +DG LIGE+ G  +    P GM
Sbjct  333  LSHYTTLYTKDCIFSPCEIDP-IDGDAR---VFSSGVGEDGVLIGEVTGSPFFYSVPEGM  388

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            EKVV Y  ++++NIP Y+TENGY   +  + + +D  NDT RV ++ DYL  L++ IRKG
Sbjct  389  EKVVMYYMQRYNNIPTYITENGYAQASNSSMTAKDFTNDTGRVDYIRDYLTFLASAIRKG  448

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            ADVRGYF+WSL D FEW+ GYT+RLGLY  D  TL+RTPKLSAKW+ +F+     V ++ 
Sbjct  449  ADVRGYFVWSLLDCFEWTSGYTQRLGLYHVDLKTLERTPKLSAKWFSEFLKGGSLVGTRP  508

Query  159  QLRN  148
            +  N
Sbjct  509  RKEN  512



>ref|XP_010316605.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
 ref|XP_010316606.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
Length=520

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 155/228 (68%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AAAERA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  284  SEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY--GLDFIG  341

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCLYS C+    GNT  EG    +  KDG  IG+  G  ++ +YP GM+K
Sbjct  342  INYYTAKYIKDCLYSACE---HGNTWSEGSYLATTEKDGVYIGQPTGAPWIFLYPQGMKK  398

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y++E+F+N P+ +TENG  +    N S+ D LND+ RV +L   LN+L+  IR+GAD
Sbjct  399  IVMYMRERFNNTPVVITENGIAENDNLNPSITDTLNDSHRVNYLYSCLNSLANAIREGAD  458

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YKQ +
Sbjct  459  VRGYFVWSLLDNFEWLHGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  506



>ref|XP_010316603.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Solanum lycopersicum]
Length=431

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 154/226 (68%), Gaps = 5/226 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D AA ERA SF  NWFLDPII G YPK+M +ILGSNLP+FS  DL KL    GLDFIGIN
Sbjct  197  DIAATERARSFYVNWFLDPIILGRYPKEMVEILGSNLPDFSKNDLSKLSY--GLDFIGIN  254

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            +YT  Y +DCLYS C+    GNT  EG   ++  KDG  IG+   +++L +YP GM+K+V
Sbjct  255  YYTAKYIKDCLYSACE---HGNTWSEGSFFETREKDGVYIGQPTEVDWLFLYPQGMKKIV  311

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+K++F+N P+ +TENG  +    N S+ D LND  RV ++  YLN+L+  I  GADVR
Sbjct  312  MYMKDRFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANAITDGADVR  371

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            GYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YKQ +
Sbjct  372  GYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRTPKLSATMYKQLM  417



>ref|XP_008801279.1| PREDICTED: beta-glucosidase 18-like, partial [Phoenix dactylifera]
Length=265

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 156/227 (69%), Gaps = 5/227 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A +RA +F + WFLDPI++G YP +M+ ILG  LP FSS D  KL+    LDFIGI
Sbjct  24   ADRLAVQRALAFETAWFLDPIVFGEYPPEMRQILGLRLPTFSSEDRRKLQYK--LDFIGI  81

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT++YA+DC++S C+   TG+T    FV  +  ++G  IG    +    V P GMEK+
Sbjct  82   NHYTSHYAKDCMFSPCEEGSTGST---AFVISTSERNGIPIGTPTSMPSNYVVPEGMEKI  138

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y  ++++NI + VTENG    +T N    ++LND  RV+FL  YL AL+  +R+GADV
Sbjct  139  VMYTMQRYNNITMVVTENGCAQGSTRNDPTTNMLNDKDRVEFLHSYLTALTRAMRQGADV  198

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            RGYFIWSL DNFEW +GYT+R GLY  +  T +RTPKLSAKW+K+F+
Sbjct  199  RGYFIWSLLDNFEWLYGYTQRFGLYHVNFETQERTPKLSAKWFKEFL  245



>ref|NP_974067.1| beta glucosidase 46 [Arabidopsis thaliana]
 gb|AEE33893.1| beta glucosidase 46 [Arabidopsis thaliana]
Length=377

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 166/238 (70%), Gaps = 4/238 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP++YG YP++M ++LGS LP+FSS ++  L +    DF+GI
Sbjct  141  ADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKS-DFLGI  199

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL + C+ S  G ++ EG +     + GN+ IGE+  + +  + P G  K
Sbjct  200  NHYTSYFIQDCLITACN-SGDGASKSEG-LALKLDRKGNVSIGELTDVNWQHIDPNGFRK  257

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P +++E++L+DTKR+++L+ YL+AL   +R GA+
Sbjct  258  MLNYLKNRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGAN  317

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI +N  +  ++
Sbjct  318  VKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQI  375



>ref|XP_010430204.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Camelina sativa]
Length=518

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 171/241 (71%), Gaps = 4/241 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+++G YP++M  ILGS LPEFSS ++  LK     DF+GI
Sbjct  280  ADKKAAERAQSFYSNWILDPVVFGKYPEEMVKILGSALPEFSSNEMNNLKNYKS-DFLGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL + C+ S  G ++ EGF  +   + GN+ IGE+  +++  + P G +K
Sbjct  339  NHYTSYFIQDCLITACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVDWQHIDPDGFKK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P ++++++++DTKR+++L++YL+AL   +R GA+
Sbjct  397  MLNYLKNRYHNIPMYITENGFGQLQKPETTVKELMHDTKRIQYLSEYLDALKAAMRDGAN  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI ++  + + + +
Sbjct  457  VKGYFAWSLLDNFEWLYGYKVRFGLFHVDYATLKRTPKQSASWYKNFIEQHVNIENHIDI  516

Query  153  R  151
            +
Sbjct  517  K  517



>ref|XP_010533828.1| PREDICTED: beta-glucosidase 45-like isoform X2 [Tarenaya hassleriana]
Length=421

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 167/241 (69%), Gaps = 10/241 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFS---SIDLEKLKAAGGLD  703
            TAD+ AAERA SF SNW LDP IYG YP +M ++LG  LPEFS   + DL+KL    G+D
Sbjct  182  TADKLAAERAQSFYSNWILDPAIYGKYPDEMVELLGPALPEFSVDQAKDLKKL----GVD  237

Query  702  FIGINHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPP  526
            F+GINHYT+Y+ +DC +S+C     G++R EGF  + F + GN+ IGE+  +++  VYP 
Sbjct  238  FVGINHYTSYFVKDCYFSSCQRG-DGSSRTEGFALK-FDRKGNVSIGELTDVDWQHVYPR  295

Query  525  GMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIR  346
            G  KV+ Y+K ++ N P++VTENGY D    ++++E+++ND KR +++  +LNAL   +R
Sbjct  296  GFRKVLDYIKNRYHNTPIFVTENGYGDLEKQDTTVEELVNDIKRREYMRGHLNALQAAMR  355

Query  345  KGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
             GA+V+GYF WSL DN+EW +GY  R GL+  D  TL RTPKLSA WYK FI  +   +S
Sbjct  356  NGANVKGYFAWSLLDNYEWLYGYRLRFGLFHVDFTTLNRTPKLSASWYKYFINYHTNTSS  415

Query  165  K  163
            +
Sbjct  416  R  416



>ref|XP_006285457.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
 gb|EOA18355.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
Length=514

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 162/231 (70%), Gaps = 8/231 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  A ERA +F   WFLDP+++G YP++M++ILG +L EF+  DL++ K   GLDFIGI
Sbjct  286  ADILAVERAQAFYLTWFLDPVVFGRYPREMQEILGEDLLEFTKDDLKRSK--NGLDFIGI  343

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG+ +GE  G+ +   YP GME++
Sbjct  344  NQYTSRYAKDCLHSACEPG-KGGSRAEGFVYANALKDGSHLGEPTGVNWFSTYPQGMEEM  402

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  +++ +IPLYVTENG+ +  T       +LND +RVKF+++YL+AL   +RKGADV
Sbjct  403  LMYAAKRYKDIPLYVTENGFGENNTGV-----LLNDHRRVKFMSNYLDALKRAMRKGADV  457

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R G+Y  D  T +RTP+LSA WYK FI  ++
Sbjct  458  RGYFAWSLLDNFEWISGYTIRFGMYHVDFKTQERTPRLSAFWYKNFIFHHR  508



>ref|XP_009803936.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=517

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 158/228 (69%), Gaps = 8/228 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA  RA SF  +WFLDPII G YPK+M  ILGSNLPE S  DL KL    GLDFIG
Sbjct  284  SEDIAATHRARSFYDSWFLDPIILGRYPKEMVQILGSNLPELSMNDLSKLSY--GLDFIG  341

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+  Y +DCLYS C+    GN+  EG   ++  +DG  IGE   +++  VYP G+EK
Sbjct  342  INHYSAVYIKDCLYSACE---HGNSWSEGSYFRTTQRDGIYIGEPGEVDWQFVYPQGIEK  398

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            VV Y+K+KF+N P+++TENG+   +   SS+ED LND +RVK+L   LN+L+  IRKGAD
Sbjct  399  VVMYLKDKFNNTPMFITENGFAGNS---SSIEDALNDVRRVKYLHSNLNSLANAIRKGAD  455

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY+ R GLY  +   L+RTPKLSA  Y++ +
Sbjct  456  VRGYFVWSLLDNFEWLDGYSIRFGLYYVNYTNLQRTPKLSATKYQELM  503



>ref|XP_009105270.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Brassica rapa]
Length=517

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 163/231 (71%), Gaps = 2/231 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF SNW LDP++YG YP++M ++LGS LP+FS  +++ LK     DF+G
Sbjct  279  TADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSIKEMKNLKRYKS-DFLG  337

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+Y+ QDCL S C+ S  G +R EGF  +   K    +GE+  + +L + P G  K
Sbjct  338  INHYTSYFIQDCLISACN-SGDGASRSEGFALKLIQKGNVSVGEVTDVSWLNIDPEGFRK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+ +++ NIP+++TENG  +   P ++++++LNDTKRV++L+ YL+AL T +R GA+
Sbjct  397  MLNYLTDRYPNIPMFITENGLGELQKPETTVKELLNDTKRVRYLSGYLDALQTAMRDGAN  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            V+GYF WSL DNFEW +GY  R G++  D  TLKRTPK SA WYK FI  +
Sbjct  457  VKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTTLKRTPKQSAYWYKNFIENH  507



>gb|AAU05454.1| At1g61820 [Arabidopsis thaliana]
 gb|AAU45206.1| At1g61820 [Arabidopsis thaliana]
Length=425

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 166/238 (70%), Gaps = 4/238 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP++YG YP++M ++LGS LP+FSS ++  L +    DF+GI
Sbjct  189  ADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKS-DFLGI  247

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL + C+ S  G ++ EG +     + GN+ IGE+  + +  + P G  K
Sbjct  248  NHYTSYFIQDCLITACN-SGDGASKSEG-LALKLDRKGNVSIGELTDVNWQHIDPNGFRK  305

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P +++E++L+DTKR+++L+ YL+AL   +R GA+
Sbjct  306  MLNYLKNRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGAN  365

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI +N  +  ++
Sbjct  366  VKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQI  423



>ref|XP_010473402.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 169/238 (71%), Gaps = 4/238 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+++G YP++M +ILGS LPEFSS ++  LK     DF+GI
Sbjct  280  ADKKAAERAQSFYSNWILDPVVFGKYPEEMVNILGSALPEFSSNEMNNLKNYKS-DFLGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL + C+ S  G ++ EGF  +   + GN+ IGE+  +++  + P G +K
Sbjct  339  NHYTSYFIQDCLITACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVDWQHIDPDGFKK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P ++++++++DTKR+++L++YL+AL   +R GA+
Sbjct  397  MLNYLKNRYHNIPMYITENGFGQLQKPETTIKELMHDTKRIQYLSEYLDALKAAMRDGAN  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI ++  +   +
Sbjct  457  VKGYFAWSLLDNFEWLYGYKVRFGLFHVDYTTLKRTPKKSASWYKNFIEQHVNIEDHI  514



>ref|XP_006413735.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55188.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=528

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 165/235 (70%), Gaps = 12/235 (5%)
 Frame = -2

Query  870  ADQAAAERAHSFL----SNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLD  703
            AD+ AAERA +F     +  FLDP+++G YP++M++I G +LP+F+  DL+  K   GLD
Sbjct  294  ADRLAAERAQAFYLTCENCRFLDPVVFGRYPREMQEIFGEDLPQFTKDDLKSSK--NGLD  351

Query  702  FIGINHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPG  523
            FIGIN YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE  G+++  VYP G
Sbjct  352  FIGINQYTSRYAKDCLHSACEPGQ-GGSRAEGFVNANALKDGLALGEPTGVDWFNVYPQG  410

Query  522  MEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRK  343
            ME+++ Y  E++ NIPLYVTENG+ +  T       ++ND +RVK+++ YL+AL   +RK
Sbjct  411  MEEMLMYATERYKNIPLYVTENGFGENNTGV-----LVNDYRRVKYMSSYLDALKRAMRK  465

Query  342  GADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            GAD+RGYF WSL DNFEW  GYT R GLY  D  TL+RTP+LSA WYK FI +++
Sbjct  466  GADIRGYFTWSLLDNFEWISGYTIRFGLYHVDFNTLERTPRLSASWYKNFIFQHR  520



>ref|XP_010023761.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Eucalyptus grandis]
Length=419

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 162/236 (69%), Gaps = 9/236 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A +R+ +F   WF+DP++YG YP +M+ +LGS LP +S+ + +KL   G LDFIG+
Sbjct  183  ADRLAVQRSLAFYIAWFVDPLVYGDYPPEMRQVLGSRLPTYSAEERKKL-LEGKLDFIGV  241

Query  690  NHYTTYYAQDCLYSTC-DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            NHYTT Y +DC++S+C  P   G+     FV  +  KDG  IGE   +    V P GME 
Sbjct  242  NHYTTLYVKDCMFSSCASPYSLGD----AFVYLTGEKDGAYIGERTAMPLFFVVPRGMEG  297

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE+++N P+++TENGY     P  +++D LNDTKR+++  +YL  LS  +RKGAD
Sbjct  298  IVTYVKERYNNTPMFITENGYAQ---PAGAIKDSLNDTKRIEYHENYLAVLSEVVRKGAD  354

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYFIWSL DNFEW +GY  R GL+  D  TLKRTPK SA WY +F++++ K+ +
Sbjct  355  VRGYFIWSLLDNFEWLYGYLIRFGLHYVDFQTLKRTPKWSATWYTEFLSEDNKIRA  410



>gb|KFK40644.1| hypothetical protein AALP_AA2G023300 [Arabis alpina]
Length=518

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 167/234 (71%), Gaps = 4/234 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP++YG YP++M +ILG +LP+FS+ ++  L  +   DF+GI
Sbjct  282  ADKKAAERAQSFYSNWILDPVVYGRYPEEMVNILGPDLPQFSNNEINNLMNSKS-DFLGI  340

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL S C+ S  G ++ EGF  +   + GN+ IGE+  + +  ++P G +K
Sbjct  341  NHYTSYFIQDCLSSACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVSWQHIHPEGFQK  398

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+  ++ NIP+++TENGY     P ++++++LNDTKR++F++ YL+AL   +R GA+
Sbjct  399  MLNYLTVRYPNIPMFITENGYGQLQKPETTIKELLNDTKRIQFMSGYLDALQGAMRDGAN  458

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK+FI ++ K 
Sbjct  459  VKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLKRTPKQSASWYKKFIEQHVKT  512



>ref|XP_010434129.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 160/231 (69%), Gaps = 8/231 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A ERA +F   WFLDP+++G YP++M++ILG +LPEF+  DL+    +  LDFIGI
Sbjct  295  ADRLATERAQAFFMTWFLDPVVFGRYPREMQEILGEDLPEFTKDDLKSF--SNKLDFIGI  352

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EG+V  +  KDG  +GE  G+ +   YP GME++
Sbjct  353  NQYTSRYAKDCLHSACEPG-KGGSRAEGYVNANALKDGLRLGEPTGVNWFSTYPQGMEEM  411

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ +IPLYVTENG+ +  T       +LND +RVKF+++YL+A+   +RKGADV
Sbjct  412  LMYATERYKDIPLYVTENGFGENNTGV-----LLNDYRRVKFMSNYLDAVKRAMRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW  GYT R G+Y  D  T +RTP+LS  WYK FI  ++
Sbjct  467  RGYFAWSLLDNFEWISGYTIRFGMYHVDFKTQERTPRLSVFWYKNFIFHHR  517



>ref|XP_010533827.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 166/241 (69%), Gaps = 10/241 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFS---SIDLEKLKAAGGLD  703
            TAD+ AAERA SF SNW LDP IYG YP +M ++LG  LPEFS   + DL+KL    G+D
Sbjct  279  TADKLAAERAQSFYSNWILDPAIYGKYPDEMVELLGPALPEFSVDQAKDLKKL----GVD  334

Query  702  FIGINHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPP  526
            F+GINHYT+Y+ +DC +S+C     G++R EGF    F + GN+ IGE+  +++  VYP 
Sbjct  335  FVGINHYTSYFVKDCYFSSCQRG-DGSSRTEGFA-LKFDRKGNVSIGELTDVDWQHVYPR  392

Query  525  GMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIR  346
            G  KV+ Y+K ++ N P++VTENGY D    ++++E+++ND KR +++  +LNAL   +R
Sbjct  393  GFRKVLDYIKNRYHNTPIFVTENGYGDLEKQDTTVEELVNDIKRREYMRGHLNALQAAMR  452

Query  345  KGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
             GA+V+GYF WSL DN+EW +GY  R GL+  D  TL RTPKLSA WYK FI  +   +S
Sbjct  453  NGANVKGYFAWSLLDNYEWLYGYRLRFGLFHVDFTTLNRTPKLSASWYKYFINYHTNTSS  512

Query  165  K  163
            +
Sbjct  513  R  513



>ref|XP_010316602.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Solanum lycopersicum]
Length=520

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 154/226 (68%), Gaps = 5/226 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D AA ERA SF  NWFLDPII G YPK+M +ILGSNLP+FS  DL KL    GLDFIGIN
Sbjct  286  DIAATERARSFYVNWFLDPIILGRYPKEMVEILGSNLPDFSKNDLSKLSY--GLDFIGIN  343

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            +YT  Y +DCLYS C+    GNT  EG   ++  KDG  IG+   +++L +YP GM+K+V
Sbjct  344  YYTAKYIKDCLYSACE---HGNTWSEGSFFETREKDGVYIGQPTEVDWLFLYPQGMKKIV  400

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+K++F+N P+ +TENG  +    N S+ D LND  RV ++  YLN+L+  I  GADVR
Sbjct  401  MYMKDRFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANAITDGADVR  460

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            GYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YKQ +
Sbjct  461  GYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRTPKLSATMYKQLM  506



>emb|CDY55219.1| BnaA01g36270D [Brassica napus]
Length=517

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 161/228 (71%), Gaps = 2/228 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ AAERA SF SNW LDP++YG YP++M ++LGS LP+FS  +++ LK     DF+G
Sbjct  279  TADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSIKEMKNLKRYKS-DFLG  337

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+Y+ QDCL S C+ S  G +R EGF  +   K    +GE+  + +L + P G  K
Sbjct  338  INHYTSYFIQDCLISACN-SGDGASRSEGFALKLIQKGNVSVGEVTDVSWLNIDPEGFRK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+ +++ NIP+++TENG  +   P ++++++LNDTKRV++L+ YL+AL   +R GA+
Sbjct  397  MLNYLTDRYPNIPMFITENGLGELQKPETTVKELLNDTKRVRYLSGYLDALQRAMRDGAN  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            V+GYF WSL DNFEW +GY  R G++  D  TLKRTPK SA WYK FI
Sbjct  457  VKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTTLKRTPKQSAYWYKNFI  504



>gb|KDP39385.1| hypothetical protein JCGZ_01142 [Jatropha curcas]
Length=422

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 164/244 (67%), Gaps = 12/244 (5%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AA+RA SF + WF+DPIIYG YP +M+ I+G  LP FS  +  KLK    LDFIGI
Sbjct  183  ADHFAAQRALSFFTAWFMDPIIYGEYPPEMRQIVGERLPTFSVEEKRKLK--NKLDFIGI  240

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C+ S   +   + FV  +  +DGNLIG+   +    V P  MEK+
Sbjct  241  NHYSTLYAKDCMFSPCNSST--DLLADSFVYNTGDRDGNLIGKPTAMPTFYVVPNSMEKI  298

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSS-MEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            V Y K++++N P+++TENGY     PNS  ++++L+D  R++++  YL +L+  IRKGAD
Sbjct  299  VMYFKDRYNNTPMFITENGYAQ---PNSGDIKEMLSDAGRIEYMEGYLTSLAAAIRKGAD  355

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK----VNS  166
            VRGYF WSL DNFEWS+GY+   GLY  DR TLKRTPK SA W++QF+  N      +NS
Sbjct  356  VRGYFGWSLIDNFEWSYGYSICFGLYHVDRTTLKRTPKQSALWFQQFLRNNNNLRMPINS  415

Query  165  KMQL  154
              +L
Sbjct  416  SRKL  419



>ref|NP_176374.1| beta-glucosidase 45 [Arabidopsis thaliana]
 sp|O80689.1|BGL45_ARATH RecName: Full=Beta-glucosidase 45; Short=AtBGLU45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC28501.1| Similar to beta-glucosidase BGQ60 precursor gb|L41869 from Hordeum 
vulgare [Arabidopsis thaliana]
 gb|AEE33890.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=520

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 162/231 (70%), Gaps = 2/231 (1%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD+ AAERA SF SNW LDP+IYG YPK+M DILG  LP+FSS +++ L+ +   DF+G
Sbjct  282  NADKEAAERAQSFYSNWILDPVIYGKYPKEMVDILGPALPQFSSNEVKNLEKSRA-DFVG  340

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHYT+Y+ QDCL S C+ +  G  + EG+  +   K    IGE+  + +  + P G  K
Sbjct  341  INHYTSYFIQDCLTSACN-TGHGAFKAEGYALKLDRKGNVTIGELTDVNWQHIDPTGFHK  399

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K+++ N+P+++TENG+ D   P ++ +++LNDTKR+++++ YL AL   +R GA+
Sbjct  400  MLNYLKDRYPNMPMFITENGFGDLQKPETTDKELLNDTKRIQYMSGYLEALQAAMRDGAN  459

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            V+GYF+WSL DNFEW FGY  R GL+  D  TLKR+PK SA WYK +I ++
Sbjct  460  VKGYFVWSLLDNFEWLFGYKVRFGLFHVDLTTLKRSPKQSASWYKNYIEEH  510



>ref|NP_850968.1| beta glucosidase 46 [Arabidopsis thaliana]
 sp|O80690.2|BGL46_ARATH RecName: Full=Beta-glucosidase 46; Short=AtBGLU46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE33892.1| beta glucosidase 46 [Arabidopsis thaliana]
Length=516

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 166/238 (70%), Gaps = 4/238 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP++YG YP++M ++LGS LP+FSS ++  L +    DF+GI
Sbjct  280  ADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKS-DFLGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL + C+ S  G ++ EG +     + GN+ IGE+  + +  + P G  K
Sbjct  339  NHYTSYFIQDCLITACN-SGDGASKSEG-LALKLDRKGNVSIGELTDVNWQHIDPNGFRK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P +++E++L+DTKR+++L+ YL+AL   +R GA+
Sbjct  397  MLNYLKNRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGAN  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI +N  +  ++
Sbjct  457  VKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQI  514



>gb|AAC28502.1| Similar to F4I1.26 putative beta-glucosidase gi|3128187 from 
A. thaliana BAC gb|AC004521. ESTs gb|N97083, gb|F19868 and gb|F15482 
come from this gene [Arabidopsis thaliana]
Length=527

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 166/238 (70%), Gaps = 4/238 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP++YG YP++M ++LGS LP+FSS ++  L +    DF+GI
Sbjct  291  ADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKS-DFLGI  349

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL + C+ S  G ++ EG +     + GN+ IGE+  + +  + P G  K
Sbjct  350  NHYTSYFIQDCLITACN-SGDGASKSEG-LALKLDRKGNVSIGELTDVNWQHIDPNGFRK  407

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P +++E++L+DTKR+++L+ YL+AL   +R GA+
Sbjct  408  MLNYLKNRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGAN  467

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI +N  +  ++
Sbjct  468  VKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQI  525



>gb|KCW60131.1| hypothetical protein EUGRSUZ_H02856 [Eucalyptus grandis]
Length=497

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 162/236 (69%), Gaps = 9/236 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A +R+ +F   WF+DP++YG YP +M+ +LGS LP +S+ + +KL   G LDFIG+
Sbjct  261  ADRLAVQRSLAFYIAWFVDPLVYGDYPPEMRQVLGSRLPTYSAEERKKL-LEGKLDFIGV  319

Query  690  NHYTTYYAQDCLYSTC-DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            NHYTT Y +DC++S+C  P   G    + FV  +  KDG  IGE   +    V P GME 
Sbjct  320  NHYTTLYVKDCMFSSCASPYSLG----DAFVYLTGEKDGAYIGERTAMPLFFVVPRGMEG  375

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE+++N P+++TENGY     P  +++D LNDTKR+++  +YL  LS  +RKGAD
Sbjct  376  IVTYVKERYNNTPMFITENGYAQ---PAGAIKDSLNDTKRIEYHENYLAVLSEVVRKGAD  432

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYFIWSL DNFEW +GY  R GL+  D  TLKRTPK SA WY +F++++ K+ +
Sbjct  433  VRGYFIWSLLDNFEWLYGYLIRFGLHYVDFQTLKRTPKWSATWYTEFLSEDNKIRA  488



>ref|XP_006348093.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=518

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 152/228 (67%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA ERA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  282  SEDIAATERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY--GLDFIG  339

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCLYS C+    GNT  EG    +  KDG  IG+   +E+L +YP GM+K
Sbjct  340  INYYTAKYIKDCLYSACE---HGNTWSEGSYFVTTEKDGVYIGQSTEVEWLFLYPQGMKK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  +    N S+ D LND  RV ++  YLN+L+  I  GAD
Sbjct  397  IVMYMKDRFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANAITDGAD  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY  R GL+  +   L+R PKLSA  YKQ +
Sbjct  457  VRGYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRIPKLSATMYKQLM  504



>ref|XP_010023759.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Eucalyptus grandis]
 gb|KCW60130.1| hypothetical protein EUGRSUZ_H02856 [Eucalyptus grandis]
Length=514

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 162/236 (69%), Gaps = 9/236 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A +R+ +F   WF+DP++YG YP +M+ +LGS LP +S+ + +KL   G LDFIG+
Sbjct  278  ADRLAVQRSLAFYIAWFVDPLVYGDYPPEMRQVLGSRLPTYSAEERKKL-LEGKLDFIGV  336

Query  690  NHYTTYYAQDCLYSTC-DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            NHYTT Y +DC++S+C  P   G    + FV  +  KDG  IGE   +    V P GME 
Sbjct  337  NHYTTLYVKDCMFSSCASPYSLG----DAFVYLTGEKDGAYIGERTAMPLFFVVPRGMEG  392

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE+++N P+++TENGY     P  +++D LNDTKR+++  +YL  LS  +RKGAD
Sbjct  393  IVTYVKERYNNTPMFITENGYAQ---PAGAIKDSLNDTKRIEYHENYLAVLSEVVRKGAD  449

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYFIWSL DNFEW +GY  R GL+  D  TLKRTPK SA WY +F++++ K+ +
Sbjct  450  VRGYFIWSLLDNFEWLYGYLIRFGLHYVDFQTLKRTPKWSATWYTEFLSEDNKIRA  505



>ref|XP_004976200.1| PREDICTED: probable inactive beta-glucosidase 14-like isoform 
X1 [Setaria italica]
Length=533

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 160/249 (64%), Gaps = 11/249 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD  A ER  SF   WFLDP+I G YP +M+ ILGSNLPEF+S   +KL+A   LDFIG
Sbjct  281  TADILAVERVLSFNGPWFLDPLILGEYPLEMRKILGSNLPEFTSKQKKKLQATK-LDFIG  339

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            +NHYTT Y +DC++S C  DP        E  V  S  +DG  IG+  G       P GM
Sbjct  340  LNHYTTSYLKDCIFSPCELDP-----VEGEAQVLTSAERDGIFIGKRTGSPIFYSVPYGM  394

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            EK+V Y K++++N P+Y+TENGY   +  +   +D  NDT RV +L  YL  L++ IRKG
Sbjct  395  EKLVMYYKQRYNNTPIYITENGYAQASNSSMITKDFTNDTGRVDYLQGYLTFLASAIRKG  454

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            ADVRGYF+WSL DNFEW+ GYT+R GLY  D  T KRTPKLSAKWY++F+  +     + 
Sbjct  455  ADVRGYFVWSLLDNFEWNSGYTQRFGLYHVDFKTQKRTPKLSAKWYREFLKGSPL---RT  511

Query  159  QLRNMILHQ  133
             LRN   HQ
Sbjct  512  SLRNGYSHQ  520



>ref|XP_010418157.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 164/237 (69%), Gaps = 2/237 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+++G YP++M +ILGS LPEFSS ++  LK     DF+GI
Sbjct  280  ADKKAAERAQSFYSNWILDPVVFGKYPEEMVNILGSALPEFSSNEMINLKNYKS-DFLGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+Y+ QDCL + C+ S  G ++ EGF  +   K    IGE+  + +  + P G +K+
Sbjct  339  NHYTSYFIQDCLITACN-SGDGASKTEGFALKLDLKGNVSIGELTDVNWQHIDPDGFKKM  397

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K ++ NIP+Y+TENG+     P ++++++L+DTKR+++L+ YL+AL   +R GA+V
Sbjct  398  LNYLKNRYHNIPMYITENGFGQLQKPETTVKELLHDTKRIQYLSGYLDALKAAMRDGANV  457

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            +GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI ++  +   +
Sbjct  458  KGYFAWSLLDNFEWLYGYKLRFGLFHVDYATLKRTPKQSASWYKNFIEQHVNIEDHI  514



>gb|KFK40645.1| hypothetical protein AALP_AA2G023400 [Arabis alpina]
Length=523

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 164/236 (69%), Gaps = 6/236 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA SF SNW LDPIIYG YPK+M  ILG  LP+FSS +++ LK     DFIGIN
Sbjct  282  DKEAAERAQSFYSNWILDPIIYGEYPKEMATILGPALPQFSSNEVKNLKNYRA-DFIGIN  340

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEKV  511
            HYT+Y+ QDCL STC     G ++ EGF      + GN+ IGE+  +++  + P G  K+
Sbjct  341  HYTSYFIQDCLISTCTTGY-GASKAEGF-ALKLDRKGNVSIGELTDVDWQHIDPKGFRKM  398

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K ++ NIP+++TENG+     P ++++++L+DTKR+++++ YL AL   +R GA+V
Sbjct  399  LNYLKHRYPNIPMFITENGFGHLQKPETTVKELLHDTKRIQYMSGYLEALQAAMRDGANV  458

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            +GYF WSL DNFEW +G+  R GL+  D  TLKRTPK SA WYK FI   ++VN++
Sbjct  459  KGYFAWSLLDNFEWLYGHKLRFGLFHVDYTTLKRTPKQSASWYKNFI--EEQVNTR  512



>ref|XP_006300409.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
 gb|EOA33307.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
Length=516

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 169/240 (70%), Gaps = 6/240 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F SNW LDP+++G YP++M +ILGS+LP+FSS ++  LK     DF+GI
Sbjct  280  ADKKAAERAQAFYSNWILDPVVFGKYPEEMVNILGSDLPQFSSSEMNNLKNYKS-DFLGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDC+ + C+ S  G ++ EGF  +   + GN+ IGE+  + +  + P G +K
Sbjct  339  NHYTSYFIQDCMITACN-SGEGASKSEGFALK-LDRKGNVSIGELTDVNWQHIDPDGFKK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P +++E++L+DTKR+ +L+ YL+AL   +R GA+
Sbjct  397  MLHYLKIRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIHYLSGYLDALKAAMRDGAN  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            V+GYF WSL DN+EW +GY  R GL+  D  TLKRTPK SA WYK FI   Q VN + Q+
Sbjct  457  VKGYFEWSLLDNYEWLYGYKVRFGLFHVDYTTLKRTPKQSASWYKNFI--EQHVNIENQI  514



>ref|XP_006451937.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
 gb|ESR65177.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
Length=523

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 4/230 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D+ A  RA +F   W LDP+++G YP +M++ LGS LP FS  + + +K  G LDFIGI
Sbjct  288  SDRQAVSRALAFNVGWMLDPLVFGDYPAEMREYLGSQLPRFSKEETKYVK--GSLDFIGI  345

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C   +  N    GFV  +  +DG +IGE  G     V P GMEK+
Sbjct  346  NHYSTLYAKDCIHSVC--VLGSNHAIRGFVYTTGERDGIMIGEPTGNPRFFVVPEGMEKI  403

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V YVK+++ NIP+YVTENGY      N   +D+++D KR+++ + YL+AL+  IR GADV
Sbjct  404  VDYVKDRYKNIPMYVTENGYSPPKQKNQRSQDLVDDVKRIEYHSGYLSALARAIRNGADV  463

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYFIWSL DNFEW  GY+   GLY  DR TL+RTPKLSA W+K F+  N
Sbjct  464  RGYFIWSLMDNFEWLDGYSVMFGLYYIDRQTLERTPKLSATWFKNFLTDN  513



>ref|XP_012091391.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 47-like [Jatropha 
curcas]
Length=456

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 166/233 (71%), Gaps = 5/233 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILG-SNLPEFSSIDLEKLKAAGGLDFIGI  691
            D+ A ERA +F    FLDPII+G YP +M +ILG  +LP FS+ +LE+LK+  GLDFI I
Sbjct  220  DKLAVERAQAFYLYRFLDPIIFGKYPTEMHEILGIHHLPAFSNYELEELKS--GLDFICI  277

Query  690  NHYTTYYAQDCLYSTCDPSM-TGNTREEGFVG-QSFSKDGNLIGEMAGLEYLVVYPPGME  517
            NHY ++YA+DC++S C+     G T+ EGF    +  KDG  IGE   +E+L VYP GME
Sbjct  278  NHYNSFYAKDCMFSFCNQGRGCGVTKTEGFAWWTAHQKDGIFIGEPTSVEWLYVYPQGME  337

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            K+VT +K++++N+PL++TENG  +    N++ E +LND KRV++++ YL++L+  +RKGA
Sbjct  338  KIVTDIKDRYNNVPLFITENGKHEKGNSNTTTEMLLNDVKRVEYMSRYLDSLAMAVRKGA  397

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            DV+GYF WSL DNFEW  GYT R GL+  D  TLK T KLSA WY+ +I+ ++
Sbjct  398  DVQGYFSWSLLDNFEWMMGYTIRFGLHHVDYSTLKGTRKLSAAWYRDYISNHK  450



>ref|XP_010069050.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW57267.1| hypothetical protein EUGRSUZ_H00071 [Eucalyptus grandis]
Length=515

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 156/239 (65%), Gaps = 9/239 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA +F   WFLDPI+YG YP +M  I+G+ LP FS+ + +KL  +  LDFIGI
Sbjct  275  ADKLAAERALAFQIAWFLDPIMYGDYPPEMHQIIGARLPVFSAEERKKL--SNKLDFIGI  332

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT  YA+DC++S C    +  +  E  V  +  KDG LIG+   + Y  V P  +E  
Sbjct  333  NQYTAAYAKDCMFSPC---TSAYSLGESMVYVTGEKDGTLIGDTTAVSYFYVVPSALEMA  389

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V YVKE+++N P+++TENGY  +  P   + D LNDTKRV++   YL+AL   +RKGADV
Sbjct  390  VMYVKERYNNTPMFITENGYAQSNAP---IADSLNDTKRVEYFKSYLSALVNAMRKGADV  446

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA-KNQKVNSKMQ  157
            RGYFIWSL DNFEW  GYT R GLY  D  TLKRTP+ SAKWYK F+A  N    SK  
Sbjct  447  RGYFIWSLLDNFEWLDGYTIRFGLYHVDFDTLKRTPRQSAKWYKNFLADSNSTTESKRH  505



>ref|XP_012071274.1| PREDICTED: beta-glucosidase 18-like [Jatropha curcas]
Length=514

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 164/244 (67%), Gaps = 12/244 (5%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AA+RA SF + WF+DPIIYG YP +M+ I+G  LP FS  +  KLK    LDFIGI
Sbjct  275  ADHFAAQRALSFFTAWFMDPIIYGEYPPEMRQIVGERLPTFSVEEKRKLK--NKLDFIGI  332

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C+ S   +   + FV  +  +DGNLIG+   +    V P  MEK+
Sbjct  333  NHYSTLYAKDCMFSPCNSST--DLLADSFVYNTGDRDGNLIGKPTAMPTFYVVPNSMEKI  390

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSS-MEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            V Y K++++N P+++TENGY     PNS  ++++L+D  R++++  YL +L+  IRKGAD
Sbjct  391  VMYFKDRYNNTPMFITENGYAQ---PNSGDIKEMLSDAGRIEYMEGYLTSLAAAIRKGAD  447

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK----VNS  166
            VRGYF WSL DNFEWS+GY+   GLY  DR TLKRTPK SA W++QF+  N      +NS
Sbjct  448  VRGYFGWSLIDNFEWSYGYSICFGLYHVDRTTLKRTPKQSALWFQQFLRNNNNLRMPINS  507

Query  165  KMQL  154
              +L
Sbjct  508  SRKL  511



>ref|XP_003529623.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03065.1| Beta-glucosidase 46 [Glycine soja]
Length=554

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 164/236 (69%), Gaps = 9/236 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD+ A ERA SF  NW LDPI++G YPK+M+ ILG+ LP+FSS D  KL+   GLDFIG
Sbjct  295  TADKLATERAQSFSINWILDPILFGKYPKEMEMILGTTLPKFSSNDKAKLRQ--GLDFIG  352

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY +YY +DC+ S C+ S  G +  EG   ++       IGE+   ++L VYP GM+ 
Sbjct  353  INHYASYYVRDCISSVCE-SGPGVSTTEGLYQRT------TIGELTPFDWLSVYPLGMKS  405

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K++++N P+++TENGY +   P+ + E+ LND KR++F++ +L+ L   IR+GAD
Sbjct  406  ILMYLKDRYNNTPMFITENGYGNLYDPDLTEEEYLNDFKRIEFMSGHLDNLMAAIREGAD  465

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            VRGYF WSL DNFEW +G++ R GL+  D  TLKRTPKLSA WY+ FI   +  +S
Sbjct  466  VRGYFAWSLLDNFEWLYGFSVRFGLHHVDFSTLKRTPKLSAIWYEHFIENYKLTDS  521



>ref|XP_006302139.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
 gb|EOA35037.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
Length=522

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 162/229 (71%), Gaps = 4/229 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
             AD+ AAERA SF SNW LDP IYG YPK+M +ILG+ LP+FSS +++ LK +   DFIG
Sbjct  286  NADKEAAERAQSFYSNWILDPAIYGKYPKEMVNILGAALPQFSSNEVKNLKNSRA-DFIG  344

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGME  517
            +NHYT+Y+ QDCL STC+ +  G  + EGF  +   + GN+ IGE+  + +  + P G  
Sbjct  345  VNHYTSYFIQDCLISTCN-TGNGAYKAEGFALK-LDRKGNVSIGELTDVVWQHIDPEGFH  402

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            K++ Y+ +++ NIP+++TENG+ D   P ++ +++L+DTKR+++++ YL AL   +R GA
Sbjct  403  KMLNYLTDRYPNIPMFITENGFGDLQKPETTDKELLHDTKRIQYMSGYLEALQAAMRDGA  462

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            +V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI
Sbjct  463  NVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLKRTPKQSASWYKNFI  511



>ref|XP_006464712.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Citrus sinensis]
Length=418

 Score =   239 bits (609),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 154/230 (67%), Gaps = 4/230 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D+ A  RA +F   W LDP+++G YP +M++ LGS LP FS  + + +K  G LDFIGI
Sbjct  183  SDRQAVSRALAFNVGWMLDPLVFGDYPAEMREYLGSQLPRFSKEETKYVK--GSLDFIGI  240

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C   +  N    GFV  +  +DG +IGE  G     V P GMEK+
Sbjct  241  NHYSTLYAKDCIHSVC--VLGSNHAIRGFVYTTGERDGIMIGEPTGNPRFFVVPEGMEKI  298

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V YVK+ + NIP+YVTENGY      N   +++++D KR+++ + YL+AL+  IR GADV
Sbjct  299  VDYVKDTYKNIPMYVTENGYSPPKQKNQRSQNLVDDVKRIEYHSGYLSALARAIRNGADV  358

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYFIWSL DNFEW  GY+   GLY  DR TL+RTPKLSA W+K F+  N
Sbjct  359  RGYFIWSLMDNFEWLDGYSVVFGLYYIDRQTLERTPKLSATWFKNFLTDN  408



>ref|XP_010431678.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45-like [Camelina 
sativa]
Length=449

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 165/231 (71%), Gaps = 4/231 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+IYG YPK+M +ILG+ LP+FSS +++ L  +  +DF+GI
Sbjct  213  ADKEAAERAQSFYSNWILDPVIYGKYPKEMVNILGTALPQFSSNEVKNLNNSR-VDFMGI  271

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL S+C+    G  + EGF  +   + GN+ IGE+  +++  + P G  K
Sbjct  272  NHYTSYFIQDCLTSSCNAGY-GAFKAEGFALK-LDRIGNVSIGELTDVDWQHIDPEGFHK  329

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+ +++ NIP+++TENG+ D   P ++ +++L+DTKR+++++ YL AL   +R GA+
Sbjct  330  MLNYLTDRYPNIPMFITENGFGDLQKPETTDKELLHDTKRIQYISGYLEALQAAMRDGAN  389

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            V+GYF+WSL DNFEW  GY  R GL+  D  TLKRTPK SA WYK FI ++
Sbjct  390  VKGYFVWSLLDNFEWLDGYKLRFGLFHVDYTTLKRTPKESASWYKNFIEEH  440



>ref|XP_010644219.1| PREDICTED: beta-glucosidase 18 isoform X1 [Vitis vinifera]
 emb|CBI20346.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 154/226 (68%), Gaps = 4/226 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AA+RA +F   W LDP+++G YP +M+   G+ LP F+S + + L  +  LDFIGIN
Sbjct  281  DREAAKRALAFYIAWMLDPLVFGDYPPEMRQYHGNELPRFTSEETKLLTQS--LDFIGIN  338

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT YA+DC++STC  S  G+   +GFV  +  + G  IGE  G+    + P GMEK++
Sbjct  339  HYTTLYAKDCIHSTC--SSDGDRAIQGFVYLTGERHGVPIGERTGMRRFFIVPRGMEKII  396

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             YVKE+++N+P++VTENGY      +   ED++ D KR++F   YL AL+  IR GADVR
Sbjct  397  EYVKERYNNMPMFVTENGYSPPEKEDEQEEDLVQDAKRIEFHKAYLAALARAIRNGADVR  456

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            GYFIWSL DNFEW +GY  R GLY  DR TL+RTPKLSA+WY  F+
Sbjct  457  GYFIWSLMDNFEWVYGYNTRFGLYYVDRQTLRRTPKLSARWYANFL  502



>ref|XP_002888065.1| hypothetical protein ARALYDRAFT_475148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64324.1| hypothetical protein ARALYDRAFT_475148 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/249 (47%), Positives = 168/249 (67%), Gaps = 10/249 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+IYG YPK+M +ILG  LP+FSS +++ L+ +   DFIGI
Sbjct  274  ADKEAAERAQSFYSNWILDPVIYGKYPKEMVNILGPALPQFSSNEVKNLENSRA-DFIGI  332

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL S C+    G  + EGF      + GN+ IGE+  +++  +   G  K
Sbjct  333  NHYTSYFIQDCLTSACNTGH-GAFKAEGF-AHKLDRKGNVSIGELTDVDWQHIDLEGFHK  390

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K+++ NI +++TENG+ D   P ++ +++L+DTKR+++++ YL AL   +R GA+
Sbjct  391  MLNYLKDRYPNIRIFITENGFGDLQKPETTDKELLHDTKRIQYMSGYLEALQAAMRDGAN  450

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            V+GYF+WSL DNFEW FGY  R GL+  D  TLKRTPK SA WYK FI         +  
Sbjct  451  VKGYFVWSLLDNFEWLFGYKVRFGLFHVDLTTLKRTPKQSASWYKNFI------EGHVNR  504

Query  153  RNMILHQNQ  127
            R++++  NQ
Sbjct  505  RDLVVVDNQ  513



>ref|XP_010316604.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=516

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 153/228 (67%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AAAERA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  280  SEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY--GLDFIG  337

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCLYS C+    G T  EG    +  KDG  IG+   +++L +YP GM+K
Sbjct  338  INYYTAAYIKDCLYSACE---HGRTWSEGSFLDTREKDGVYIGQPTEVDWLFLYPQGMKK  394

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  +    N S+ D LND  RV ++  YLN+L+  I  GAD
Sbjct  395  IVMYMKDRFNNTPMVITENGIAENDNLNPSIIDTLNDFHRVDYMRSYLNSLANAITDGAD  454

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YKQ +
Sbjct  455  VRGYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  502



>ref|XP_010920389.1| PREDICTED: beta-glucosidase 18-like [Elaeis guineensis]
Length=439

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 155/227 (68%), Gaps = 5/227 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  A +RA +F   WFLDP+I+G YP +M+ +L   LP FSS D  KL+    LDFIGI
Sbjct  198  ADCLAVQRALAFDIAWFLDPVIFGEYPPEMRQVLSLRLPTFSSEDRRKLQHK--LDFIGI  255

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+ Y +DC++S C+    G T    FV  +  ++G  IG    +    V+P GMEK+
Sbjct  256  NHYTSKYVKDCIFSPCE---GGKTESTAFVMSTGERNGIPIGTPTSMPDNYVFPDGMEKI  312

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+ ++++NIP+++TENGY   +T N    D+LNDT RV++L  YL +L+  +R+GADV
Sbjct  313  IMYIMQRYNNIPMFITENGYAQGSTSNDPTTDMLNDTSRVEYLHGYLTSLTRAVRQGADV  372

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            RGYFIWSL DNFEW +GYT+R GLY  +  T +RTP+LSAKW+K+F+
Sbjct  373  RGYFIWSLLDNFEWLYGYTQRFGLYHVNFETQERTPRLSAKWFKEFL  419



>ref|XP_010920356.1| PREDICTED: beta-glucosidase 18-like [Elaeis guineensis]
Length=510

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 158/233 (68%), Gaps = 5/233 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A +RA +F + WFLDP+I+G YP +M+ +LG  LP FSS D  KL+    LDFIGI
Sbjct  273  ADRLAVQRALAFDTAWFLDPVIFGEYPPEMRQVLGLRLPTFSSEDRRKLQYK--LDFIGI  330

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+ Y +DC++S C+    G+T    FV  +  ++G  IG    +    V+P GMEK+
Sbjct  331  NHYTSKYVKDCMFSPCN---EGSTESTAFVISTGERNGIPIGTPTSMPDNYVFPDGMEKM  387

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y  ++++NIP+++TENGY   +T NS   D LND  RV++L  YL +L+  +R+GADV
Sbjct  388  VMYAMQRYNNIPMFITENGYAQGSTGNSPTTDTLNDRGRVEYLHGYLTSLTRAMRQGADV  447

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            RGYFIWSL DNFEW FGY++R GLY  +  T +RTPKLSAKW K+F+   Q +
Sbjct  448  RGYFIWSLLDNFEWLFGYSQRFGLYHVNFKTQERTPKLSAKWVKKFLGGPQVI  500



>gb|ERN19524.1| hypothetical protein AMTR_s00062p00043120 [Amborella trichopoda]
Length=537

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 163/262 (62%), Gaps = 24/262 (9%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA+RA +F S WFLDPI++G YP +M+ ILGS LP FS  +  KL+   GLDFIGI
Sbjct  273  VDRIAAQRALAFESAWFLDPIVFGDYPPEMRQILGSRLPRFSKEERRKLQ--NGLDFIGI  330

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+ Y +DCL+S C     G +  EGF      ++G  IGE   +    VYP GMEK+
Sbjct  331  NHYTSLYVKDCLFSEC---TYGMSSIEGFYSMILEREGIPIGEPTAMTTFYVYPQGMEKI  387

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIR-----  346
            V Y+KE+++N+P+++TENGY   +TP +  E+ ++D +RVK+L  YL +L+  IR     
Sbjct  388  VMYMKERYNNLPMFITENGYAQGSTPKAKAEEFVDDAERVKYLGSYLESLANAIRSLSLS  447

Query  345  --------------KGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAK  208
                          KGA+V+GY +WSL DNFEW  GY  R GLY  D  T KRTPKLSA 
Sbjct  448  LSQQRDLPCACVRMKGANVKGYMVWSLLDNFEWLNGYNMRFGLYHVDFSTFKRTPKLSAD  507

Query  207  WYKQFIAKNQKVNSKMQLRNMI  142
            WYK FI   +K ++    +++I
Sbjct  508  WYKGFIQNYKKHHNISYTQSLI  529



>ref|XP_002448173.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
 gb|EES12501.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
Length=515

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 156/240 (65%), Gaps = 4/240 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  A +R  SF + WFLDPII G YP  M+ +LG NLPEF+S   +K+     LDFIG+N
Sbjct  274  DILAVDRGLSFGAPWFLDPIILGDYPSPMRKMLGPNLPEFTS-KQKKILQPSKLDFIGLN  332

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY+T Y +DC+YS+  P        +  +  S  +DG LIGE  G  YL V P GMEKVV
Sbjct  333  HYSTSYLKDCIYSS--PCELDPFDGDAQISTSIDRDGILIGERTGSPYLNVVPYGMEKVV  390

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y K +++N P+Y+TENGY   +  N S +D  NDT RV +L  YL  L++ IRKGADVR
Sbjct  391  MYFKRRYNNTPMYITENGYAQASNSNMSAKDFTNDTGRVDYLQGYLTFLASAIRKGADVR  450

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLRN  148
            GYF+WSL DNFEW+ GYT+R GLY  D  T KRTPKLSAKWY +F+ K   + ++ Q  N
Sbjct  451  GYFVWSLLDNFEWNSGYTQRFGLYHVDFKTQKRTPKLSAKWYSEFL-KGSPLRTRPQNGN  509



>ref|XP_010245701.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=512

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 153/230 (67%), Gaps = 5/230 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  A +RA +F + WFLDPI YG YP +M+ ILGS LP FS  D +KL     LDFIG+N
Sbjct  271  DNLAVQRALAFDTAWFLDPIFYGEYPPEMRQILGSRLPMFSVEDKKKL--GNKLDFIGVN  328

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY+T Y +DC+ S C+ S +         G+   KDG+ IG+   +    V P GMEK++
Sbjct  329  HYSTLYVKDCMLSQCESSTSFGEASVYITGE---KDGHPIGDPTAMPSFYVVPYGMEKIL  385

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y K++++N P+++TENGY   + PN S  D+LND  R+++L  YL +L+  +R GADVR
Sbjct  386  MYFKDRYNNTPMFITENGYAQASNPNVSKRDLLNDAGRIEYLKSYLTSLNLAMRHGADVR  445

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            GYF+WSL DNFEW +GYT R G+Y  D  TL+RTPK SA WY+QF+A+ +
Sbjct  446  GYFVWSLIDNFEWLYGYTMRFGIYYVDYKTLERTPKHSAMWYRQFLAREK  495



>gb|KJB81915.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=485

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 155/238 (65%), Gaps = 6/238 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D+ A  RA +F   W LDP+++G YP +M+    S LP FSS + E +K  G +DFIG+
Sbjct  224  SDRQAVNRALAFTGGWVLDPLVFGDYPPEMRQYHRSELPRFSSEETEYMK--GSIDFIGL  281

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C   + G+    GF   +  +DG LIGE  G+E   V P GMEK+
Sbjct  282  NHYSTLYAKDCIHSPC--VLGGDHFIRGFTFTTGERDGTLIGEPTGVERFYVVPRGMEKI  339

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V +V ++++N+P+YVTENGYC   T   +  ++L+D  RV F   YL AL+  IRKGADV
Sbjct  340  VDHVSKRYNNMPIYVTENGYCPPLT--EAAPNLLHDVNRVHFYNGYLAALARAIRKGADV  397

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            RGYF WSL DNFEW+ GY+   GLY  DR+T+ RTPKLSAKW++ F+A         Q
Sbjct  398  RGYFAWSLMDNFEWAGGYSSTFGLYYVDRLTMNRTPKLSAKWFQHFLANRSSARFNRQ  455



>emb|CDY25326.1| BnaC01g29950D [Brassica napus]
Length=691

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 160/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDPIIYG YPK+M ++LGS LP FS  ++E LK    LDFIGI
Sbjct  458  ADREAAERAQSFYSNWILDPIIYGKYPKEMVNVLGSALPRFSRKEVENLKQLR-LDFIGI  516

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL++TC+    G ++ +GF  +   + GN+ IGE+  + +  ++P G  K
Sbjct  517  NHYTSYFIQDCLFTTCNAG-DGASKAQGFALK-LDRKGNVSIGELTDVNWQHIHPEGFRK  574

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
             + Y+K ++ NIP+++TENG+ D   P +++ ++LNDTKR+++++ YL+AL + +R GA+
Sbjct  575  TLNYLKNRYHNIPMFITENGFGDLQKPETTLTELLNDTKRIQYMSGYLDALQSAMRDGAN  634

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSA  211
            V+GYF WSL DNFEW +GY  R GL+  D  +LKRTPKLSA
Sbjct  635  VKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTSLKRTPKLSA  675



>ref|XP_009794052.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=521

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 154/228 (68%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA +RA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  285  SEDIAATQRARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSVNDLSKLSY--GLDFIG  342

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCLYS C+    G T  EG    +  KDG  IG+   +++L +YP GM+K
Sbjct  343  INYYTAKYIKDCLYSACE---HGKTWSEGSYFVTTEKDGVYIGQPTEVDWLFLYPQGMKK  399

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  +    N S+ D LND  RV ++  YL++L+  IR+GAD
Sbjct  400  IVMYMKDRFNNTPMVITENGIAENENLNPSITDTLNDVHRVNYMHSYLDSLANAIREGAD  459

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY  R GL+  +   L+RTPKLSA  YK+ +
Sbjct  460  VRGYFVWSLLDNFEWLDGYRLRFGLHYVNFTNLERTPKLSATRYKELM  507



>ref|XP_006464710.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Citrus sinensis]
Length=523

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 154/230 (67%), Gaps = 4/230 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D+ A  RA +F   W LDP+++G YP +M++ LGS LP FS  + + +K  G LDFIGI
Sbjct  288  SDRQAVSRALAFNVGWMLDPLVFGDYPAEMREYLGSQLPRFSKEETKYVK--GSLDFIGI  345

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C   +  N    GFV  +  +DG +IGE  G     V P GMEK+
Sbjct  346  NHYSTLYAKDCIHSVC--VLGSNHAIRGFVYTTGERDGIMIGEPTGNPRFFVVPEGMEKI  403

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V YVK+ + NIP+YVTENGY      N   +++++D KR+++ + YL+AL+  IR GADV
Sbjct  404  VDYVKDTYKNIPMYVTENGYSPPKQKNQRSQNLVDDVKRIEYHSGYLSALARAIRNGADV  463

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            RGYFIWSL DNFEW  GY+   GLY  DR TL+RTPKLSA W+K F+  N
Sbjct  464  RGYFIWSLMDNFEWLDGYSVVFGLYYIDRQTLERTPKLSATWFKNFLTDN  513



>ref|NP_193907.2| beta-glucosidase 47 [Arabidopsis thaliana]
 sp|Q9SVS1.2|BGL47_ARATH RecName: Full=Beta-glucosidase 47; Short=AtBGLU47; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE84500.1| beta-glucosidase 47 [Arabidopsis thaliana]
Length=535

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 161/234 (69%), Gaps = 18/234 (8%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AA+RA +F   WFLDP+++G YP++M++ILG +LPEF+  DL+  K A  LDFIGI
Sbjct  303  ADRLAADRAQAFYLTWFLDPVVFGRYPREMREILGDDLPEFTKDDLKSSKNA--LDFIGI  360

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE          P GME++
Sbjct  361  NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVYANALKDGLRLGE----------PVGMEEM  409

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NI LYVTENG+ +  T       +LND +RVKF+++YL+AL   +RKGADV
Sbjct  410  LMYATERYKNITLYVTENGFGENNTGV-----LLNDYQRVKFMSNYLDALKRAMRKGADV  464

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVN  169
            RGYF WSL DNFEW  GYT R G+Y  D  T +RTP+LSA WYK FI +++ ++
Sbjct  465  RGYFAWSLLDNFEWISGYTIRFGMYHVDFSTQERTPRLSASWYKNFIFQHRALS  518



>gb|KJB81916.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=514

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 155/238 (65%), Gaps = 6/238 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D+ A  RA +F   W LDP+++G YP +M+    S LP FSS + E +K  G +DFIG+
Sbjct  253  SDRQAVNRALAFTGGWVLDPLVFGDYPPEMRQYHRSELPRFSSEETEYMK--GSIDFIGL  310

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C   + G+    GF   +  +DG LIGE  G+E   V P GMEK+
Sbjct  311  NHYSTLYAKDCIHSPC--VLGGDHFIRGFTFTTGERDGTLIGEPTGVERFYVVPRGMEKI  368

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V +V ++++N+P+YVTENGYC   T   +  ++L+D  RV F   YL AL+  IRKGADV
Sbjct  369  VDHVSKRYNNMPIYVTENGYCPPLT--EAAPNLLHDVNRVHFYNGYLAALARAIRKGADV  426

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            RGYF WSL DNFEW+ GY+   GLY  DR+T+ RTPKLSAKW++ F+A         Q
Sbjct  427  RGYFAWSLMDNFEWAGGYSSTFGLYYVDRLTMNRTPKLSAKWFQHFLANRSSARFNRQ  484



>ref|XP_008669177.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Zea 
mays]
 tpg|DAA36953.1| TPA: hypothetical protein ZEAMMB73_881817 [Zea mays]
Length=509

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 164/246 (67%), Gaps = 7/246 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A  RA SF + WFLDP+ +G YP  M+ ILG NLP+F++ + + LK    +DFIG
Sbjct  268  TEDHLAVSRALSFEAPWFLDPLFFGDYPHQMRQILGPNLPKFTAGEEKLLKNQ--IDFIG  325

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHY T+Y +DC+YS CD         E  V +S  ++G  IG++       V P  MEK
Sbjct  326  VNHYQTFYVKDCIYSLCD---IDPYTSEALVSESTERNGIPIGKLTQDANTYVVPSSMEK  382

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+KE+++NIPLY+TENGY      ++++E+++NDT+R+ ++ DYL  LS  IRKGAD
Sbjct  383  LVMYLKERYNNIPLYITENGYAQIPNISTTVEEIINDTERINYIRDYLTYLSFAIRKGAD  442

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVN--SKM  160
            VRGYF+WSL D+FEW  GYT + GL+  +  +LKRTPKLSAKWY +FI   +++   S+ 
Sbjct  443  VRGYFVWSLMDSFEWISGYTIKYGLFHVNFKSLKRTPKLSAKWYNKFIKGYEQIEIASEE  502

Query  159  QLRNMI  142
             L +M+
Sbjct  503  SLEHMV  508



>ref|XP_009624454.1| PREDICTED: beta-glucosidase 18 [Nicotiana tomentosiformis]
Length=521

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 153/228 (67%), Gaps = 5/228 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D AA +RA SF  NWFLDPII G YPK+M  ILGSNLP+FS  DL KL    GLDFIG
Sbjct  285  SEDIAATQRARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSVNDLRKLSY--GLDFIG  342

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            IN+YT  Y +DCLYS C+    GNT  EG    +  KDG  IG+   +++L +YP GM+K
Sbjct  343  INYYTAKYIKDCLYSACE---HGNTWSEGSYFVTTQKDGVDIGQPTEVDWLFLYPQGMKK  399

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K++F+N P+ +TENG  +    N S+ D LND  RV ++  YL +L+  IR+GAD
Sbjct  400  IVIYMKDRFNNTPMVITENGIAENENLNPSITDTLNDVHRVNYMHSYLTSLANAIREGAD  459

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            VRGYF+WSL DNFEW  GY+ R GL+  +   L+R PKLSA  YK  +
Sbjct  460  VRGYFVWSLLDNFEWLDGYSLRFGLHYVNFTNLQRIPKLSATSYKGLM  507



>ref|XP_002888064.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64323.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 164/235 (70%), Gaps = 4/235 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AAERA SF SNW LDP++YG YP++M +ILGS LP FSS ++  +K     DF+GI
Sbjct  280  VDKNAAERAQSFYSNWILDPVVYGKYPEEMVNILGSALPRFSSNEMNSIKNYKS-DFLGI  338

Query  690  NHYTTYYAQDCLYSTCDP-SMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGME  517
            NHYT+Y+ QDCL + C+  S  G ++ EGF  +   + GN+ IGE+  + +  + P G +
Sbjct  339  NHYTSYFIQDCLITACNSGSGNGASKSEGFALK-LDRKGNVSIGELTDVNWQHIDPDGFK  397

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            K++ Y+K ++ N+P+++TENG+     P ++++++L+DTKR+++++ YL+AL   +R GA
Sbjct  398  KMLNYLKNRYHNMPMFITENGFGTLQKPETTVKELLDDTKRIQYMSGYLDALKEAMRDGA  457

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            +V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA WYK FI ++  +
Sbjct  458  NVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLKRTPKQSASWYKNFIEQHGNI  512



>gb|KJB81911.1| hypothetical protein B456_013G167400 [Gossypium raimondii]
Length=546

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 155/238 (65%), Gaps = 6/238 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D+ A  RA +F   W LDP+++G YP +M+    S LP FSS + E +K  G +DFIG+
Sbjct  285  SDRQAVNRALAFTGGWVLDPLVFGDYPPEMRQYHRSELPRFSSEETEYMK--GSIDFIGL  342

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C   + G+    GF   +  +DG LIGE  G+E   V P GMEK+
Sbjct  343  NHYSTLYAKDCIHSPC--VLGGDHFIRGFTFTTGERDGTLIGEPTGVERFYVVPRGMEKI  400

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V +V ++++N+P+YVTENGYC   T   +  ++L+D  RV F   YL AL+  IRKGADV
Sbjct  401  VDHVSKRYNNMPIYVTENGYCPPLT--EAAPNLLHDVNRVHFYNGYLAALARAIRKGADV  458

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            RGYF WSL DNFEW+ GY+   GLY  DR+T+ RTPKLSAKW++ F+A         Q
Sbjct  459  RGYFAWSLMDNFEWAGGYSSTFGLYYVDRLTMNRTPKLSAKWFQHFLANRSSARFNRQ  516



>ref|XP_010023758.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW60129.1| hypothetical protein EUGRSUZ_H02855 [Eucalyptus grandis]
Length=518

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 155/230 (67%), Gaps = 10/230 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ A +RA +F   WF+DP +YG YP +M+ I+GS LP FS+ +  +L A   LDFIGI
Sbjct  283  ADRLAVQRALAFDFAWFVDPFVYGDYPPEMRQIVGSRLPTFSAEERNRLDAK--LDFIGI  340

Query  690  NHYTTYYAQDCLYSTC-DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            NHYTT YA+DC++STC  P   G    E FV  +  KDG  IGE   +    + P G+E 
Sbjct  341  NHYTTKYAKDCMFSTCTSPYSLG----EAFVYVTGEKDGVYIGERTAMSDFFIVPRGIEG  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +VTYVKE+++N P+++TENGY     P   ++D LNDTKR+++   YL  LS  +RKGAD
Sbjct  397  IVTYVKERYNNTPMFITENGYAQFAGP---IDDSLNDTKRIEYHEGYLAVLSEVVRKGAD  453

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK  184
            VRGYFIWSL DNFEW  GY  R GL+  D  TLKRTPK SA WYK+F+++
Sbjct  454  VRGYFIWSLLDNFEWLHGYLVRFGLHYVDFQTLKRTPKWSATWYKEFLSE  503



>ref|XP_010240132.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Brachypodium 
distachyon]
Length=431

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 8/230 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A +RA SF + WFLDPII G YP +M+ +LG+NLP F+S +  KL+A   LDFIG
Sbjct  188  TVDLLAVQRAISFNAPWFLDPIILGDYPPEMRQMLGANLPNFTSKEKRKLQATK-LDFIG  246

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            +NHYTT Y +DC++S C  DP + G+ R    V     +DG LIGE  G  Y    P GM
Sbjct  247  LNHYTTVYLKDCIFSPCAVDP-IDGDAR----VVSLAERDGVLIGEPTGTPYFYDVPHGM  301

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            EKVV + K++++N P Y+TENGY   +  + +  D +ND  R+ ++  YL  L++ IRKG
Sbjct  302  EKVVMHYKQRYNNTPTYITENGYAQASNHSMAANDFINDAGRIHYIRGYLTFLASAIRKG  361

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            AD+RGYF+WSL D+FEW+ GYT+R GLY  D  T KRTPKLSA WY++F+
Sbjct  362  ADIRGYFVWSLLDDFEWTSGYTQRYGLYHVDFKTQKRTPKLSAGWYRKFL  411



>ref|XP_010240133.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X3 [Brachypodium 
distachyon]
Length=425

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 8/230 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A +RA SF + WFLDPII G YP +M+ +LG+NLP F+S +  KL+A   LDFIG
Sbjct  182  TVDLLAVQRAISFNAPWFLDPIILGDYPPEMRQMLGANLPNFTSKEKRKLQATK-LDFIG  240

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            +NHYTT Y +DC++S C  DP + G+ R    V     +DG LIGE  G  Y    P GM
Sbjct  241  LNHYTTVYLKDCIFSPCAVDP-IDGDAR----VVSLAERDGVLIGEPTGTPYFYDVPHGM  295

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            EKVV + K++++N P Y+TENGY   +  + +  D +ND  R+ ++  YL  L++ IRKG
Sbjct  296  EKVVMHYKQRYNNTPTYITENGYAQASNHSMAANDFINDAGRIHYIRGYLTFLASAIRKG  355

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            AD+RGYF+WSL D+FEW+ GYT+R GLY  D  T KRTPKLSA WY++F+
Sbjct  356  ADIRGYFVWSLLDDFEWTSGYTQRYGLYHVDFKTQKRTPKLSAGWYRKFL  405



>ref|XP_008454703.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=480

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 153/229 (67%), Gaps = 4/229 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  AAERA  F+  W  DPI+YG YPK+M++ILGS LP FS  D+EK    G LDF+ +N
Sbjct  234  DIKAAERAFIFIFAWVYDPIVYGDYPKEMQEILGSQLPSFS--DIEKNIIRGSLDFVCVN  291

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT+Y +DCL+S C  S  G+    G++  +  +DG  IG+  G++   V P G+ KV+
Sbjct  292  HYTTFYTKDCLHSPC--SDGGDHAITGYLNTTAYRDGVSIGDPTGIDVFFVVPRGLGKVI  349

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+KE++ N P++VTENGY       +++ED++ DTKRV +  DYL +L+  +R GADVR
Sbjct  350  NYIKERYPNKPIFVTENGYSMPQAEGNNVEDLIKDTKRVNYHKDYLASLAKAMRDGADVR  409

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW+ GY  R GL   DR TL+R PKLSA W+  F+  N
Sbjct  410  GYFVWSLIDNFEWADGYDTRFGLLYVDRKTLERRPKLSAHWFSSFLGGN  458



>ref|XP_003581423.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Brachypodium 
distachyon]
Length=518

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 8/230 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A +RA SF + WFLDPII G YP +M+ +LG+NLP F+S +  KL+A   LDFIG
Sbjct  275  TVDLLAVQRAISFNAPWFLDPIILGDYPPEMRQMLGANLPNFTSKEKRKLQATK-LDFIG  333

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            +NHYTT Y +DC++S C  DP + G+ R    V     +DG LIGE  G  Y    P GM
Sbjct  334  LNHYTTVYLKDCIFSPCAVDP-IDGDAR----VVSLAERDGVLIGEPTGTPYFYDVPHGM  388

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            EKVV + K++++N P Y+TENGY   +  + +  D +ND  R+ ++  YL  L++ IRKG
Sbjct  389  EKVVMHYKQRYNNTPTYITENGYAQASNHSMAANDFINDAGRIHYIRGYLTFLASAIRKG  448

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            AD+RGYF+WSL D+FEW+ GYT+R GLY  D  T KRTPKLSA WY++F+
Sbjct  449  ADIRGYFVWSLLDDFEWTSGYTQRYGLYHVDFKTQKRTPKLSAGWYRKFL  498



>gb|EMS60351.1| Beta-glucosidase 16 [Triticum urartu]
Length=530

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 162/244 (66%), Gaps = 9/244 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSID---LEKLKAAGGLD  703
            T D  AA RA SF  +WFL+PI +G YP++M ++L SNLP+F+S +   L+K KA    D
Sbjct  290  TEDILAARRALSFEVDWFLEPIFFGDYPREMHELLASNLPKFTSEEKSLLQKNKA----D  345

Query  702  FIGINHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPG  523
            FIG+NHYTT Y +DC+ S CD +          V  +  +DG  IG+    +   V P G
Sbjct  346  FIGVNHYTTIYVKDCISSPCDLNTYEAYEGNALVLATGERDGVAIGKPTAFDGYYVVPEG  405

Query  522  MEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRK  343
            ME++V YV ++++N P+YVTENGY   +  N++M++++ND +RV +L  YL  LS+ IRK
Sbjct  406  MEQIVKYVNQRYTNTPVYVTENGYSQYS--NNTMDELMNDGERVNYLQGYLTFLSSAIRK  463

Query  342  GADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            GA+VRGYF+WS+ DNFEW+FG+T R GLY  D  T KRTPK+SAKWY+ F+  ++  +  
Sbjct  464  GANVRGYFVWSIIDNFEWTFGFTVRFGLYHVDYETQKRTPKMSAKWYRDFLMGSRPTDQV  523

Query  162  MQLR  151
              LR
Sbjct  524  QTLR  527



>gb|AFO12647.1| beta-glucosidase, partial [Cucumis sativus]
Length=337

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 157/246 (64%), Gaps = 7/246 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  AA+RA  F+  W  DPI+YG YPK+M++ILGS LP FS  D+EK    G LDFI +N
Sbjct  91   DIKAAQRALIFIFAWVYDPIVYGDYPKEMREILGSQLPSFS--DVEKDIIRGSLDFICVN  148

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT+Y +DCL+S C      N    G++  +  +DG  IG+  G++   V P G+ KV+
Sbjct  149  HYTTFYTKDCLHSACFGGR--NHPVTGYLNTTAYRDGVSIGDPTGIDVFFVVPRGLGKVI  206

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+KE++ N P++VTENGY    +  +  E ++ DTKRV +  +YL +L+  +R GADVR
Sbjct  207  NYIKERYPNKPIFVTENGYSSPQSEGNETEVLIKDTKRVNYHKNYLASLANAMRDGADVR  266

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLRN  148
            GYF+WSL DNFEW+ GY  R GL   DR TL+R PKLSA W+  F+  N    +K    +
Sbjct  267  GYFVWSLIDNFEWADGYDTRFGLLYVDRKTLERRPKLSAHWFSSFLGGNLHELTKY---S  323

Query  147  MILHQN  130
             I+H+N
Sbjct  324  SIVHKN  329



>gb|KDP39384.1| hypothetical protein JCGZ_01141 [Jatropha curcas]
Length=488

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 158/227 (70%), Gaps = 7/227 (3%)
 Frame = -2

Query  858  AAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGINHYT  679
            A +RA +F + WF+DPI+YG YP +M+ I+G  LP+FS  D +KL++   LDFIGINHY+
Sbjct  260  ATQRALAFYAAWFMDPIMYGEYPPEMQQIVGLRLPKFSVEDRKKLESK--LDFIGINHYS  317

Query  678  TYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVVTYV  499
            T YA+DCL S+C+  +T +   + F   +  +DG LIG+   +    V P  MEK + Y 
Sbjct  318  TLYAKDCLVSSCN--ITTDIIADSFAYITGERDGVLIGQPTAMPTFYVVPNSMEKTIMYF  375

Query  498  KEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVRGYF  319
            K +++N P+++TENGY   ++   ++ED+LNDT R++++  YL +L+  +RKGADVRGYF
Sbjct  376  KNRYNNTPMFITENGYAQPSS--KAIEDMLNDTSRIEYMQSYLTSLAAALRKGADVRGYF  433

Query  318  IWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
             WSL DNFEW +GYT   GLY  DR TL+RTPK SAKW+ QF+ KN+
Sbjct  434  HWSLIDNFEWRYGYTICFGLYYVDRTTLQRTPKQSAKWFHQFL-KNE  479



>ref|XP_009397666.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=502

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 155/227 (68%), Gaps = 5/227 (2%)
 Frame = -2

Query  843  HSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGINHYTTYYAQ  664
             SF   WFLDPIIYG YP  M+ ILGS LP FS+ D +KL+     DFIG+NHYT+ YA+
Sbjct  280  QSFYVPWFLDPIIYGDYPPAMRQILGSRLPRFSTSDKKKLQHKS--DFIGVNHYTSSYAK  337

Query  663  DCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVVTYVKEKFS  484
            DC++S C+    G +  +  V  +  ++G  IG+   +    V P GMEK+V Y+K+++ 
Sbjct  338  DCMFSPCE---GGGSEGDASVLTTGERNGLAIGKPTAMPNFYVVPRGMEKIVMYIKKRYK  394

Query  483  NIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVRGYFIWSLF  304
            NIP+++TENGY   +  N+S++D+LND  RV++L  YL++L   +R+GADVRGYF+WSL 
Sbjct  395  NIPMFITENGYPQGSDHNTSVKDLLNDKDRVEYLRSYLSSLHKAMRQGADVRGYFVWSLI  454

Query  303  DNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            DNFEW +GYT R GLY  +  T +RTPKLSA WY++F+  +Q +  K
Sbjct  455  DNFEWLYGYTLRFGLYHVNYETQERTPKLSATWYQEFLEDSQVLIQK  501



>ref|XP_012071272.1| PREDICTED: beta-glucosidase 18-like [Jatropha curcas]
Length=502

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 159/231 (69%), Gaps = 7/231 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D  A +RA +F + WF+DPI+YG YP +M+ I+G  LP+FS  D +KL++   LDFIGI
Sbjct  270  VDFFATQRALAFYAAWFMDPIMYGEYPPEMQQIVGLRLPKFSVEDRKKLESK--LDFIGI  327

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DCL S+C+  +T +   + F   +  +DG LIG+   +    V P  MEK 
Sbjct  328  NHYSTLYAKDCLVSSCN--ITTDIIADSFAYITGERDGVLIGQPTAMPTFYVVPNSMEKT  385

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y K +++N P+++TENGY   ++   ++ED+LNDT R++++  YL +L+  +RKGADV
Sbjct  386  IMYFKNRYNNTPMFITENGYAQPSS--KAIEDMLNDTSRIEYMQSYLTSLAAALRKGADV  443

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            RGYF WSL DNFEW +GYT   GLY  DR TL+RTPK SAKW+ QF+ KN+
Sbjct  444  RGYFHWSLIDNFEWRYGYTICFGLYYVDRTTLQRTPKQSAKWFHQFL-KNE  493



>gb|KEH38761.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=529

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 151/227 (67%), Gaps = 4/227 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA RA +F+  W LDP+++G YP DM+ ILGS LP FSS +   L+  G LDFIGI
Sbjct  281  CDRQAANRALAFVIGWLLDPLVFGEYPADMRSILGSQLPRFSSKEKSLLR--GSLDFIGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+Y   YA+DC  STC   +      +GF+  +  +DG  IG+  G+++  V P GMEK+
Sbjct  339  NNYGALYAKDCYLSTC--PLEAARPIKGFLQTTGMRDGIPIGDQTGMKWFFVVPKGMEKI  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+K K+ N+P+Y+TENGY        +M D+L+D KR+++   YL AL   +RKGADV
Sbjct  397  VDYIKIKYHNMPMYITENGYSSPLNAGMTMNDLLHDFKRIEYHKAYLAALLRAMRKGADV  456

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            RGY +WSLFDNFEW+ GY K+ GLY  DR TL+R PKLS +W+  F+
Sbjct  457  RGYMVWSLFDNFEWNSGYDKKFGLYYVDRQTLERIPKLSVEWFSSFL  503



>ref|XP_010430205.1| PREDICTED: beta-glucosidase 46-like isoform X2 [Camelina sativa]
Length=498

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+++G YP++M  ILGS LPEFSS ++  LK     DF+GI
Sbjct  280  ADKKAAERAQSFYSNWILDPVVFGKYPEEMVKILGSALPEFSSNEMNNLKNYKS-DFLGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL + C+ S  G ++ EGF  +   + GN+ IGE+  +++  + P G +K
Sbjct  339  NHYTSYFIQDCLITACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVDWQHIDPDGFKK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+K ++ NIP+Y+TENG+     P ++++++++DTKR+++L++YL+AL   +R GA+
Sbjct  397  MLNYLKNRYHNIPMYITENGFGQLQKPETTVKELMHDTKRIQYLSEYLDALKAAMRDGAN  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSA  211
            V+GYF WSL DNFEW +GY  R GL+  D  TLKRTPK SA
Sbjct  457  VKGYFAWSLLDNFEWLYGYKVRFGLFHVDYATLKRTPKQSA  497



>gb|ABC55715.1| beta-mannosidase 4 [Oncidium hybrid cultivar]
Length=498

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 155/230 (67%), Gaps = 5/230 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  AA RA +F   WFLDPIIYGSYP DM  +LGS LP FS  D  KL+++  LDFIG+N
Sbjct  271  DAMAAARALAFEVGWFLDPIIYGSYPPDMIQLLGSVLPTFSGSDKRKLRSS--LDFIGVN  328

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY++ Y +DCL+S+C     G     G V     K+G  IG   G+  L V P G EK+V
Sbjct  329  HYSSLYPKDCLFSSC---YLGPFVSNGSVLGLGYKNGVPIGPKTGMPNLFVTPNGTEKIV  385

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             YVKE++ N P+++TENGY   ++ N   +D+LND  RV+FL  YL +LS  IRKGADVR
Sbjct  386  LYVKERYKNKPMFLTENGYGQNSSDNLLTKDILNDEVRVEFLKSYLTSLSNAIRKGADVR  445

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQ  178
            GYFIWSL DNFEW  GY++R GLY  D +T KRTPK SAKWYK+F+ + +
Sbjct  446  GYFIWSLLDNFEWVHGYSERFGLYYVDYLTQKRTPKQSAKWYKKFLIEKK  495



>ref|XP_002448170.1| hypothetical protein SORBIDRAFT_06g022420 [Sorghum bicolor]
 gb|EES12498.1| hypothetical protein SORBIDRAFT_06g022420 [Sorghum bicolor]
Length=817

 Score =   238 bits (607),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 154/234 (66%), Gaps = 5/234 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A  RA SF + WFLDP+ +G YP  M+ ILG NLP+F+  + + LK    +DFIG
Sbjct  576  TEDHLAVSRALSFQAPWFLDPLFFGDYPHQMRQILGPNLPKFTKGEKQLLKNQ--IDFIG  633

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY T Y +DC++S CD         +  V +S  ++G LIG+   +    V P  MEK
Sbjct  634  INHYETLYIKDCIHSLCDLDTYAG---DALVTESAERNGILIGKPTPVANTCVVPSSMEK  690

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K+++ +IPLY+TENGY      +++ E+++NDT+R  ++ DYL  LS  IRKGAD
Sbjct  691  LVMYLKQRYKSIPLYITENGYAQIGNSSTTTEELINDTERSSYIHDYLTYLSLAIRKGAD  750

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            VRGYF+WSL DNFEW  GYT + GLY  D  +LKRTPKLSAKWY +FI  N+ +
Sbjct  751  VRGYFVWSLMDNFEWLSGYTTKYGLYYVDFKSLKRTPKLSAKWYSKFIKGNEHI  804



>ref|XP_002448166.1| hypothetical protein SORBIDRAFT_06g022385 [Sorghum bicolor]
 gb|EES12494.1| hypothetical protein SORBIDRAFT_06g022385, partial [Sorghum bicolor]
Length=378

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 153/234 (65%), Gaps = 6/234 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A  RA SF + WFLDP+ +G YP+ M  ILG NLP+F+  + + LK    +DFIG
Sbjct  138  TEDHLAVSRALSFEAQWFLDPLFFGEYPQQMHKILGPNLPKFTEGEKQLLKKQ--IDFIG  195

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHY TYY +DC+YS CD  +         V +S  ++G  IG++      VV P  MEK
Sbjct  196  VNHYETYYVKDCIYSQCDLDLYTCV---ALVSESSERNGMPIGKLTPANSYVV-PSSMEK  251

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+++++ +IPLY+TENGY      +++ E+++ND  R  ++ DYL  LS  IRKGAD
Sbjct  252  LVMYLEQRYKSIPLYITENGYAQIGNSSTTTEELINDNGRSGYIGDYLTYLSFAIRKGAD  311

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            VRGYF+WSL D FEW+ GYT + GL+  D  +LKRTP+LSAKWY +FI   +++
Sbjct  312  VRGYFVWSLMDTFEWNSGYTAKYGLFHVDFKSLKRTPRLSAKWYSKFIKGYEQI  365



>ref|XP_009413740.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 158/241 (66%), Gaps = 11/241 (5%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD  A +RA SF   W LDPI+ G YP +M ++LGS LP F+    EK      LDFIG
Sbjct  246  TADCLATQRALSFEGPWILDPILLGDYPSEMHEVLGSRLPIFTY--EEKKLLLNKLDFIG  303

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+T Y  DC+ S+CD  + G  R+   +  +  KDG LIGE   L      P G+EK
Sbjct  304  INHYSTNYVMDCMLSSCD--LDGYMRD-ALIATTGYKDGVLIGEPTALPTYYAVPYGIEK  360

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+ E+++N+P+Y+TENGY   ++  +  ++++NDT+R+KF+  YL  LS  I +GAD
Sbjct  361  MVRYIMERYNNVPMYITENGYAQGSS-GAFTKELINDTERIKFMHSYLTFLSAAISQGAD  419

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            VRGYF WSL DNFEW+FGYT R GL+  D  T +RTPKLSAKWYK+F++       K+QL
Sbjct  420  VRGYFSWSLLDNFEWAFGYTVRFGLFHVDYKTQRRTPKLSAKWYKKFLS-----GKKLQL  474

Query  153  R  151
            R
Sbjct  475  R  475



>ref|XP_006593298.1| PREDICTED: beta-glucosidase 18-like [Glycine max]
Length=536

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 147/239 (62%), Gaps = 4/239 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ A  RA +FL  W LDP+++G YP +M  ILGS LP FS  +   LK  G +DFIGI
Sbjct  281  CDRQAVNRALAFLIPWVLDPLVFGEYPAEMHSILGSQLPVFSLKEKSLLK--GSIDFIGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY + Y +DC  S C  S+  +    GFV  +  +DG  IG+  G  +  V P GM+K+
Sbjct  339  NHYGSLYVKDCSLSAC--SLEADHPITGFVEVTGIRDGVPIGDQTGFSWFYVVPRGMQKL  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V YVK ++ NIP+Y+TENGYC    P+ +M D+L D KR+ +   YL AL   IRKGADV
Sbjct  397  VDYVKIRYHNIPMYITENGYCSPLKPDETMHDLLQDVKRIDYHKAYLAALLRAIRKGADV  456

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            RGY IWSL DNFEW+ GY  R GLY  +R T +R PKLS +W+  F+    + N    L
Sbjct  457  RGYMIWSLLDNFEWANGYEIRYGLYHVNRDTHERIPKLSVQWFSSFLNNTIRTNITEHL  515



>gb|KHN28048.1| Beta-glucosidase 18 [Glycine soja]
Length=546

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 147/239 (62%), Gaps = 4/239 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ A  RA +FL  W LDP+++G YP +M  ILGS LP FS  +   LK  G +DFIGI
Sbjct  291  CDRQAVNRALAFLIPWVLDPLVFGEYPAEMHSILGSQLPVFSLKEKSLLK--GSIDFIGI  348

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY + Y +DC  S C  S+  +    GFV  +  +DG  IG+  G  +  V P GM+K+
Sbjct  349  NHYGSLYVKDCSLSAC--SLEADHPITGFVEVTGIRDGVPIGDQTGFSWFYVVPRGMQKL  406

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V YVK ++ NIP+Y+TENGYC    P+ +M D+L D KR+ +   YL AL   IRKGADV
Sbjct  407  VDYVKIRYHNIPMYITENGYCSPLKPDETMHDLLQDVKRIDYHKAYLAALLRAIRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            RGY IWSL DNFEW+ GY  R GLY  +R T +R PKLS +W+  F+    + N    L
Sbjct  467  RGYMIWSLLDNFEWANGYEIRYGLYHVNRDTHERIPKLSVQWFSSFLNNTIRTNITEHL  525



>gb|KGN59900.1| hypothetical protein Csa_3G852490 [Cucumis sativus]
Length=545

 Score =   231 bits (590),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 158/246 (64%), Gaps = 7/246 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  AA+RA  F+  W  DPI+YG YPK+M++ILGS LP FS  D+EK    G LDFI +N
Sbjct  299  DIKAAQRALIFIFAWVYDPIVYGDYPKEMREILGSQLPSFS--DVEKDIIRGSLDFICVN  356

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT+Y +DCL+S C     GN    G++  +  +DG  IG+  G++   V P G+ KV+
Sbjct  357  HYTTFYTKDCLHSACFGG--GNHPVTGYLNTTAYRDGVSIGDPTGIDVFFVVPRGLGKVI  414

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+KE++ N P++VTENGY    +  +  E ++ DTKRV +  +YL +L+  +R GADVR
Sbjct  415  NYIKERYPNKPIFVTENGYSSPQSEGNETEVLIKDTKRVNYHKNYLASLANAMRDGADVR  474

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLRN  148
            GYF+WSL DNFEW+ GY  R GL   DR TL+R PKLSA W+  F+  N    +K    +
Sbjct  475  GYFVWSLIDNFEWADGYDTRFGLLYVDRKTLERRPKLSAHWFSSFLGGNLHELTKY---S  531

Query  147  MILHQN  130
             I+H+N
Sbjct  532  SIVHKN  537



>gb|EMT31288.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=555

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 155/244 (64%), Gaps = 9/244 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSID---LEKLKAAGGLD  703
            T D  AA RA SF  +WFL+PI +G YP++M  +L SNLP+F+S +   L+K KA    D
Sbjct  315  TEDILAARRALSFEVDWFLEPIFFGDYPREMHKLLSSNLPKFTSEEKSLLQKNKA----D  370

Query  702  FIGINHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPG  523
            FIGINHYTT Y +DC+ S CD            V  +  +DG  IG     +     P G
Sbjct  371  FIGINHYTTIYVKDCISSPCDLKAYEAYEANALVLATGERDGVAIGRPTAFDGYYDVPEG  430

Query  522  MEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRK  343
            ME++V YV +++ N PLYVTENGY   +  N +M+ ++ND +RV +L  YL  LS+ +RK
Sbjct  431  MEQIVKYVNQRYKNTPLYVTENGYSQHS--NDTMDKLINDVERVNYLHGYLTCLSSAVRK  488

Query  342  GADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            GA+VRGYF+WS+ DNFEW+FG+T R GLY  D  T KRTPK+SAKWY+ F+  ++  +  
Sbjct  489  GANVRGYFVWSIIDNFEWTFGFTVRFGLYHVDYGTQKRTPKMSAKWYRDFLMGSRPTDQV  548

Query  162  MQLR  151
              LR
Sbjct  549  QMLR  552



>ref|XP_011652391.1| PREDICTED: beta-glucosidase 18 isoform X2 [Cucumis sativus]
Length=537

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 158/246 (64%), Gaps = 7/246 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  AA+RA  F+  W  DPI+YG YPK+M++ILGS LP FS  D+EK    G LDFI +N
Sbjct  291  DIKAAQRALIFIFAWVYDPIVYGDYPKEMREILGSQLPSFS--DVEKDIIRGSLDFICVN  348

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT+Y +DCL+S C     GN    G++  +  +DG  IG+  G++   V P G+ KV+
Sbjct  349  HYTTFYTKDCLHSACFGG--GNHPVTGYLNTTAYRDGVSIGDPTGIDVFFVVPRGLGKVI  406

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+KE++ N P++VTENGY    +  +  E ++ DTKRV +  +YL +L+  +R GADVR
Sbjct  407  NYIKERYPNKPIFVTENGYSSPQSEGNETEVLIKDTKRVNYHKNYLASLANAMRDGADVR  466

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLRN  148
            GYF+WSL DNFEW+ GY  R GL   DR TL+R PKLSA W+  F+  N    +K    +
Sbjct  467  GYFVWSLIDNFEWADGYDTRFGLLYVDRKTLERRPKLSAHWFSSFLGGNLHELTKY---S  523

Query  147  MILHQN  130
             I+H+N
Sbjct  524  SIVHKN  529



>ref|XP_004487691.1| PREDICTED: beta-glucosidase 18-like [Cicer arietinum]
Length=525

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 148/234 (63%), Gaps = 4/234 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA RA +F+  W LDP+++G YP +M+ ILG  LP+FS    EK    G LDFIGI
Sbjct  278  CDRQAANRALAFVIGWLLDPLVFGEYPVEMRSILGHQLPKFSL--KEKSLLRGSLDFIGI  335

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+Y   YA+DC +S C        R  GFV  +  KDG  IG+  G+    V P G+EK+
Sbjct  336  NNYGALYAKDCYFSNCPIEAAQPIR--GFVETTGMKDGIPIGDKVGMPRFFVVPNGVEKI  393

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V ++K ++ N+P+Y+TENGY     PN +M D+L+D KR+++   YL AL   IRKGADV
Sbjct  394  VDHIKIRYHNMPMYITENGYSSLLNPNMTMHDLLHDFKRIEYHKAYLTALRRAIRKGADV  453

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVN  169
            RGY +WSLFDNFEWS GY    GLY  DR TL+R PKLS +W+  F+  +   N
Sbjct  454  RGYMVWSLFDNFEWSSGYDITFGLYYVDRQTLERIPKLSVQWFSSFLNNDSDTN  507



>ref|XP_009413739.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=508

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 158/241 (66%), Gaps = 11/241 (5%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            TAD  A +RA SF   W LDPI+ G YP +M ++LGS LP F+    EK      LDFIG
Sbjct  271  TADCLATQRALSFEGPWILDPILLGDYPSEMHEVLGSRLPIFTY--EEKKLLLNKLDFIG  328

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            INHY+T Y  DC+ S+CD  + G  R+   +  +  KDG LIGE   L      P G+EK
Sbjct  329  INHYSTNYVMDCMLSSCD--LDGYMRD-ALIATTGYKDGVLIGEPTALPTYYAVPYGIEK  385

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+ E+++N+P+Y+TENGY   ++  +  ++++NDT+R+KF+  YL  LS  I +GAD
Sbjct  386  MVRYIMERYNNVPMYITENGYAQGSS-GAFTKELINDTERIKFMHSYLTFLSAAISQGAD  444

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            VRGYF WSL DNFEW+FGYT R GL+  D  T +RTPKLSAKWYK+F++       K+QL
Sbjct  445  VRGYFSWSLLDNFEWAFGYTVRFGLFHVDYKTQRRTPKLSAKWYKKFLS-----GKKLQL  499

Query  153  R  151
            R
Sbjct  500  R  500



>gb|EMT09723.1| Beta-glucosidase 6 [Aegilops tauschii]
Length=508

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 157/241 (65%), Gaps = 9/241 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T DQ A ERA SF   WFLDPII G YP +M+ ILG  LPEF+    +KL A   LDFIG
Sbjct  264  TVDQLAVERAISFNVPWFLDPIILGDYPAEMRKILGPTLPEFTLKQKKKLHATK-LDFIG  322

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            +NHY+T+Y +DC++S+C  DP M G+ R          +DG  IG+  G  +    P GM
Sbjct  323  LNHYSTWYLKDCIFSSCEMDP-MDGDARALSLA----ERDGVPIGKQTGAPFFYDVPHGM  377

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            EKVV Y K++++N P Y+TENGY   +  + + +D   DT+R+ +++ YL  L + +RKG
Sbjct  378  EKVVMYYKQRYNNTPTYITENGYAQASNSSMTAKDFTGDTERIDYISGYLTYLVSAMRKG  437

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            ADVRGYF+WS+ D+FEW+ GY  R GLY  D  T KRTPKLSA+W+++F+ K   V+ + 
Sbjct  438  ADVRGYFVWSILDDFEWTSGYKDRFGLYHVDFKTQKRTPKLSAEWFREFL-KGSLVSREF  496

Query  159  Q  157
            Q
Sbjct  497  Q  497



>ref|XP_011652390.1| PREDICTED: beta-glucosidase 18 isoform X1 [Cucumis sativus]
Length=560

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 158/246 (64%), Gaps = 7/246 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  AA+RA  F+  W  DPI+YG YPK+M++ILGS LP FS  D+EK    G LDFI +N
Sbjct  314  DIKAAQRALIFIFAWVYDPIVYGDYPKEMREILGSQLPSFS--DVEKDIIRGSLDFICVN  371

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT+Y +DCL+S C     GN    G++  +  +DG  IG+  G++   V P G+ KV+
Sbjct  372  HYTTFYTKDCLHSAC--FGGGNHPVTGYLNTTAYRDGVSIGDPTGIDVFFVVPRGLGKVI  429

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+KE++ N P++VTENGY    +  +  E ++ DTKRV +  +YL +L+  +R GADVR
Sbjct  430  NYIKERYPNKPIFVTENGYSSPQSEGNETEVLIKDTKRVNYHKNYLASLANAMRDGADVR  489

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLRN  148
            GYF+WSL DNFEW+ GY  R GL   DR TL+R PKLSA W+  F+  N    +K    +
Sbjct  490  GYFVWSLIDNFEWADGYDTRFGLLYVDRKTLERRPKLSAHWFSSFLGGNLHELTKY---S  546

Query  147  MILHQN  130
             I+H+N
Sbjct  547  SIVHKN  552



>ref|XP_002448169.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
 gb|EES12497.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
Length=510

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 150/234 (64%), Gaps = 5/234 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A  RA SF + WFLDP+ +G YP  M+ ILG NLPEF+  + EK      +DFIG
Sbjct  269  TDDHLAVSRAQSFEAPWFLDPLFFGDYPHQMRQILGPNLPEFT--EGEKQLMKNQIDFIG  326

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHY T Y +DC+YS CD         +  V +S  ++G  IG+   +    V P  MEK
Sbjct  327  VNHYKTLYVKDCVYSLCDLDTYAG---DALVSESAERNGIPIGKPTPVANNYVVPSSMEK  383

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+ +++ +IPLY+TENGY      +++ E+++NDT+R  ++ DYL  LS  IRKGAD
Sbjct  384  LVMYLTQRYKSIPLYITENGYAQIGNSSTTTEELINDTERSSYIRDYLTYLSFAIRKGAD  443

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            VRGYF+WSL DNFEW  GYT + GLY  D  +LKRTPKLSAKWY  FI   +++
Sbjct  444  VRGYFVWSLMDNFEWLSGYTIKYGLYHVDFKSLKRTPKLSAKWYSNFIKGYEQI  497



>ref|NP_001053302.1| Os04g0513100 [Oryza sativa Japonica Group]
 sp|Q7XPY7.2|BGL14_ORYSJ RecName: Full=Probable inactive beta-glucosidase 14; Short=Os4bglu14; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE03397.2| OSJNBa0004N05.21 [Oryza sativa Japonica Group]
 dbj|BAF15216.1| Os04g0513100 [Oryza sativa Japonica Group]
 dbj|BAG90635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77631.1| hypothetical protein OsI_16623 [Oryza sativa Indica Group]
Length=516

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 154/230 (67%), Gaps = 8/230 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A +RA SF ++WFLDPI+ G YP +M+++LG +LP+F+S    +L++   LDFIG
Sbjct  272  TIDLLAVKRALSFGASWFLDPILLGDYPTEMREVLGQSLPKFTSKQKNRLQSTK-LDFIG  330

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            +NHYTT Y +DC++S C  DP        +  V   + +DG  IG+  G  +    P GM
Sbjct  331  LNHYTTCYVKDCIFSPCEIDP-----VNADARVFSLYERDGVPIGKATGAPFFHDVPRGM  385

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            E+ VTY K++++N P Y+TENGY   +  N + +D  NDT R+ ++  YL +L++ IRKG
Sbjct  386  EEAVTYYKQRYNNTPTYITENGYSQASNSNMTAKDFTNDTGRITYIQGYLISLASAIRKG  445

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            ADVRGYF+WSL D+FEW+FGYT R GLY     TLKRTPKLS  WY++F+
Sbjct  446  ADVRGYFVWSLLDDFEWNFGYTLRFGLYHVHYKTLKRTPKLSVDWYRKFL  495



>gb|EMS59801.1| putative inactive beta-glucosidase 14 [Triticum urartu]
Length=552

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 157/241 (65%), Gaps = 9/241 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T DQ A ERA SF   WFLDPII G YP +M+ ILG  LPEF+    +KL A   LDFIG
Sbjct  308  TIDQLAVERAISFNVPWFLDPIILGDYPAEMRKILGPTLPEFTLKQKKKLHATK-LDFIG  366

Query  693  INHYTTYYAQDCLYSTC--DPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGM  520
            +NHY+T+YA+DC++S C  DP M G+ R    V     +DG  IG+  G  +    P GM
Sbjct  367  LNHYSTWYAKDCIFSPCEMDP-MDGDARVLSLV----ERDGVPIGKETGAPFFYDVPHGM  421

Query  519  EKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKG  340
            EK V Y K++++N P Y+TENGY   +  + + +D   DT+R+ +++ YL  L + IRKG
Sbjct  422  EKAVMYYKQRYNNTPTYITENGYAQASNSSMTAKDFTGDTERIDYISGYLTYLVSAIRKG  481

Query  339  ADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKM  160
            ADVRGYF+WS+ D+FEW+ GY  R GLY  D  T KRTPKLSA+W+++F+ K   V+ + 
Sbjct  482  ADVRGYFVWSILDDFEWTSGYKDRFGLYHVDFKTQKRTPKLSAEWFREFL-KGSLVSREF  540

Query  159  Q  157
            Q
Sbjct  541  Q  541



>ref|XP_003541851.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=537

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 151/239 (63%), Gaps = 4/239 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ A  R  +F   W LDP+++G YP +M+ ILGS +P FS +  EK    G LDFIGI
Sbjct  291  CDRQAVSRGLAFDIAWVLDPLVFGEYPPEMRSILGSKMPVFSPV--EKSLIKGSLDFIGI  348

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY T YA+DC  STC  S+  +    GF+ ++ ++DG  IG+  G+    V P GMEK+
Sbjct  349  NHYGTLYAKDCSLSTC--SLGADHPIAGFLERTATRDGIPIGDPTGVPDFFVVPRGMEKL  406

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+K ++ N+P+Y+TENGY     P+ ++ D+L D KR+ +   YL AL  +IRKGADV
Sbjct  407  VEYIKIRYRNMPMYITENGYSQPPKPDVTIHDLLQDFKRIDYHKAYLAALLRSIRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            RGY IWSL DNFEW+ GY  R GLY  DR TL+R PKLS +W+  F+  +   N    L
Sbjct  467  RGYMIWSLLDNFEWTSGYDIRFGLYYVDRGTLERIPKLSVQWFSSFLNNSSHPNITEHL  525



>ref|XP_006594785.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=543

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 151/239 (63%), Gaps = 4/239 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ A  R  +F   W LDP+++G YP +M+ ILGS +P FS +  EK    G LDFIGI
Sbjct  291  CDRQAVSRGLAFDIAWVLDPLVFGEYPPEMRSILGSKMPVFSPV--EKSLIKGSLDFIGI  348

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY T YA+DC  STC  S+  +    GF+ ++ ++DG  IG+  G+    V P GMEK+
Sbjct  349  NHYGTLYAKDCSLSTC--SLGADHPIAGFLERTATRDGIPIGDPTGVPDFFVVPRGMEKL  406

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+K ++ N+P+Y+TENGY     P+ ++ D+L D KR+ +   YL AL  +IRKGADV
Sbjct  407  VEYIKIRYRNMPMYITENGYSQPPKPDVTIHDLLQDFKRIDYHKAYLAALLRSIRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQL  154
            RGY IWSL DNFEW+ GY  R GLY  DR TL+R PKLS +W+  F+  +   N    L
Sbjct  467  RGYMIWSLLDNFEWTSGYDIRFGLYYVDRGTLERIPKLSVQWFSSFLNNSSHPNITEHL  525



>ref|XP_007021332.1| Beta-glucosidase 45, putative [Theobroma cacao]
 gb|EOY12857.1| Beta-glucosidase 45, putative [Theobroma cacao]
Length=617

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 150/222 (68%), Gaps = 6/222 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  A +RA +F   W +DP+++G YP +M+   GS LP FS  + E +K  G +DFIGI
Sbjct  289  ADLQAVKRALAFTVGWAIDPLVFGDYPPEMRQYHGSELPRFSPEETEYVK--GSIDFIGI  346

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY+T YA+DC++S C  ++ G+    GF   +  +DG LIGE  G+E   V P GMEK+
Sbjct  347  NHYSTLYAKDCIHSHC--ALGGDHFIRGFAYTTGERDGILIGEPTGVERFYVVPRGMEKI  404

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V YV ++++N+P+YVTENGY    T    + D+L+D  R+KF   YL AL+  IR GADV
Sbjct  405  VDYVSKRYNNMPIYVTENGYSPPQT--EQVPDLLHDVNRIKFHRSYLAALARAIRNGADV  462

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKW  205
            RGYF+WSL DNFEW+ GY+   G+Y  DR TLKRTPKLSAKW
Sbjct  463  RGYFVWSLMDNFEWTGGYSVTFGVYYVDRQTLKRTPKLSAKW  504



>ref|XP_002448174.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
 gb|EES12502.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
Length=522

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 148/226 (65%), Gaps = 2/226 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D    ERA SF + WFLDPII G YP  M+ ILG NLPEF+ +  +K+     LDFIG+N
Sbjct  275  DILGVERALSFGAPWFLDPIILGHYPSAMRKILGPNLPEFT-LKQKKILQTSKLDFIGLN  333

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY+T Y +D + S+  P        +  +  S  +DG LIGE  G  Y+   P G+EKVV
Sbjct  334  HYSTNYLKDSI-SSSSPCELDQYDGDAQISTSAERDGILIGERTGSPYINTVPYGIEKVV  392

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+  +++N P+YVTENGY   +  + S +D  NDT RV +L  YL +L++ IRKGADV 
Sbjct  393  TYLNTRYNNTPIYVTENGYAQASNSSMSAKDFTNDTGRVNYLQGYLTSLASAIRKGADVH  452

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            GYF+WSL DNFEW+ GYT+R GLY  D  T KRTPKLS KWY++F+
Sbjct  453  GYFVWSLLDNFEWNNGYTQRFGLYYVDYNTQKRTPKLSTKWYREFL  498



>ref|XP_010473401.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45 [Camelina 
sativa]
Length=552

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 159/225 (71%), Gaps = 4/225 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+IYG YPK+M +ILG+ LP+FSS +++ L  +  +DFIGI
Sbjct  284  ADKEAAERAQSFYSNWILDPVIYGKYPKEMVNILGTALPQFSSNEVKNLNNSR-VDFIGI  342

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNL-IGEMAGLEYLVVYPPGMEK  514
            NHYT+Y+ QDCL S+C+    G  + EGF  +   + GN+ IGE+  +++  + P G  K
Sbjct  343  NHYTSYFIQDCLTSSCNAGY-GAFKAEGFALK-LDRIGNVSIGELTDVDWQHIDPEGFHK  400

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            ++ Y+ +++ NIP+++TENG+ D   P ++ +++L+DTKR+++++ YL AL   +R GA+
Sbjct  401  MLNYLTDRYPNIPMFITENGFGDLQKPETTYKELLHDTKRIQYISGYLEALQAAMRDGAN  460

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYK  199
            V+GYF+WSL DNFEW  GY  R GL+  D  TLKRTPK SA   K
Sbjct  461  VKGYFVWSLLDNFEWLDGYKLRFGLFHVDYTTLKRTPKESASXSK  505



>ref|XP_008669176.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Zea 
mays]
Length=510

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 163/247 (66%), Gaps = 8/247 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNW-FLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFI  697
            T D  A  RA SF +   FLDP+ +G YP  M+ ILG NLP+F++ + + LK    +DFI
Sbjct  268  TEDHLAVSRALSFEAPCRFLDPLFFGDYPHQMRQILGPNLPKFTAGEEKLLKNQ--IDFI  325

Query  696  GINHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            G+NHY T+Y +DC+YS CD         E  V +S  ++G  IG++       V P  ME
Sbjct  326  GVNHYQTFYVKDCIYSLCD---IDPYTSEALVSESTERNGIPIGKLTQDANTYVVPSSME  382

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            K+V Y+KE+++NIPLY+TENGY      ++++E+++NDT+R+ ++ DYL  LS  IRKGA
Sbjct  383  KLVMYLKERYNNIPLYITENGYAQIPNISTTVEEIINDTERINYIRDYLTYLSFAIRKGA  442

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVN--SK  163
            DVRGYF+WSL D+FEW  GYT + GL+  +  +LKRTPKLSAKWY +FI   +++   S+
Sbjct  443  DVRGYFVWSLMDSFEWISGYTIKYGLFHVNFKSLKRTPKLSAKWYNKFIKGYEQIEIASE  502

Query  162  MQLRNMI  142
              L +M+
Sbjct  503  ESLEHMV  509



>gb|EMS46231.1| Beta-glucosidase 16 [Triticum urartu]
Length=509

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 157/242 (65%), Gaps = 9/242 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA SF  +WFLDPI +G YP++M+++L SNLP+F+S +   L++    DFIG
Sbjct  273  TKDILAARRALSFEVDWFLDPIFFGDYPREMREMLSSNLPKFTSEEKRLLQSKA--DFIG  330

Query  693  INHYTTYYAQDCLYSTCD-PSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            +NHYT  YA+DC+ S CD  +  GN   +  VG+   +DG  IG           P GME
Sbjct  331  VNHYTAIYAKDCISSPCDIKTYEGNAMVQA-VGE---RDGVAIGRPTAFHGYYDVPEGME  386

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
             +V YV +++ N P+Y+TENGY   +  ++SME+++ND  RV +L  YL  +S+ +RKGA
Sbjct  387  LIVKYVNQRYENTPVYITENGYSQLS--DNSMEELINDVGRVNYLQGYLTCISSAVRKGA  444

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            +V GYF+WSL DNFEW FG+T R G+Y  D  T +RTPK+S KWY+ F+  ++ V+    
Sbjct  445  NVHGYFVWSLMDNFEWGFGFTVRFGIYHVDFETQERTPKMSGKWYRDFLTGSRPVDQAQT  504

Query  156  LR  151
            LR
Sbjct  505  LR  506



>ref|XP_009378508.1| PREDICTED: beta-glucosidase 18-like [Pyrus x bretschneideri]
Length=516

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/237 (50%), Positives = 157/237 (66%), Gaps = 10/237 (4%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AA+RA +F   W LDP+IYG YP +M+   G  LP+FS+ +   L+  G +DFIG+N
Sbjct  280  DRLAADRALAFNVAWMLDPLIYGDYPAEMRQCHGLALPKFSANEKRLLR--GSIDFIGVN  337

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY+T Y +DC+ STC PS  G+    GF+  +  +DG  IGE  G  YL V P GME+++
Sbjct  338  HYSTLYVKDCINSTC-PS-GGDRPIRGFLNTTSYRDGVPIGEPTGTSYLFVVPRGMEEII  395

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+K ++ N+P++VTENGY   T P  + ++ L D  R+ F   YL +L+  IRKGA+VR
Sbjct  396  DYLKRRYHNVPMFVTENGY---TLP--AQQNELQDMGRINFHKAYLVSLARAIRKGANVR  450

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            GYFIWSL DNFEW  GYT R GLY  DR TL+RTPKLSAKW+  F+ KN   N K +
Sbjct  451  GYFIWSLMDNFEWLSGYTSRFGLYYVDRQTLERTPKLSAKWFASFL-KNNNHNEKEE  506



>gb|EYU26405.1| hypothetical protein MIMGU_mgv1a004080mg [Erythranthe guttata]
Length=545

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/237 (50%), Positives = 157/237 (66%), Gaps = 10/237 (4%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AA+RA +F   W LDP++YG YP++MK+  GS LP FSS + E LK +  +DFIGIN
Sbjct  292  DKEAAKRALAFNVAWTLDPLVYGDYPQEMKNYHGSELPSFSSEEKELLKDS--IDFIGIN  349

Query  687  HYTTYYAQDCLYSTC---DPSMT-GNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVYPPG  523
            HY   YA+DC++S+C   D S T G+ R   GFV  +  ++G  IGE  G+    V P G
Sbjct  350  HYGVLYAKDCVHSSCPCNDSSCTQGSDRPIRGFVYTTGERNGIPIGERTGMSRFFVVPSG  409

Query  522  MEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRK  343
            ME +V YVKE+++N  ++VTENGY   ++PN   +   +D KR+++   YL  L+  IRK
Sbjct  410  MEDIVDYVKERYNNKTMFVTENGY---SSPNDEDDIYEHDVKRIQYHRSYLEYLAQAIRK  466

Query  342  GADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            GADVRGYFIWSL DNFEWS GY  + GLY  DR+TL R PKLSA WY+ F+  +  V
Sbjct  467  GADVRGYFIWSLMDNFEWSSGYAIKFGLYHIDRLTLNRIPKLSANWYRDFLGNSSIV  523



>ref|NP_001053305.1| Os04g0513900 [Oryza sativa Japonica Group]
 dbj|BAF15219.1| Os04g0513900, partial [Oryza sativa Japonica Group]
Length=253

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 147/247 (60%), Gaps = 19/247 (8%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A ERA +F + WFLDP++YG YP +M+ ILG  LP FS  D  KL+    LDFIG+N
Sbjct  26   DRLATERALAFETPWFLDPLVYGDYPPEMRQILGGRLPSFSPEDRRKLRYK--LDFIGVN  83

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT YA+DC++S C     G   +      +   +G  IG    +    V P G+EK+V
Sbjct  84   HYTTLYARDCMFSDCP---QGQETQHALAAVTGESNGLPIGTPTAMPTFYVVPDGIEKMV  140

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y   +++N+P+++TENGY       +  ED ++D  R+++L  YL  L+  IR GADVR
Sbjct  141  KYFMRRYNNLPMFITENGYAQGGDSYTDAEDWIDDEDRIEYLEGYLTKLAKVIRDGADVR  200

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLRN  148
            GYF WS+ DNFEW FGYT R GLY  D  T +R+PKLSA WYK+F+              
Sbjct  201  GYFAWSVVDNFEWLFGYTLRFGLYYIDYRTQERSPKLSALWYKEFLQN------------  248

Query  147  MILHQNQ  127
              LH+NQ
Sbjct  249  --LHENQ  253



>ref|XP_003541849.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=532

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 147/236 (62%), Gaps = 4/236 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA RA +F     LDP+++G YP +M+ ILGS LP FS    EK    G LDFIGI
Sbjct  281  CDRQAASRALTFELARVLDPLVFGEYPAEMRSILGSKLPVFSP--KEKSLIKGSLDFIGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY T YA+DC  STC  S+  +    GFV  + +++G  IGE  G+    V P G+EK+
Sbjct  339  NHYGTLYAKDCTLSTC--SLGADHPIRGFVETTATRNGVPIGEPTGIAQFFVVPRGVEKL  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
              Y+K ++ NIP+Y+TENGY     P+ ++ D L D KR+ +   YL AL  +IRKGADV
Sbjct  397  ADYIKMRYHNIPMYITENGYSPPPKPDVTIHDSLQDFKRIDYHKAYLAALLRSIRKGADV  456

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            RGY IWSL DNFEW+ GY  R GLY  DR TL+R PKLS +W+  F+      N +
Sbjct  457  RGYMIWSLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFLNNTSHTNKQ  512



>gb|AID16401.1| monolignol beta-glucosidase, partial [synthetic construct]
Length=498

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 161/243 (66%), Gaps = 9/243 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA +F  +WFLDPI +G YP++M++IL SNLP+F+  + +KL     +DFIG
Sbjct  259  TEDVRAARRALAFEVDWFLDPIFFGDYPREMREILSSNLPKFTP-EEKKLLQNNKVDFIG  317

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            INHYT  YA+DC+YS C    T +T E    V     ++G +IG+   L    V P  ME
Sbjct  318  INHYTAIYAKDCIYSPC----TLDTYEGNALVYAIGRRNGKIIGKPTALHGYFVVPEAME  373

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            KVV YV +++ N  +Y+TENGY   +  ++SMED++ND +RV ++ DYL  LS+ IRKGA
Sbjct  374  KVVMYVNDRYRNTTIYITENGYSQHS--DTSMEDLINDVERVNYMHDYLKYLSSAIRKGA  431

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            +V GYF WS+ DNFEW +GYT + GLYQ D  T +R P++SAKWY+ F+  +  +   +Q
Sbjct  432  NVGGYFAWSIVDNFEWVYGYTVKFGLYQVDFDTQERIPRMSAKWYRDFLT-SSSLTDGLQ  490

Query  156  LRN  148
            +R+
Sbjct  491  VRS  493



>gb|KEH38756.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=528

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 147/227 (65%), Gaps = 4/227 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ A  RA +F+  W LDP+++G YP +M+ ILG+ LP+ S+ +   L+  G LDFIGI
Sbjct  279  CDRQATNRALAFVIGWLLDPLVFGEYPAEMRSILGNRLPKISTKEKSLLR--GSLDFIGI  336

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+Y   YA+DC  STC        R  GF+  +  +DG  IG+  G+    V P GMEK+
Sbjct  337  NNYGALYAKDCYLSTCPLEAARPIR--GFLETTGMRDGIPIGDQTGMPRFFVVPKGMEKI  394

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+K K+ N+P+Y+TENGY      + +M D+L+D KR+++   YL AL   IRKGADV
Sbjct  395  VDYIKIKYQNLPMYITENGYSSPLNASMTMHDLLHDFKRIEYHKAYLAALLRAIRKGADV  454

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            RGY +WSLFDNFEW+ GY  R GLY  DR TL+R PKLS +W+  F+
Sbjct  455  RGYMVWSLFDNFEWNSGYNVRFGLYYVDRQTLERIPKLSVEWFSSFL  501



>gb|AFK42730.1| unknown [Medicago truncatula]
Length=209

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 144/204 (71%), Gaps = 3/204 (1%)
 Frame = -2

Query  783  MKDILGSNLPEFSSIDLEKLKAAGGLDFIGINHYTTYYAQDCLYSTCDPSMTGNTREEGF  604
            M +ILG +L  FS  D EK K   GLDFIGINHYT+YY +DC++S CD    G+++ EGF
Sbjct  1    MHEILGPDLLVFSKYDKEKFK--NGLDFIGINHYTSYYVKDCIFSACDQG-KGSSKTEGF  57

Query  603  VGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSS  424
               S   +   IGE   L +  V+P GME +VTY+K++++NIP+++TENG+  + +   +
Sbjct  58   ALTSAQMNDKSIGEPTALAWFYVHPQGMENIVTYIKDRYNNIPMFITENGFGTSESSYPT  117

Query  423  MEDVLNDTKRVKFLADYLNALSTTIRKGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDR  244
             E  LND KRV++L+ YL++L+T IRKGADV+GYF+WS+ DNFEW+ GY+ R GL+  D 
Sbjct  118  TEYELNDVKRVEYLSSYLDSLATAIRKGADVKGYFVWSILDNFEWNHGYSIRFGLHHVDF  177

Query  243  VTLKRTPKLSAKWYKQFIAKNQKV  172
             TL RTP+ SA WYK FI++++ +
Sbjct  178  ATLNRTPRGSAFWYKNFISEHKNL  201



>ref|XP_008226781.1| PREDICTED: beta-glucosidase 18-like [Prunus mume]
Length=398

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 161/249 (65%), Gaps = 11/249 (4%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A +RA +F   W  DP++YG YP +M+   G  LP FS+ + + L+  G +DFIG+N
Sbjct  147  DRDAVDRALAFNVAWTFDPVVYGDYPAEMRHCHGLELPRFSAKEKQLLR--GSIDFIGVN  204

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY+T Y +DC++S C PS  G+    GF+  +  +DG  IGE  GL+   V P GMEK++
Sbjct  205  HYSTLYVKDCIHSPC-PS-GGDRPIMGFLNTTGYRDGVPIGEPTGLDDFFVVPRGMEKII  262

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             YVK++++N+P++VTENG C   T     E+ L D  R+ F   YL +L+  IR GADVR
Sbjct  263  DYVKQRYNNMPMFVTENG-CTLQT----QENELEDRDRINFHKSYLASLARAIRSGADVR  317

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK--NQKVNSKMQL  154
            GYF+WS+ DNFEW  GYTKR GLY  DR TL+RTPKLSA W+  F+    +   N ++ L
Sbjct  318  GYFVWSVMDNFEWLNGYTKRFGLYYVDRETLERTPKLSAGWFASFLRNHTHNNDNEEISL  377

Query  153  RNMILHQNQ  127
             +++ +QN+
Sbjct  378  ASVVHNQNK  386



>sp|Q7XSK2.2|BGL16_ORYSJ RecName: Full=Beta-glucosidase 16; Short=Os4bglu16; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54544.1| OSJNBa0004N05.24 [Oryza sativa Japonica Group]
 emb|CAE01908.2| OSJNBb0070J16.1 [Oryza sativa Japonica Group]
 gb|EEC77634.1| hypothetical protein OsI_16626 [Oryza sativa Indica Group]
Length=516

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 161/243 (66%), Gaps = 9/243 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA +F  +WFLDPI +G YP++M++IL SNLP+F+  + +KL     +DFIG
Sbjct  277  TEDVRAARRALAFEVDWFLDPIFFGDYPREMREILSSNLPKFTP-EEKKLLQNNKVDFIG  335

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            INHYT  YA+DC+YS C    T +T E    V     ++G +IG+   L    V P  ME
Sbjct  336  INHYTAIYAKDCIYSPC----TLDTYEGNALVYAIGRRNGKIIGKPTALHGYFVVPEAME  391

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            KVV YV +++ N  +Y+TENGY   +  ++SMED++ND +RV ++ DYL  LS+ IRKGA
Sbjct  392  KVVMYVNDRYRNTTIYITENGYSQHS--DTSMEDLINDVERVNYMHDYLKYLSSAIRKGA  449

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            +V GYF WS+ DNFEW +GYT + GLYQ D  T +R P++SAKWY+ F+  +  +   +Q
Sbjct  450  NVGGYFAWSIVDNFEWVYGYTVKFGLYQVDFDTQERIPRMSAKWYRDFLT-SSSLTDGLQ  508

Query  156  LRN  148
            +R+
Sbjct  509  VRS  511



>ref|XP_006653596.1| PREDICTED: beta-glucosidase 16-like, partial [Oryza brachyantha]
Length=503

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 152/229 (66%), Gaps = 6/229 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA SF   WFLDPI +G YP++M++IL  NLPEF++ + +KL     +DF+G
Sbjct  262  TEDVRAARRALSFEVEWFLDPIFFGDYPREMREILSLNLPEFTA-EEKKLLWTNKVDFVG  320

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREE-GFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            INHYT+ YA+DC+YS C      NT E    V     ++G  IG+    +   V P G+E
Sbjct  321  INHYTSIYAKDCIYSPCKL----NTYESNALVYAPSERNGVKIGKPTAFDVFFVVPQGIE  376

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
              V YV +++ +  +Y+TENGY      +++ME+++ND +RV +L DYL  LS+ IRKGA
Sbjct  377  SAVMYVTDRYKDTIIYITENGYSQRIHNDTNMEELINDVERVSYLHDYLKYLSSAIRKGA  436

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            +V GYF+WSL DNFEW+FGYT + GLY  D  T +RTPK+SAKWYK F+
Sbjct  437  NVGGYFVWSLMDNFEWTFGYTVKFGLYHVDFDTQERTPKMSAKWYKDFL  485



>ref|NP_001185287.1| beta-glucosidase 45 [Arabidopsis thaliana]
 gb|AEE33891.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=543

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 150/215 (70%), Gaps = 2/215 (1%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AAERA SF SNW LDP+IYG YPK+M DILG  LP+FSS +++ L+ +   DF+GI
Sbjct  283  ADKEAAERAQSFYSNWILDPVIYGKYPKEMVDILGPALPQFSSNEVKNLEKSRA-DFVGI  341

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYT+Y+ QDCL S C+    G  + EG+  +   K    IGE+  + +  + P G  K+
Sbjct  342  NHYTSYFIQDCLTSACNTGH-GAFKAEGYALKLDRKGNVTIGELTDVNWQHIDPTGFHKM  400

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K+++ N+P+++TENG+ D   P ++ +++LNDTKR+++++ YL AL   +R GA+V
Sbjct  401  LNYLKDRYPNMPMFITENGFGDLQKPETTDKELLNDTKRIQYMSGYLEALQAAMRDGANV  460

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRT  226
            +GYF+WSL DNFEW FGY  R GL+  D  TLKR+
Sbjct  461  KGYFVWSLLDNFEWLFGYKVRFGLFHVDLTTLKRS  495



>ref|XP_010644221.1| PREDICTED: beta-glucosidase 18-like [Vitis vinifera]
 emb|CBI20347.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 154/240 (64%), Gaps = 5/240 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA RA +F   W LDP++ G YP +M  +LG N+P+FS  +L+K+K  G +DFIGI
Sbjct  277  CDREAASRALAFNIAWVLDPLLNGDYPPEMYRLLGENMPKFSPDELKKIK--GSIDFIGI  334

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY++ YA++C YS   PS  G    +GFV  +  +DG  IGE   +    V P G+EK+
Sbjct  335  NHYSSLYAENCSYS---PSKLGCQAIKGFVYTTGERDGVPIGEETAIPRFYVVPSGLEKL  391

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K +++N P++VTENG      P      +LNDTKRV++   YL +L+  IRKGADV
Sbjct  392  IDYLKTRYNNKPIFVTENGLSQMDQPEERNRVLLNDTKRVEYHKGYLASLAQAIRKGADV  451

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLR  151
            RGYF+WSL DNFEW+ GY+ R GLY  D  TL R PK S+KWY  F++ N + N    +R
Sbjct  452  RGYFVWSLLDNFEWTNGYSIRFGLYYVDYKTLCRIPKFSSKWYTSFLSYNSQRNRNGIIR  511



>gb|EMS66653.1| Beta-glucosidase 16 [Triticum urartu]
Length=538

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 159/242 (66%), Gaps = 8/242 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA SF  +WFLDPI +G YP++M ++L SNLP+F+S + ++L      DFIG
Sbjct  301  TEDILAARRALSFEVDWFLDPIFFGDYPREMCEMLSSNLPKFTS-EEKRLLRKNNADFIG  359

Query  693  INHYTTYYAQDCLYSTCD-PSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            +NHYT+ YA+DC+ S CD  +  GN   +  VG+   +DG  IG+   +      P GME
Sbjct  360  LNHYTSIYAKDCISSPCDLETYEGNALVQA-VGE---RDGVTIGKPTAIHGYYDVPEGME  415

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
             +V YV +++ N P+YVTENGY   +  ++SMED++ND  RV +L  YL ++S+ +R+GA
Sbjct  416  LIVKYVNQRYKNTPVYVTENGYSQFS--DNSMEDLINDVGRVNYLQGYLTSISSAVRRGA  473

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            +V GYF+WSL DNFEW FG+T R GLY  D  T +RTPK+S  WY+ F+  ++ V+    
Sbjct  474  NVSGYFVWSLMDNFEWRFGFTVRFGLYHVDFETRERTPKMSGNWYRDFLTGSRPVDQAHT  533

Query  156  LR  151
            LR
Sbjct  534  LR  535



>ref|XP_008669175.1| PREDICTED: probable inactive beta-glucosidase 14 [Zea mays]
Length=517

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 150/234 (64%), Gaps = 5/234 (2%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  A  RA SF + W LDP+ +G YP  M+ ILG NLP+F+  + + LK    +DFIG
Sbjct  276  TEDHLAVSRALSFDAPWILDPLFFGDYPHQMRQILGPNLPKFTEGEKKLLK--NQIDFIG  333

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEK  514
            +NHY T+Y +DC+YS CD         E  V  S  ++G  IG+   +    V P  MEK
Sbjct  334  VNHYQTFYVKDCIYSLCD---MDAYPSEALVSISTERNGIPIGKPTPVANTYVVPSSMEK  390

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +V Y+K+++ +IPLY+TENGY      +++ E+++ND +R  ++ DYL  LS  IRKGAD
Sbjct  391  LVMYLKQRYKSIPLYITENGYAQIANISTTAEEIINDIERSTYIRDYLTYLSFAIRKGAD  450

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            VRGYF+WSL DNFEW  GYT + GL   +  +LKRTPKLSAKWY +FI   +++
Sbjct  451  VRGYFVWSLMDNFEWISGYTVKYGLCHVNFKSLKRTPKLSAKWYSKFIKGYEQI  504



>ref|XP_004976206.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Setaria italica]
Length=414

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 149/232 (64%), Gaps = 5/232 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA +F   WF+DPI+YG YP +M+ +LGS LP FS  +  KL     LDFIGIN
Sbjct  184  DRLAAERALAFSVPWFVDPIVYGDYPPEMRQVLGSRLPTFSPEERRKLGYK--LDFIGIN  241

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT YA+DC++S+  P   G   +      +  ++G  IG   G     V P G+EK+V
Sbjct  242  HYTTLYARDCMFSSGCP--LGQGTQHALAAVTGERNGVPIGPPTGRPMFYVVPDGIEKMV  299

Query  507  TYVKEKFSNIPLYVTENGYCDT-TTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            TY+  +++N+P++VTENGY D     +   +D+L+D  R+++L  YL  ++  IR GADV
Sbjct  300  TYIMRRYNNLPMFVTENGYPDGGEAGHDHAKDLLHDQGRIQYLDGYLTKVAKAIRDGADV  359

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK  175
            RGYF+WSL DNFEW +GYT R GLY  D  TL+R PK SA WYK+F+   Q 
Sbjct  360  RGYFVWSLMDNFEWLYGYTLRYGLYYVDYQTLERKPKSSALWYKRFLQSFQH  411



>emb|CDX79092.1| BnaA01g11590D [Brassica napus]
Length=470

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 149/236 (63%), Gaps = 28/236 (12%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AAERA +F   WFLDPI                   F+  DL+  K   GLDFIGI
Sbjct  260  ADSLAAERAQAFYLTWFLDPI-------------------FTRDDLKSSK--NGLDFIGI  298

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N YT+ YA+DCL+S C+P   G +R EGFV  +  KDG  +GE  G+ +  VYP GME++
Sbjct  299  NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLPLGEPTGVNWFNVYPQGMEEM  357

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y  E++ NIPLYVTENG  ++T        +LND +RVKF+++YL+AL   +RKG DV
Sbjct  358  LMYATERYRNIPLYVTENGKDNSTGV------LLNDYRRVKFMSNYLDALKRAMRKGEDV  411

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            RGYF WSL DNFEW  GYT R G+Y  D  TL+RTP+LSA WYK FI+K+    SK
Sbjct  412  RGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHISSQSK  467



>gb|KHN28049.1| Beta-glucosidase 18 [Glycine soja]
Length=529

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 149/238 (63%), Gaps = 6/238 (3%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ A +RA +F+  W LDP+++G YP +M  ILGS LP FS    EK    G +DFIGI
Sbjct  278  CDRQAVKRALAFVVAWSLDPLVFGDYPPEMHSILGSQLPRFSP--EEKSLIKGSIDFIGI  335

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            N+Y T YA+DC  + C        R  GFV  + ++DG  IG++ G     V P G+EK+
Sbjct  336  NNYGTLYAKDCSLTACPLGTDRPIR--GFVEATGTRDGIPIGDLTGNPRFFVVPRGLEKI  393

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+K ++ N+P+Y+TENGY     PN +M+D+L D KR+ +   YL AL   IRKGADV
Sbjct  394  VDYIKIRYHNMPMYITENGYSSPHKPNVTMDDLLQDFKRIDYHKAYLAALLRAIRKGADV  453

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            RGY IWSL DNFEW+ GY  R GLY  DR TL+R PK S +W+  F+  N  ++S  Q
Sbjct  454  RGYMIWSLMDNFEWTSGYGVRYGLYYVDRHTLERIPKRSVQWFSSFL--NDTIHSNKQ  509



>ref|XP_006594784.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Glycine max]
Length=507

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 147/237 (62%), Gaps = 5/237 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA RA +F     LDP+++G YP +M+ ILGS LP FS    EK    G LDFIGI
Sbjct  255  CDRQAASRALTFELARVLDPLVFGEYPAEMRSILGSKLPVFSP--KEKSLIKGSLDFIGI  312

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGE-MAGLEYLVVYPPGMEK  514
            NHY T YA+DC  STC  S+  +    GFV  + +++G  IGE   G+    V P G+EK
Sbjct  313  NHYGTLYAKDCTLSTC--SLGADHPIRGFVETTATRNGVPIGEPQTGIAQFFVVPRGVEK  370

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +  Y+K ++ NIP+Y+TENGY     P+ ++ D L D KR+ +   YL AL  +IRKGAD
Sbjct  371  LADYIKMRYHNIPMYITENGYSPPPKPDVTIHDSLQDFKRIDYHKAYLAALLRSIRKGAD  430

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            VRGY IWSL DNFEW+ GY  R GLY  DR TL+R PKLS +W+  F+      N +
Sbjct  431  VRGYMIWSLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFLNNTSHTNKQ  487



>ref|XP_006652510.1| PREDICTED: beta-glucosidase 16-like [Oryza brachyantha]
Length=518

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 157/243 (65%), Gaps = 8/243 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA SF  +WFLDPI +G YP+DM++I+ SNLP+F+  + +KL     +DFIG
Sbjct  278  TEDVRAARRAQSFEVDWFLDPIFFGDYPRDMREIISSNLPKFTPQE-KKLLQMNKVDFIG  336

Query  693  INHYTTYYAQDCLYSTCD-PSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            INHYT+ YA+DC+YS C   +  GN      V  +  ++G  IG     +   V P G+E
Sbjct  337  INHYTSIYAKDCIYSPCKLDTYEGNA----LVYTTARRNGKQIGGSTAFDTYFVVPKGIE  392

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
              V YV +++ N  +Y+TENGY   +  N   E ++ND +RV +L DYL+ LS+ IRKGA
Sbjct  393  SAVMYVHDRYKNTAIYITENGYSQHSDTNIK-ELIINDVERVNYLHDYLSYLSSAIRKGA  451

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS-KM  160
            DVRGYF+WS+ DNFEW+FGYT + GLY  D  T +R P++SA WYK F+   ++ +  ++
Sbjct  452  DVRGYFVWSIVDNFEWTFGYTVKFGLYHVDFDTQERIPRMSATWYKDFLTGCRQADGLQV  511

Query  159  QLR  151
            Q R
Sbjct  512  QSR  514



>ref|XP_006370302.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
 gb|ERP66871.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
Length=522

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/229 (49%), Positives = 149/229 (65%), Gaps = 7/229 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A  RA +F + W  D +++G YP +M+  LGS LP FS  +   +K  G LDFIG+N
Sbjct  277  DRQAVSRALAFTNAWLFDAVVFGDYPAEMRLYLGSALPTFSPEETSYVK--GSLDFIGMN  334

Query  687  HYTTYYAQDCLYSTCDPSMTGNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
             YT+ YA+DC++S C   ++G  R   GFV  +  +DG  IG   G     V P GMEK+
Sbjct  335  FYTSLYAKDCIHSAC---ISGGDRPIRGFVHTTGERDGEPIGGRCGNPRFFVVPEGMEKI  391

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+KE+++N+P++VTENG+      N  ++ +L DT RV F   YL AL+  IR GADV
Sbjct  392  VNYMKERYNNMPMFVTENGFSPPQQ-NDQVQALLQDTNRVNFHKSYLAALARAIRNGADV  450

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAK  184
            RGYF+WSL DNFEW  GY++R GLY  DR TL+R PKLSAKWYK F+A 
Sbjct  451  RGYFVWSLVDNFEWIDGYSQRYGLYYVDRQTLERVPKLSAKWYKNFLAN  499



>ref|XP_003580124.2| PREDICTED: beta-glucosidase 16-like [Brachypodium distachyon]
Length=554

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 154/240 (64%), Gaps = 9/240 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA SF   WFLDPI +G YP++M+++L +NLP+F+    EK      +DFIG
Sbjct  317  TEDIRAARRALSFEVEWFLDPIFFGDYPREMREMLSANLPKFTP--EEKKLMQNKVDFIG  374

Query  693  INHYTTYYAQDCLYSTCD-PSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            IN YT  YA+DC+   C+  +  GN      V  +  +DG LIG+    +     P GME
Sbjct  375  INQYTAIYARDCISLPCNIMTYEGNA----MVLATGERDGVLIGKPTAFKGYYDVPQGME  430

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
            + V YV E++ N P+YVTENGY   +  ++S+ED++ND  RV +L  YL ++S+ +RKGA
Sbjct  431  QAVKYVNERYENTPVYVTENGYSQQS--DNSVEDLINDVGRVNYLQGYLTSISSAVRKGA  488

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            +VRGYF+WSL DNFEW FGYT R GLY  D  T KR PK SAKWY+ F+A    V+ ++Q
Sbjct  489  NVRGYFVWSLIDNFEWGFGYTVRFGLYHVDFETQKRIPKTSAKWYRGFLAGAGPVDDQVQ  548



>ref|XP_011098338.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=549

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 155/242 (64%), Gaps = 10/242 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD+ AA RA +F   W LDP+++G YP +MK I GS LP FS  + E L+ +  +D+IGI
Sbjct  300  ADKEAANRALAFNVAWVLDPLVFGDYPPEMKRIHGSELPRFSLEERELLRDS--VDYIGI  357

Query  690  NHYTTYYAQDCLYSTC---DPSMT--GNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPP  526
            NHY T YA+DC++STC   + S T  G+    GFV  +  +DG  IGE  G+    V P 
Sbjct  358  NHYGTLYAKDCIHSTCSCNESSCTQGGDRPIRGFVATTGVRDGVTIGEPTGMSRFFVVPR  417

Query  525  GMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIR  346
            G+E +V Y+K+++ N P+ VTENGY   ++P +  +   +D KR+ +   YL  L+  +R
Sbjct  418  GLEDIVRYIKDRYHNKPMIVTENGY---SSPGNEDDIYKHDVKRIHYHQSYLAHLAQAVR  474

Query  345  KGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
             GADVRGYFIWSL DNFEWS GYT + G+Y+ DR TL R PKLSA WY+ F+  +  ++ 
Sbjct  475  NGADVRGYFIWSLLDNFEWSNGYTAKFGIYRVDRQTLNRIPKLSAVWYRDFLRNSSLIDV  534

Query  165  KM  160
             +
Sbjct  535  HL  536



>ref|XP_006594783.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=533

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 147/237 (62%), Gaps = 5/237 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ AA RA +F     LDP+++G YP +M+ ILGS LP FS    EK    G LDFIGI
Sbjct  281  CDRQAASRALTFELARVLDPLVFGEYPAEMRSILGSKLPVFSP--KEKSLIKGSLDFIGI  338

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGE-MAGLEYLVVYPPGMEK  514
            NHY T YA+DC  STC  S+  +    GFV  + +++G  IGE   G+    V P G+EK
Sbjct  339  NHYGTLYAKDCTLSTC--SLGADHPIRGFVETTATRNGVPIGEPQTGIAQFFVVPRGVEK  396

Query  513  VVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGAD  334
            +  Y+K ++ NIP+Y+TENGY     P+ ++ D L D KR+ +   YL AL  +IRKGAD
Sbjct  397  LADYIKMRYHNIPMYITENGYSPPPKPDVTIHDSLQDFKRIDYHKAYLAALLRSIRKGAD  456

Query  333  VRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            VRGY IWSL DNFEW+ GY  R GLY  DR TL+R PKLS +W+  F+      N +
Sbjct  457  VRGYMIWSLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFLNNTSHTNKQ  513



>dbj|BAJ93784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 155/242 (64%), Gaps = 9/242 (4%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA +F  +WFLDPI +G YP++M+++L SNLP F+S +   L++    DFIG
Sbjct  273  TEDILAARRALAFEVDWFLDPIFFGDYPREMREMLSSNLPTFTSEEKRLLQSKA--DFIG  330

Query  693  INHYTTYYAQDCLYSTCD-PSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            +NHYT  YA+DC+ S C+  S  GN   +  VG+   +DG  IG           P GME
Sbjct  331  VNHYTAIYAKDCIASPCNIKSYEGNALVQA-VGE---RDGVAIGRPTAFPGYYDVPEGME  386

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
             +V YV +++ N P+YVTENG+   +  ++SMED++ND  RV  L  YL  +S+ +R+GA
Sbjct  387  LIVKYVNQRYENAPVYVTENGFSQFS--DNSMEDLINDVGRVNCLQGYLTCISSAVRRGA  444

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            +VRGYF+WSL DNFEW FG+T R GLY  D  T +RTPK+S KWY+ F+  +  V+    
Sbjct  445  NVRGYFVWSLMDNFEWGFGFTVRFGLYYVDFETQERTPKMSGKWYRDFLTGSVLVDQAQT  504

Query  156  LR  151
            LR
Sbjct  505  LR  506



>ref|XP_007149594.1| hypothetical protein PHAVU_005G082900g [Phaseolus vulgaris]
 gb|ESW21588.1| hypothetical protein PHAVU_005G082900g [Phaseolus vulgaris]
Length=526

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 145/236 (61%), Gaps = 4/236 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
             D+ A +R  +F+  W LDP+++G YP +M  ILG+ LP FS    EK    G LDFIGI
Sbjct  291  CDRQAVKRVLAFVIAWVLDPLVFGEYPAEMHSILGNQLPVFSP--EEKRLIKGSLDFIGI  348

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHY + YA+DC  S C  S   +    GFV  +  +DG  IG+  G+    V P GMEK+
Sbjct  349  NHYGSLYAKDCSLSAC--SQGADHPITGFVETTGIRDGIPIGDQTGMPLFFVVPMGMEKI  406

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+K ++ N+P+Y+TENGYC     + ++  +L D KR+ +   YL AL   IRKGADV
Sbjct  407  VDYIKIRYHNMPMYITENGYCLPLKQDVTVNYLLQDFKRIDYHKAYLAALLRAIRKGADV  466

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSK  163
            RGY IWSL DNFEW+ GY  R GLY  DR TL+R PKLS +W+  F+      N++
Sbjct  467  RGYMIWSLLDNFEWARGYDMRFGLYYVDRNTLERIPKLSVQWFSSFLNNTISTNTR  522



>gb|KGN59899.1| hypothetical protein Csa_3G852480 [Cucumis sativus]
Length=518

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 147/229 (64%), Gaps = 5/229 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D  A +R  +F   W  DPI+YG YPK+M++ILGS LP FS  D   +K  G LDFI I
Sbjct  282  SDTQAVDRILAFYVGWIYDPIVYGDYPKEMREILGSELPSFSDEDKRYIK--GSLDFISI  339

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYTT YA+DC +S+C   +  N     FV  +  ++G LIG+  G+  L V P GMEKV
Sbjct  340  NHYTTKYAKDCFHSSCPDEV--NRPINAFVETTPYRNGILIGDPMGIPGLYVVPRGMEKV  397

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K+++ N  ++VTENGY    +  + +E +LND KR+KF   YL AL+  +R G DV
Sbjct  398  INYIKQRYPNHSIFVTENGYSMRPSDGNKVETILNDWKRIKFHKSYLAALARAMRNGGDV  457

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRV-TLKRTPKLSAKWYKQFIA  187
            RGYFIWSL DNFEW  GY  R GL+  D + TL+R PKLSA W+  F+ 
Sbjct  458  RGYFIWSLMDNFEWIRGYDTRFGLFYVDHLKTLERRPKLSAHWFASFLG  506



>ref|XP_011652389.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=520

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 147/229 (64%), Gaps = 5/229 (2%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            +D  A +R  +F   W  DPI+YG YPK+M++ILGS LP FS  D   +K  G LDFI I
Sbjct  284  SDTQAVDRILAFYVGWIYDPIVYGDYPKEMREILGSELPSFSDEDKRYIK--GSLDFISI  341

Query  690  NHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
            NHYTT YA+DC +S+C   +  N     FV  +  ++G LIG+  G+  L V P GMEKV
Sbjct  342  NHYTTKYAKDCFHSSCPDEV--NRPINAFVETTPYRNGILIGDPMGIPGLYVVPRGMEKV  399

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            + Y+K+++ N  ++VTENGY    +  + +E +LND KR+KF   YL AL+  +R G DV
Sbjct  400  INYIKQRYPNHSIFVTENGYSMRPSDGNKVETILNDWKRIKFHKSYLAALARAMRNGGDV  459

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRV-TLKRTPKLSAKWYKQFIA  187
            RGYFIWSL DNFEW  GY  R GL+  D + TL+R PKLSA W+  F+ 
Sbjct  460  RGYFIWSLMDNFEWIRGYDTRFGLFYVDHLKTLERRPKLSAHWFASFLG  508



>gb|EMT28326.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=253

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 150/225 (67%), Gaps = 8/225 (4%)
 Frame = -2

Query  822  FLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGINHYTTYYAQDCLYSTC  643
            FLDPI +G YP++M ++L SNLP+F+S + ++L      DFIG+NHYT+ YA+DC+ S C
Sbjct  33   FLDPIFFGDYPREMCEMLSSNLPKFTS-EEKRLLRKNNADFIGLNHYTSIYAKDCISSPC  91

Query  642  D-PSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVVTYVKEKFSNIPLYV  466
            D  +  GN   +  VG+   +DG  IG+   +      P GME +V YV +++ N P+YV
Sbjct  92   DLETYEGNALVQA-VGE---RDGVTIGKPTAIHGYYDVPEGMELIVKYVNQRYKNTPVYV  147

Query  465  TENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVRGYFIWSLFDNFEWS  286
            TENGY   +  ++SMED++ND  RV +L  YL ++S+ IR+GA+V GYF+WSL DNFEW 
Sbjct  148  TENGYSQFS--DNSMEDLINDVGRVNYLQGYLTSISSAIRRGANVSGYFVWSLMDNFEWR  205

Query  285  FGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLR  151
            FG+T R GLY  D  T +RTPK+S KWY+ F+  ++ V+    LR
Sbjct  206  FGFTVRFGLYHVDFETRERTPKMSGKWYRDFLTGSRPVDQAHTLR  250



>ref|XP_004976205.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Setaria italica]
Length=508

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 149/232 (64%), Gaps = 5/232 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA +F   WF+DPI+YG YP +M+ +LGS LP FS  +  KL     LDFIGIN
Sbjct  278  DRLAAERALAFSVPWFVDPIVYGDYPPEMRQVLGSRLPTFSPEERRKLGYK--LDFIGIN  335

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT YA+DC++S+  P   G   +      +  ++G  IG   G     V P G+EK+V
Sbjct  336  HYTTLYARDCMFSSGCP--LGQGTQHALAAVTGERNGVPIGPPTGRPMFYVVPDGIEKMV  393

Query  507  TYVKEKFSNIPLYVTENGYCDT-TTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            TY+  +++N+P++VTENGY D     +   +D+L+D  R+++L  YL  ++  IR GADV
Sbjct  394  TYIMRRYNNLPMFVTENGYPDGGEAGHDHAKDLLHDQGRIQYLDGYLTKVAKAIRDGADV  453

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK  175
            RGYF+WSL DNFEW +GYT R GLY  D  TL+R PK SA WYK+F+   Q 
Sbjct  454  RGYFVWSLMDNFEWLYGYTLRYGLYYVDYQTLERKPKSSALWYKRFLQSFQH  505



>ref|XP_004976204.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Setaria italica]
Length=510

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 149/232 (64%), Gaps = 5/232 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AAERA +F   WF+DPI+YG YP +M+ +LGS LP FS  +  KL     LDFIGIN
Sbjct  280  DRLAAERALAFSVPWFVDPIVYGDYPPEMRQVLGSRLPTFSPEERRKLGYK--LDFIGIN  337

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT YA+DC++S+  P   G   +      +  ++G  IG   G     V P G+EK+V
Sbjct  338  HYTTLYARDCMFSSGCP--LGQGTQHALAAVTGERNGVPIGPPTGRPMFYVVPDGIEKMV  395

Query  507  TYVKEKFSNIPLYVTENGYCDT-TTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            TY+  +++N+P++VTENGY D     +   +D+L+D  R+++L  YL  ++  IR GADV
Sbjct  396  TYIMRRYNNLPMFVTENGYPDGGEAGHDHAKDLLHDQGRIQYLDGYLTKVAKAIRDGADV  455

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQK  175
            RGYF+WSL DNFEW +GYT R GLY  D  TL+R PK SA WYK+F+   Q 
Sbjct  456  RGYFVWSLMDNFEWLYGYTLRYGLYYVDYQTLERKPKSSALWYKRFLQSFQH  507



>ref|XP_009382650.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 148/231 (64%), Gaps = 15/231 (6%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            + D   A +  SF + WFLDPII+G YP +M+  LGS LP FS  +  KL+    LDFIG
Sbjct  265  SLDFLVARQVMSFQAAWFLDPIIHGDYPPEMRQALGSKLPTFSIKERRKLQYK--LDFIG  322

Query  693  INHYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSF---SKDGNLIGEMAGLEYLVVYPPG  523
            INHYT+ Y +DC +S C  S          +G+SF    ++G  IG+   +    V P G
Sbjct  323  INHYTSLYVRDCTFSPCKSSRN--------IGESFIYTERNGIPIGKPTAMPNYYVVPYG  374

Query  522  MEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRK  343
            +E+VV Y   +++N P+++TENGY   +  NSSM ++LND+ RV  +  YL  L+  +RK
Sbjct  375  IEEVVLYTMRRYNNTPMFITENGYAQHS--NSSMTELLNDSDRVDAMRQYLTYLNNAMRK  432

Query  342  GADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            GADVRGYF+WSL DNFEW +GYT R GL+  D  T KRTPKLSA+WYKQF+
Sbjct  433  GADVRGYFVWSLMDNFEWLYGYTMRFGLHHVDYNTQKRTPKLSARWYKQFL  483



>ref|XP_009605772.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Nicotiana tomentosiformis]
Length=436

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 149/234 (64%), Gaps = 10/234 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AA RA +F   W LDP++YG YP +M++  G  LP+FSS   EK       DFIG+
Sbjct  192  ADTKAATRALAFHVAWLLDPLVYGDYPIEMREYHGKKLPKFSS--EEKRLIKNSTDFIGL  249

Query  690  NHYTTYYAQDCLYSTCDPSMT------GNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVY  532
            NHYTT++ +DCL+S C  + T      G  R   GF+  +  KDG  IG+  G+  + V 
Sbjct  250  NHYTTWFVKDCLHSNCTCTDTDVLCTHGENRAIGGFLLITGQKDGASIGDPMGMPGVYVV  309

Query  531  PPGMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTT  352
            P GME++V YV ++++N P++VTENGY           D+  D KR+K+   YL +L+ +
Sbjct  310  PQGMEEIVDYVNKRYNNTPIFVTENGYASNENQGGGY-DLDQDMKRIKYHKAYLASLARS  368

Query  351  IRKGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            IR GADVRGYFIWSL DNFEW FGYT + GLY  D +TL R+PKLSA+WYK F+
Sbjct  369  IRNGADVRGYFIWSLMDNFEWRFGYTIKFGLYHVDPLTLDRSPKLSAQWYKNFL  422



>ref|XP_009605774.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Nicotiana 
tomentosiformis]
Length=434

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 155/239 (65%), Gaps = 7/239 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AA RA  F + W  DP++YG YP++M++ LGS+LP F+S + + +K +  +DFIG+N
Sbjct  184  DRDAANRALVFTAAWVFDPLVYGYYPREMREYLGSSLPTFTSDERKLIKDS--IDFIGVN  241

Query  687  HYTTYYAQDCLYSTCDPSMT-----GNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPG  523
            HY T Y +DC+YS+C  S +     G+    G++     KDG  IGE  G+    V P G
Sbjct  242  HYGTLYVKDCIYSSCVCSNSSCIAGGDHPIHGYLITLGEKDGVPIGEPTGMPRFFVVPRG  301

Query  522  MEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRK  343
            ME++V Y+K+++ N P++VTENGY       +   ++ +D KRV+F   YL +L+  IRK
Sbjct  302  MEEIVDYMKKRYPNKPMFVTENGYSSLNPTTAQAAELQHDIKRVEFHKSYLASLARAIRK  361

Query  342  GADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            GADVRGYFIWSL DNFEW+ GY  + GLY  DR TL R PKLSAKWY+ F+   +  N+
Sbjct  362  GADVRGYFIWSLMDNFEWTSGYEVKFGLYYVDRSTLDRVPKLSAKWYRDFLTGEKPRNA  420



>ref|XP_007149593.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21587.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=530

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 148/237 (62%), Gaps = 6/237 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A +R  SF+ +W LDP+++G YP +M+ ILGS LP+FS    EK    G  DFIGIN
Sbjct  280  DRQAVKRVLSFVVSWCLDPLVFGEYPAEMRSILGSQLPKFSH--EEKNLIKGSSDFIGIN  337

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            +Y T YA+DC  S C   +  +    GFV  +  +DG  IG+  G     V P G+EK+V
Sbjct  338  NYGTLYAKDCSLSAC--PIGADRPIRGFVETTGIRDGIPIGDQTGNPRFFVVPSGLEKIV  395

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+K ++ N P+Y+TENGY     P+ ++ D+L D KRV F   YL AL   IRKGADVR
Sbjct  396  DYIKIRYHNRPMYITENGYSSPPKPDETVNDLLQDFKRVDFHKAYLAALLRAIRKGADVR  455

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            GY IWSL DNFEW+ GY  R GLY  +R TL+R PKLS +W+  F+  N  +N+  Q
Sbjct  456  GYMIWSLMDNFEWASGYGIRYGLYYVNRDTLERIPKLSVQWFSSFL--NNTINTSKQ  510



>ref|XP_009768487.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=530

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 155/239 (65%), Gaps = 7/239 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AA RA  F + W  DP++YG YP++M+  LGS+LP F+S + + +K +  +DFIG+N
Sbjct  281  DRDAANRALVFTAAWVFDPLVYGYYPREMRQYLGSSLPRFTSDERKLIKDS--IDFIGVN  338

Query  687  HYTTYYAQDCLYSTCDPSMT-----GNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPG  523
            HY T YA+DC+YS+C  S +     G+    G++     KDG  IGE  G+    V P G
Sbjct  339  HYGTLYAKDCIYSSCVCSNSSCIAGGDHPIHGYLITLGEKDGVPIGEPTGMPRFFVVPRG  398

Query  522  MEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRK  343
            ME++V Y+K+++ N P++VTENGY       +   ++ +D KRV+F   YL +L+  IRK
Sbjct  399  MEEIVDYMKKRYPNKPMFVTENGYSSLNPTTAQAAELQHDIKRVEFHKSYLASLARAIRK  458

Query  342  GADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNS  166
            GADVRGYFIWSL DNFEW+ GY  + GLY  DR TL R PKLSAKWY+ F+   +  N+
Sbjct  459  GADVRGYFIWSLMDNFEWASGYELKFGLYYVDRSTLNRVPKLSAKWYRDFLTGEKTSNA  517



>ref|XP_002448179.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
 gb|EES12507.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Length=516

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 148/226 (65%), Gaps = 3/226 (1%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A ERA +F + WFLDPIIYG YP +M+ +LGS LP FS  +  KL     LDFIGIN
Sbjct  287  DRLATERALAFDAPWFLDPIIYGDYPPEMRQLLGSKLPTFSPEERRKLGYK--LDFIGIN  344

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT YA+DC++S+  PS +G          +  ++G  IG    +      P G+EK+V
Sbjct  345  HYTTLYAKDCMFSSGCPS-SGQEIHHALAAFTGERNGIPIGPPTAMPKFYFVPDGIEKMV  403

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
            TY+ ++++N+P+++TENGY       +++ED L+D  R+++L  YL  L+  IR GADVR
Sbjct  404  TYIMKRYNNLPMFITENGYAQGGDSYTNVEDWLDDQGRIQYLDGYLTKLAKVIRDGADVR  463

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            GYF+WSL DNFEW +GYT R GL+  D  T +R PK SA WYK+F+
Sbjct  464  GYFVWSLIDNFEWLYGYTLRFGLHYVDYQTQERKPKSSALWYKRFL  509



>ref|XP_008454668.1| PREDICTED: beta-glucosidase 18-like [Cucumis melo]
Length=519

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 146/228 (64%), Gaps = 5/228 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AA+R  +F   W  DPI+YG YPK M++ILGS LP FS  D + +K  G LDFI IN
Sbjct  286  DRKAADRFLAFHVGWIYDPIVYGDYPKKMREILGSELPSFSDEDKKYIK--GSLDFISIN  343

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT Y +DC +S+C  +   N     F   +  ++G LIG+  G+  L V P GMEKV+
Sbjct  344  HYTTKYVKDCFHSSC--TDEANRPINAFTETTPYRNGILIGDQMGMPGLYVVPRGMEKVI  401

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+K+K+ N  ++VTENGY   T+  + +ED++ND KR+KF   YL AL+  +R G  VR
Sbjct  402  NYIKQKYPNQSIFVTENGYSMPTSDGNKVEDIVNDWKRIKFHKSYLAALAKAMRNGGHVR  461

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRV-TLKRTPKLSAKWYKQFIA  187
            GYF WSL DNFEW  GY  R GL+  D + TL+R PKLSA W+  F+ 
Sbjct  462  GYFAWSLMDNFEWIRGYDTRFGLFYVDHLKTLERRPKLSAHWFTSFLG  509



>sp|Q7XSK0.2|BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54546.1| OSJNBa0004N05.26 [Oryza sativa Japonica Group]
 emb|CAE01910.2| OSJNBb0070J16.3 [Oryza sativa Japonica Group]
 emb|CAH67620.1| OSIGBa0140J09.1 [Oryza sativa Indica Group]
Length=505

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 147/247 (60%), Gaps = 19/247 (8%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A ERA +F + WFLDP++YG YP +M+ ILG  LP FS  D  KL+    LDFIG+N
Sbjct  278  DRLATERALAFETPWFLDPLVYGDYPPEMRQILGGRLPSFSPEDRRKLRYK--LDFIGVN  335

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT YA+DC++S C     G   +      +   +G  IG    +    V P G+EK+V
Sbjct  336  HYTTLYARDCMFSDCP---QGQETQHALAAVTGESNGLPIGTPTAMPTFYVVPDGIEKMV  392

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y   +++N+P+++TENGY       +  ED ++D  R+++L  YL  L+  IR GADVR
Sbjct  393  KYFMRRYNNLPMFITENGYAQGGDSYTDAEDWIDDEDRIEYLEGYLTKLAKVIRDGADVR  452

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQLRN  148
            GYF WS+ DNFEW FGYT R GLY  D  T +R+PKLSA WYK+F+              
Sbjct  453  GYFAWSVVDNFEWLFGYTLRFGLYYIDYRTQERSPKLSALWYKEFLQN------------  500

Query  147  MILHQNQ  127
              LH+NQ
Sbjct  501  --LHENQ  505



>ref|XP_007149591.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 ref|XP_007149592.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21585.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21586.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=532

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 148/237 (62%), Gaps = 6/237 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A +R  SF+ +W LDP+++G YP +M+ ILGS LP+FS    EK    G  DFIGIN
Sbjct  280  DRQAVKRVLSFVVSWCLDPLVFGEYPAEMRSILGSQLPKFSH--EEKNLIKGSSDFIGIN  337

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            +Y T YA+DC  S C   +  +    GFV  +  +DG  IG+  G     V P G+EK+V
Sbjct  338  NYGTLYAKDCSLSAC--PIGADRPIRGFVETTGIRDGIPIGDQTGNPRFFVVPSGLEKIV  395

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+K ++ N P+Y+TENGY     P+ ++ D+L D KRV F   YL AL   IRKGADVR
Sbjct  396  DYIKIRYHNRPMYITENGYSSPPKPDETVNDLLQDFKRVDFHKAYLAALLRAIRKGADVR  455

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            GY IWSL DNFEW+ GY  R GLY  +R TL+R PKLS +W+  F+  N  +N+  Q
Sbjct  456  GYMIWSLMDNFEWASGYGIRYGLYYVNRDTLERIPKLSVQWFSSFL--NNTINTSKQ  510



>ref|XP_008453064.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=546

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 147/229 (64%), Gaps = 4/229 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D  A +RA  F   W  DPI+YG YPK+M+++ GS LP FS    EK    G LD+I +N
Sbjct  299  DIEAVDRALIFNFAWVYDPIVYGDYPKEMREVFGSQLPSFSKT--EKSIIKGSLDYICVN  356

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HYTT Y +DCL+S C  S  G+   +GF+  +  +D   IG+  G++   V P G+EK++
Sbjct  357  HYTTLYTKDCLHSPC--SNGGDRPIKGFLDTTGYRDSVSIGDPTGVDRFFVVPRGLEKII  414

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+++++ N P+ VTENGY    +   ++ED++NDTKRV F  +YL +L   +R GADVR
Sbjct  415  NYIRQRYPNNPIVVTENGYSMPPSDGKTLEDIINDTKRVNFHKNYLASLVRAMRNGADVR  474

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKN  181
            GYF+WSL DNFEW  G+T R GL+  D  TL+R PKLSA W+  F+  N
Sbjct  475  GYFVWSLMDNFEWIDGFTTRFGLWYVDFQTLERRPKLSAHWFASFLGGN  523



>ref|XP_011042496.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Populus euphratica]
Length=537

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 149/228 (65%), Gaps = 7/228 (3%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ A  RA +F + W  D +++G YP +M+  LGS LP FS  +   LK  G LDFIG+N
Sbjct  282  DRQAVRRALAFTNAWLFDAVVFGDYPAEMRLYLGSALPTFSLEETCYLK--GSLDFIGMN  339

Query  687  HYTTYYAQDCLYSTCDPSMTGNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKV  511
             YT+ YA+DC++S C   ++G  R   GFV  +  +DG  IG   G     V P GMEK+
Sbjct  340  FYTSLYAKDCIHSAC---ISGGDRPIRGFVYTTGERDGEPIGGRCGNPRFFVVPEGMEKI  396

Query  510  VTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADV  331
            V Y+KE+++N+P++VTENG+      N  ++ +L DT RV F   YL AL+  IR GA+V
Sbjct  397  VNYMKERYNNMPMFVTENGFSPPQQ-NDQVQALLQDTSRVNFHKSYLAALARAIRNGANV  455

Query  330  RGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIA  187
            RGYF+WSL DNFEW  GY+ R GLY  DR TL+R PKLSAKWYK+F+A
Sbjct  456  RGYFVWSLVDNFEWIDGYSLRYGLYYVDRQTLERVPKLSAKWYKKFLA  503



>ref|XP_009762322.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=531

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 153/242 (63%), Gaps = 11/242 (5%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  A+ RA +F   W LDP++YG YP +M++  G  LP+FSS +   +K +   DFIG+
Sbjct  287  ADTKASTRALAFHVAWLLDPLVYGDYPIEMREYHGKKLPKFSSEEKRLIKNS--TDFIGL  344

Query  690  NHYTTYYAQDCLYSTCDPSMT------GNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVY  532
            NHYTT++ +DCL+S C    T      G  R   GF+  +  KDG  IG+  G+  + V 
Sbjct  345  NHYTTWFVKDCLHSNCTCVDTDVLCTHGENRAICGFLLITGQKDGASIGDPMGMPGVYVV  404

Query  531  PPGMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTT  352
            P GME +V YVK+ ++NIP+YVTENGY           D+  D KR+K+   YL +L+ +
Sbjct  405  PQGMEDIVDYVKKTYNNIPIYVTENGYASNENQGGGY-DLDQDMKRIKYHKAYLASLARS  463

Query  351  IRKGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
            IR GADVRGYFIWSL DNFEW FGYT + GLY  D +TL R+PKLSA+WYK  +  N  +
Sbjct  464  IRNGADVRGYFIWSLMDNFEWRFGYTIKFGLYHVDPLTLDRSPKLSAQWYKNLLT-NSSL  522

Query  171  NS  166
            NS
Sbjct  523  NS  524



>dbj|BAJ92008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 153/242 (63%), Gaps = 8/242 (3%)
 Frame = -2

Query  873  TADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIG  694
            T D  AA RA SF  +WFL+PI +G YP++M ++L SNL +F+S + ++L      DFIG
Sbjct  270  TEDILAARRALSFEVDWFLEPIFFGDYPREMHEMLSSNLLKFTS-EEKRLLQKNKADFIG  328

Query  693  INHYTTYYAQDCLYSTCD-PSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGME  517
            INHYT  YA+DC+ S C+  +  GN      V     +DG  IG    L      P GME
Sbjct  329  INHYTAIYAKDCISSPCNVETYEGNA----LVQALGERDGVEIGRPTALHGYYDVPEGME  384

Query  516  KVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGA  337
             +V YV +++ N P+YVTENGY   +  N+SME ++ND  RV +L  YL ++S+ +R+GA
Sbjct  385  LIVKYVNQRYKNTPVYVTENGYSQFS--NNSMEGLINDVGRVNYLQGYLTSISSAVRRGA  442

Query  336  DVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKVNSKMQ  157
            +V GYF+WSL DNFEW FG+T R GLY  D  T +RTPK+S KWY+ F+  ++ V+    
Sbjct  443  NVSGYFVWSLMDNFEWFFGFTVRFGLYHVDFETCERTPKMSGKWYRDFLTCSRPVDQART  502

Query  156  LR  151
            LR
Sbjct  503  LR  504



>dbj|BAO04172.1| hypothetical protein [Delphinium grandiflorum]
Length=525

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 142/232 (61%), Gaps = 5/232 (2%)
 Frame = -2

Query  867  DQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGIN  688
            D+ AA RA +F + W LDP+I G YP +M+  LG  LP+FS  +   LK +  LDFI IN
Sbjct  275  DREAANRALAFCAPWILDPLILGKYPSEMRKYLGDQLPKFSPEEKAMLKDS--LDFISIN  332

Query  687  HYTTYYAQDCLYSTCDPSMTGNTREEGFVGQSFSKDGNLIGEMAGLEYLVVYPPGMEKVV  508
            HY T YA+DC++S+CD   TG    +GFV  +  K+G  IGE        + P G+   +
Sbjct  333  HYVTLYAKDCIHSSCD---TGGHAVQGFVYTTGEKNGIPIGERTAFYRFFIIPDGIRMAI  389

Query  507  TYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTTIRKGADVR  328
             Y+K +++N PLYV ENG C    P     ++L D +RV +   YL A++  IR GADVR
Sbjct  390  EYIKARYNNRPLYVLENGICQENEPLELNGELLQDRQRVNYHKAYLAAVNRAIRDGADVR  449

Query  327  GYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNQKV  172
             YF+WSL DNFEW+ GYT R GLY  D  TLKRTPKLSAKWY  F+     V
Sbjct  450  SYFVWSLLDNFEWASGYTYRYGLYYVDYKTLKRTPKLSAKWYSNFLNNESGV  501



>ref|XP_009605771.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 151/234 (65%), Gaps = 10/234 (4%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  AA RA +F   W LDP++YG YP +M++  G  LP+FSS +   +K +   DFIG+
Sbjct  287  ADTKAATRALAFHVAWLLDPLVYGDYPIEMREYHGKKLPKFSSEEKRLIKNS--TDFIGL  344

Query  690  NHYTTYYAQDCLYSTCDPSMT------GNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVY  532
            NHYTT++ +DCL+S C  + T      G  R   GF+  +  KDG  IG+  G+  + V 
Sbjct  345  NHYTTWFVKDCLHSNCTCTDTDVLCTHGENRAIGGFLLITGQKDGASIGDPMGMPGVYVV  404

Query  531  PPGMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTT  352
            P GME++V YV ++++N P++VTENGY           D+  D KR+K+   YL +L+ +
Sbjct  405  PQGMEEIVDYVNKRYNNTPIFVTENGYASNENQGGGY-DLDQDMKRIKYHKAYLASLARS  463

Query  351  IRKGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            IR GADVRGYFIWSL DNFEW FGYT + GLY  D +TL R+PKLSA+WYK F+
Sbjct  464  IRNGADVRGYFIWSLMDNFEWRFGYTIKFGLYHVDPLTLDRSPKLSAQWYKNFL  517



>ref|XP_006348230.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=528

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 148/234 (63%), Gaps = 11/234 (5%)
 Frame = -2

Query  870  ADQAAAERAHSFLSNWFLDPIIYGSYPKDMKDILGSNLPEFSSIDLEKLKAAGGLDFIGI  691
            AD  A  RA +F   W LDP++YG YP +M+  LG+ LP FSS   EK+      DFIG+
Sbjct  285  ADNKATNRALAFHVAWLLDPLVYGDYPIEMRHYLGTKLPIFSS--EEKILIKNSTDFIGL  342

Query  690  NHYTTYYAQDCLYSTCDPSMT------GNTRE-EGFVGQSFSKDGNLIGEMAGLEYLVVY  532
            NHYTT++ +DCL S C    +      G  R   G+V  +  KDG  IG+  G+  + V 
Sbjct  343  NHYTTWFVKDCLNSNCTCMESDVLCTHGENRAIRGYVLITGQKDGAYIGDQMGMPGVYVV  402

Query  531  PPGMEKVVTYVKEKFSNIPLYVTENGYCDTTTPNSSMEDVLNDTKRVKFLADYLNALSTT  352
            P GME +V YV ++++N+P++VTENGY   +  N    D+  D KR+K+   YL +L+ +
Sbjct  403  PQGMEDIVDYVNKRYNNLPIFVTENGY--ASNENQEEYDMDQDRKRIKYHKAYLASLARS  460

Query  351  IRKGADVRGYFIWSLFDNFEWSFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  190
            IR GADVRGYF+WSL DNFEW FGYT + GLY  DR +L R+PKLSA W++ F+
Sbjct  461  IRNGADVRGYFVWSLMDNFEWRFGYTVKFGLYHVDRFSLNRSPKLSAHWFRDFL  514



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1963610081719