BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12462

Length=930
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006359499.1|  PREDICTED: heparanase-like protein 3-like          269   8e-82   Solanum tuberosum [potatoes]
ref|XP_009625836.1|  PREDICTED: heparanase-like protein 3               265   2e-80   Nicotiana tomentosiformis
ref|XP_009757548.1|  PREDICTED: heparanase-like protein 3               265   2e-80   Nicotiana sylvestris
ref|XP_004242732.1|  PREDICTED: heparanase-like protein 3               258   1e-77   Solanum lycopersicum
emb|CBI25561.3|  unnamed protein product                                256   4e-77   Vitis vinifera
ref|XP_010100865.1|  Heparanase-like protein 3                          255   1e-76   
ref|XP_002263173.1|  PREDICTED: heparanase-like protein 3               254   4e-76   Vitis vinifera
ref|XP_010687865.1|  PREDICTED: heparanase-like protein 3               254   6e-76   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN81917.1|  hypothetical protein VITISV_038549                     254   2e-75   Vitis vinifera
emb|CDP10485.1|  unnamed protein product                                252   3e-75   Coffea canephora [robusta coffee]
ref|XP_010250274.1|  PREDICTED: heparanase-like protein 3               251   5e-75   Nelumbo nucifera [Indian lotus]
ref|XP_006381083.1|  hypothetical protein POPTR_0006s06100g             251   6e-75   
ref|XP_006381082.1|  hypothetical protein POPTR_0006s06100g             251   6e-75   
ref|XP_006453123.1|  hypothetical protein CICLE_v10007919mg             251   7e-75   Citrus clementina [clementine]
gb|KDO73428.1|  hypothetical protein CISIN_1g008762mg                   251   9e-75   Citrus sinensis [apfelsine]
gb|KDO73427.1|  hypothetical protein CISIN_1g008762mg                   250   2e-74   Citrus sinensis [apfelsine]
ref|XP_009358543.1|  PREDICTED: heparanase-like protein 3               246   4e-73   Pyrus x bretschneideri [bai li]
ref|XP_009338385.1|  PREDICTED: heparanase-like protein 3               246   5e-73   Pyrus x bretschneideri [bai li]
ref|XP_007203617.1|  hypothetical protein PRUPE_ppa003883mg             246   5e-73   Prunus persica
ref|XP_008457259.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...    245   7e-73   Cucumis melo [Oriental melon]
ref|XP_008336960.1|  PREDICTED: heparanase-like protein 3               245   1e-72   
ref|XP_008242878.1|  PREDICTED: heparanase-like protein 3               245   1e-72   Prunus mume [ume]
ref|XP_009363939.1|  PREDICTED: heparanase-like protein 3               243   7e-72   Pyrus x bretschneideri [bai li]
ref|XP_011457618.1|  PREDICTED: heparanase-like protein 3               243   1e-71   Fragaria vesca subsp. vesca
ref|XP_006389405.1|  hypothetical protein POPTR_0025s00410g             242   1e-71   
ref|XP_002533671.1|  heparanase, putative                               242   2e-71   Ricinus communis
ref|XP_011020240.1|  PREDICTED: heparanase-like protein 3               241   3e-71   Populus euphratica
gb|AFK44771.1|  unknown                                                 228   1e-70   Medicago truncatula
ref|XP_012081146.1|  PREDICTED: heparanase-like protein 3 isoform X2    235   5e-70   
gb|AFK40288.1|  unknown                                                 238   6e-70   Lotus japonicus
ref|XP_008385022.1|  PREDICTED: heparanase-like protein 3               238   8e-70   
ref|XP_007013614.1|  Glucuronidase 3 isoform 2                          237   1e-69   
gb|AAC62794.1|  T2L5.6 gene product                                     225   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013613.1|  Glucuronidase 3 isoform 1                          237   4e-69   
ref|XP_003533856.1|  PREDICTED: heparanase-like protein 3-like          235   7e-69   Glycine max [soybeans]
ref|XP_010533116.1|  PREDICTED: heparanase-like protein 3               235   8e-69   Tarenaya hassleriana [spider flower]
ref|XP_003546578.1|  PREDICTED: heparanase-like protein 3-like          234   9e-69   Glycine max [soybeans]
ref|XP_012081145.1|  PREDICTED: heparanase-like protein 3 isoform X1    234   1e-68   Jatropha curcas
gb|KHG18442.1|  hypothetical protein F383_07597                         234   2e-68   Gossypium arboreum [tree cotton]
ref|XP_002324878.2|  hypothetical protein POPTR_0018s02050g             234   2e-68   
ref|XP_011017900.1|  PREDICTED: heparanase-like protein 3 isoform X1    234   2e-68   Populus euphratica
ref|XP_008219534.1|  PREDICTED: heparanase-like protein 3 isoform X1    233   2e-68   Prunus mume [ume]
ref|XP_007138475.1|  hypothetical protein PHAVU_009G212400g             233   3e-68   Phaseolus vulgaris [French bean]
ref|XP_010435392.1|  PREDICTED: heparanase-like protein 3               227   3e-68   
gb|KJB64649.1|  hypothetical protein B456_010G059600                    233   3e-68   Gossypium raimondii
ref|XP_009409980.1|  PREDICTED: heparanase-like protein 3               233   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801894.1|  PREDICTED: heparanase-like protein 3 isoform X2    231   1e-67   
ref|XP_006283483.1|  hypothetical protein CARUB_v10004531mg             232   1e-67   Capsella rubella
gb|EYU34947.1|  hypothetical protein MIMGU_mgv1a004017mg                231   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_006852836.2|  PREDICTED: heparanase-like protein 3               231   3e-67   
gb|KHG18266.1|  hypothetical protein F383_21213                         230   3e-67   Gossypium arboreum [tree cotton]
gb|ERN14303.1|  hypothetical protein AMTR_s00033p00188330               231   4e-67   Amborella trichopoda
ref|XP_008801893.1|  PREDICTED: heparanase-like protein 3 isoform X1    230   5e-67   Phoenix dactylifera
ref|XP_010648741.1|  PREDICTED: heparanase-like protein 3               231   6e-67   Vitis vinifera
ref|XP_008219535.1|  PREDICTED: heparanase-like protein 3 isoform X2    229   6e-67   Prunus mume [ume]
ref|XP_004139281.1|  PREDICTED: heparanase-like protein 3               229   8e-67   Cucumis sativus [cucumbers]
ref|NP_851092.1|  glucuronidase 3                                       226   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009355782.1|  PREDICTED: heparanase-like protein 3               229   1e-66   Pyrus x bretschneideri [bai li]
gb|KJB23650.1|  hypothetical protein B456_004G108900                    229   1e-66   Gossypium raimondii
gb|KJB23649.1|  hypothetical protein B456_004G108900                    229   2e-66   Gossypium raimondii
ref|XP_010906003.1|  PREDICTED: heparanase-like protein 3               229   2e-66   Elaeis guineensis
gb|ACJ85694.1|  unknown                                                 218   2e-66   Medicago truncatula
ref|XP_011036604.1|  PREDICTED: heparanase-like protein 3 isoform X2    228   2e-66   Populus euphratica
gb|KEH37925.1|  glycoside hydrolase family 79 amino-terminal doma...    228   2e-66   Medicago truncatula
ref|XP_007224283.1|  hypothetical protein PRUPE_ppa019445mg             228   2e-66   
ref|XP_002283260.2|  PREDICTED: heparanase-like protein 3               228   3e-66   
ref|XP_011081531.1|  PREDICTED: heparanase-like protein 3               228   4e-66   Sesamum indicum [beniseed]
ref|XP_011036603.1|  PREDICTED: heparanase-like protein 3 isoform X1    228   4e-66   Populus euphratica
emb|CDY12398.1|  BnaC08g08070D                                          228   5e-66   Brassica napus [oilseed rape]
ref|XP_009108062.1|  PREDICTED: heparanase-like protein 3               227   6e-66   Brassica rapa
emb|CDY47561.1|  BnaA08g07260D                                          227   6e-66   Brassica napus [oilseed rape]
ref|XP_010440690.1|  PREDICTED: heparanase-like protein 3               227   9e-66   Camelina sativa [gold-of-pleasure]
gb|EYU20239.1|  hypothetical protein MIMGU_mgv1a026019mg                227   9e-66   Erythranthe guttata [common monkey flower]
ref|XP_004488517.1|  PREDICTED: heparanase-like protein 3-like          226   2e-65   Cicer arietinum [garbanzo]
ref|XP_009393723.1|  PREDICTED: heparanase-like protein 3               225   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008394121.1|  PREDICTED: heparanase-like protein 3 isoform X2    224   6e-65   Malus domestica [apple tree]
ref|NP_851093.1|  glucuronidase 3                                       224   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870409.1|  glycosyl hydrolase family 79 N-terminal doma...    224   7e-65   Arabidopsis lyrata subsp. lyrata
dbj|BAB10787.1|  unnamed protein product                                224   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609474.1|  Heparanase-like protein                            223   1e-64   Medicago truncatula
ref|XP_008394120.1|  PREDICTED: heparanase-like protein 3 isoform X1    224   1e-64   Malus domestica [apple tree]
ref|XP_010450341.1|  PREDICTED: heparanase-like protein 3               223   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007011804.1|  Glucuronidase 3 isoform 2                          222   2e-64   
ref|XP_006483406.1|  PREDICTED: heparanase-like protein 3-like is...    223   3e-64   Citrus sinensis [apfelsine]
ref|XP_007011803.1|  Glucuronidase 3 isoform 1                          222   5e-64   
ref|XP_006403100.1|  hypothetical protein EUTSA_v10003449mg             221   8e-64   
ref|XP_011078541.1|  PREDICTED: heparanase-like protein 3               221   2e-63   Sesamum indicum [beniseed]
gb|KFK22707.1|  hypothetical protein AALP_AAs49083U000200               220   2e-63   Arabis alpina [alpine rockcress]
ref|XP_006450373.1|  hypothetical protein CICLE_v10010401mg             220   5e-63   
ref|XP_010927354.1|  PREDICTED: heparanase-like protein 3 isoform X2    218   5e-63   
ref|XP_002515478.1|  heparanase, putative                               219   6e-63   
ref|XP_008793957.1|  PREDICTED: heparanase-like protein 3               216   6e-63   Phoenix dactylifera
emb|CDP13545.1|  unnamed protein product                                218   1e-62   Coffea canephora [robusta coffee]
ref|XP_002452991.1|  hypothetical protein SORBIDRAFT_04g036200          219   1e-62   Sorghum bicolor [broomcorn]
gb|EPS66918.1|  hypothetical protein M569_07858                         218   2e-62   Genlisea aurea
gb|EMT25528.1|  Heparanase-like protein 3                               216   4e-62   
ref|XP_010927353.1|  PREDICTED: heparanase-like protein 3 isoform X1    216   7e-62   Elaeis guineensis
gb|KDO61807.1|  hypothetical protein CISIN_1g037212mg                   216   1e-61   Citrus sinensis [apfelsine]
ref|XP_009623092.1|  PREDICTED: heparanase-like protein 3               216   2e-61   Nicotiana tomentosiformis
ref|NP_001241969.1|  uncharacterized protein LOC100792087 precursor     215   2e-61   
ref|XP_003542659.1|  PREDICTED: heparanase-like protein 3-like          215   2e-61   Glycine max [soybeans]
ref|XP_004249602.1|  PREDICTED: heparanase-like protein 3               215   2e-61   Solanum lycopersicum
ref|XP_009792772.1|  PREDICTED: heparanase-like protein 3 isoform X2    215   3e-61   Nicotiana sylvestris
ref|XP_012076507.1|  PREDICTED: heparanase-like protein 3               214   4e-61   
ref|XP_009792771.1|  PREDICTED: heparanase-like protein 3 isoform X1    215   4e-61   Nicotiana sylvestris
ref|XP_006338978.1|  PREDICTED: heparanase-like protein 3-like          214   4e-61   Solanum tuberosum [potatoes]
gb|KDP33563.1|  hypothetical protein JCGZ_07134                         214   5e-61   Jatropha curcas
ref|XP_004508419.1|  PREDICTED: heparanase-like protein 3-like          214   6e-61   Cicer arietinum [garbanzo]
gb|KHN15030.1|  Heparanase-like protein 3                               213   8e-61   Glycine soja [wild soybean]
gb|EMS60649.1|  Heparanase-like protein 3                               214   2e-60   Triticum urartu
ref|XP_007155083.1|  hypothetical protein PHAVU_003G171800g             212   2e-60   Phaseolus vulgaris [French bean]
ref|XP_007155084.1|  hypothetical protein PHAVU_003G171800g             212   3e-60   Phaseolus vulgaris [French bean]
ref|XP_010099859.1|  Heparanase-like protein 3                          212   4e-60   Morus notabilis
gb|AFW77131.1|  hypothetical protein ZEAMMB73_462319                    205   5e-60   
emb|CBI21126.3|  unnamed protein product                                216   6e-60   Vitis vinifera
ref|XP_006648064.1|  PREDICTED: heparanase-like protein 3-like          211   8e-60   Oryza brachyantha
ref|XP_003561019.1|  PREDICTED: heparanase-like protein 3               211   8e-60   Brachypodium distachyon [annual false brome]
ref|XP_010048938.1|  PREDICTED: heparanase-like protein 3 isoform X2    209   2e-59   Eucalyptus grandis [rose gum]
gb|KJB27355.1|  hypothetical protein B456_004G293000                    209   2e-59   Gossypium raimondii
ref|XP_011459847.1|  PREDICTED: heparanase-like protein 3               206   3e-59   Fragaria vesca subsp. vesca
ref|XP_004954253.1|  PREDICTED: heparanase-like protein 3-like          209   3e-59   Setaria italica
gb|KJB27356.1|  hypothetical protein B456_004G293000                    209   3e-59   Gossypium raimondii
ref|XP_010048937.1|  PREDICTED: heparanase-like protein 3 isoform X1    209   6e-59   Eucalyptus grandis [rose gum]
dbj|BAJ89245.1|  predicted protein                                      209   6e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW73900.1|  hypothetical protein ZEAMMB73_176333                    208   9e-59   
ref|NP_001048420.1|  Os02g0802200                                       208   1e-58   
ref|XP_008647415.1|  PREDICTED: uncharacterized protein LOC100193...    204   2e-58   
ref|XP_003570329.1|  PREDICTED: heparanase-like protein 3               207   2e-58   Brachypodium distachyon [annual false brome]
ref|XP_010048935.1|  PREDICTED: heparanase-like protein 3               207   2e-58   Eucalyptus grandis [rose gum]
ref|XP_004964694.1|  PREDICTED: heparanase-like protein 3-like          207   3e-58   Setaria italica
ref|XP_006655848.1|  PREDICTED: heparanase-like protein 3-like          204   3e-58   Oryza brachyantha
gb|EAY87898.1|  hypothetical protein OsI_09318                          206   5e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_008647414.1|  PREDICTED: uncharacterized protein LOC100193...    201   1e-56   Zea mays [maize]
gb|EYU34948.1|  hypothetical protein MIMGU_mgv1a004017mg                202   1e-56   Erythranthe guttata [common monkey flower]
ref|NP_001132339.1|  uncharacterized protein LOC100193781 precursor     201   4e-56   Zea mays [maize]
gb|ACF81144.1|  unknown                                                 201   4e-56   Zea mays [maize]
ref|XP_010048934.1|  PREDICTED: heparanase-like protein 3 isoform X2    199   4e-56   Eucalyptus grandis [rose gum]
gb|EAY99897.1|  hypothetical protein OsI_21892                          200   9e-56   Oryza sativa Indica Group [Indian rice]
gb|EAZ36024.1|  hypothetical protein OsJ_20330                          200   1e-55   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056967.1|  Os06g0179000                                       200   1e-55   
gb|EPS67583.1|  hypothetical protein M569_07189                         200   1e-55   Genlisea aurea
ref|XP_010665516.1|  PREDICTED: heparanase-like protein 3 isoform X2    200   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010665510.1|  PREDICTED: heparanase-like protein 3 isoform X1    200   3e-55   
dbj|BAJ90636.1|  predicted protein                                      198   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010048933.1|  PREDICTED: heparanase-like protein 3 isoform X1    199   4e-55   Eucalyptus grandis [rose gum]
ref|XP_010050122.1|  PREDICTED: heparanase-like protein 3               197   2e-54   Eucalyptus grandis [rose gum]
ref|XP_008658727.1|  PREDICTED: heparanase-like protein 3 isoform X1    196   5e-54   
ref|NP_001152083.1|  heparanase-like protein 3 precursor                195   9e-54   Zea mays [maize]
ref|XP_002437942.1|  hypothetical protein SORBIDRAFT_10g005260          191   4e-52   Sorghum bicolor [broomcorn]
gb|EYU38304.1|  hypothetical protein MIMGU_mgv1a011158mg                184   4e-52   Erythranthe guttata [common monkey flower]
gb|ABR16706.1|  unknown                                                 187   4e-52   Picea sitchensis
ref|XP_011070961.1|  PREDICTED: heparanase-like protein 1 isoform X2    181   4e-49   Sesamum indicum [beniseed]
ref|XP_011070960.1|  PREDICTED: heparanase-like protein 2 isoform X1    182   5e-49   Sesamum indicum [beniseed]
gb|KCW81359.1|  hypothetical protein EUGRSUZ_C02741                     178   6e-48   Eucalyptus grandis [rose gum]
ref|XP_010936349.1|  PREDICTED: heparanase-like protein 1 isoform X2    179   7e-48   Elaeis guineensis
gb|ACN26863.1|  unknown                                                 177   8e-48   Zea mays [maize]
ref|XP_010936348.1|  PREDICTED: heparanase-like protein 1 isoform X1    179   2e-47   
gb|EAZ26032.1|  hypothetical protein OsJ_09885                          176   5e-47   Oryza sativa Japonica Group [Japonica rice]
gb|AGV40186.2|  heparanase 1-like protein                               176   7e-47   Nicotiana tabacum [American tobacco]
ref|XP_009631958.1|  PREDICTED: heparanase-like protein 2               176   7e-47   Nicotiana tomentosiformis
gb|ACG44916.1|  heparanase-like protein 2 precursor                     176   7e-47   Zea mays [maize]
ref|XP_002468296.1|  hypothetical protein SORBIDRAFT_01g043180          176   9e-47   Sorghum bicolor [broomcorn]
ref|NP_001049350.1|  Os03g0211700                                       176   1e-46   
ref|XP_008393204.1|  PREDICTED: heparanase-like protein 1               176   1e-46   
ref|XP_003520103.1|  PREDICTED: heparanase-like protein 2-like          166   2e-46   
ref|XP_011012392.1|  PREDICTED: heparanase-like protein 2               175   2e-46   Populus euphratica
ref|XP_002284470.1|  PREDICTED: heparanase-like protein 1               175   2e-46   Vitis vinifera
ref|XP_010259074.1|  PREDICTED: heparanase-like protein 1               175   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009338656.1|  PREDICTED: heparanase-like protein 1 isoform X1    175   3e-46   Pyrus x bretschneideri [bai li]
ref|NP_001145968.1|  uncharacterized protein LOC100279495 precursor     174   3e-46   Zea mays [maize]
ref|XP_004239465.2|  PREDICTED: heparanase-like protein 2               174   4e-46   
dbj|BAJ97884.1|  predicted protein                                      174   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ84826.1|  predicted protein                                      174   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96463.1|  predicted protein                                      174   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009783167.1|  PREDICTED: heparanase-like protein 2               173   5e-46   Nicotiana sylvestris
ref|XP_009761177.1|  PREDICTED: heparanase-like protein 2               174   7e-46   Nicotiana sylvestris
ref|XP_009612848.1|  PREDICTED: heparanase-like protein 2               173   8e-46   Nicotiana tomentosiformis
ref|XP_006348811.1|  PREDICTED: heparanase-like protein 2-like          173   1e-45   
gb|EYU22381.1|  hypothetical protein MIMGU_mgv1a008019mg                170   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_003558511.1|  PREDICTED: heparanase-like protein 1               172   1e-45   Brachypodium distachyon [annual false brome]
emb|CBI15157.3|  unnamed protein product                                172   2e-45   Vitis vinifera
ref|XP_008374597.1|  PREDICTED: heparanase-like protein 1               172   2e-45   Malus domestica [apple tree]
ref|XP_002315010.1|  hypothetical protein POPTR_0010s16820g             171   3e-45   
ref|XP_003578591.1|  PREDICTED: heparanase-like protein 1               172   3e-45   Brachypodium distachyon [annual false brome]
ref|XP_009595357.1|  PREDICTED: heparanase-like protein 2 isoform X2    171   5e-45   Nicotiana tomentosiformis
gb|KCW81358.1|  hypothetical protein EUGRSUZ_C02740                     170   5e-45   Eucalyptus grandis [rose gum]
gb|EYU28837.1|  hypothetical protein MIMGU_mgv1a026758mg                170   6e-45   Erythranthe guttata [common monkey flower]
ref|XP_009595353.1|  PREDICTED: heparanase-like protein 2 isoform X1    171   6e-45   Nicotiana tomentosiformis
ref|XP_012080342.1|  PREDICTED: heparanase-like protein 1               171   7e-45   Jatropha curcas
ref|XP_010936395.1|  PREDICTED: heparanase-like protein 2               170   8e-45   Elaeis guineensis
ref|XP_004241591.1|  PREDICTED: heparanase-like protein 2               170   1e-44   Solanum lycopersicum
gb|ACV84153.1|  heparanase                                              170   1e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_010688437.1|  PREDICTED: heparanase-like protein 3               169   1e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012068345.1|  PREDICTED: heparanase-like protein 2               169   1e-44   Jatropha curcas
emb|CAD42650.1|  putative heparanase                                    170   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002514696.1|  Heparanase-2, putative                             169   2e-44   Ricinus communis
ref|XP_006574931.1|  PREDICTED: heparanase-like protein 2-like is...    166   2e-44   
ref|XP_010046621.1|  PREDICTED: heparanase-like protein 2               169   2e-44   Eucalyptus grandis [rose gum]
gb|KCW86528.1|  hypothetical protein EUGRSUZ_B03174                     169   2e-44   Eucalyptus grandis [rose gum]
gb|EMT29716.1|  Heparanase-like protein 3                               169   2e-44   
gb|KDO83095.1|  hypothetical protein CISIN_1g041499mg                   169   2e-44   Citrus sinensis [apfelsine]
ref|XP_002866422.1|  glycosyl hydrolase family 79 N-terminal doma...    169   3e-44   
ref|XP_009339108.1|  PREDICTED: heparanase-like protein 1 isoform X1    169   3e-44   Pyrus x bretschneideri [bai li]
gb|KJB50982.1|  hypothetical protein B456_008G196400                    169   3e-44   Gossypium raimondii
ref|XP_002512114.1|  Heparanase precursor, putative                     169   3e-44   
ref|XP_006345162.1|  PREDICTED: heparanase-like protein 1-like          169   3e-44   Solanum tuberosum [potatoes]
ref|XP_008239880.1|  PREDICTED: heparanase-like protein 1               169   3e-44   Prunus mume [ume]
ref|XP_004298393.1|  PREDICTED: heparanase-like protein 2               169   4e-44   Fragaria vesca subsp. vesca
ref|XP_007226518.1|  hypothetical protein PRUPE_ppa025624mg             168   4e-44   
gb|EMS53277.1|  Heparanase-like protein 1                               167   4e-44   Triticum urartu
ref|XP_008221534.1|  PREDICTED: heparanase-like protein 2               168   4e-44   Prunus mume [ume]
ref|XP_010678425.1|  PREDICTED: heparanase-like protein 2               168   5e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006374168.1|  hypothetical protein POPTR_0015s03440g             165   5e-44   
ref|XP_006354764.1|  PREDICTED: heparanase-like protein 2-like is...    168   8e-44   Solanum tuberosum [potatoes]
ref|XP_010030437.1|  PREDICTED: heparanase-like protein 1               168   8e-44   Eucalyptus grandis [rose gum]
ref|XP_006438800.1|  hypothetical protein CICLE_v10033641mg             167   1e-43   
ref|XP_004299326.1|  PREDICTED: heparanase-like protein 1               167   1e-43   Fragaria vesca subsp. vesca
ref|XP_006649618.1|  PREDICTED: heparanase-like protein 2-like          167   1e-43   
gb|KJB38700.1|  hypothetical protein B456_006G267500                    167   1e-43   Gossypium raimondii
ref|XP_006483691.1|  PREDICTED: heparanase-like protein 2-like          167   2e-43   
ref|XP_011075654.1|  PREDICTED: heparanase-like protein 2               167   2e-43   Sesamum indicum [beniseed]
ref|XP_006837042.1|  PREDICTED: heparanase-like protein 2               166   2e-43   Amborella trichopoda
ref|XP_009394623.1|  PREDICTED: heparanase-like protein 2               166   2e-43   
ref|XP_006664141.1|  PREDICTED: heparanase-like protein 1-like is...    166   2e-43   Oryza brachyantha
gb|KHN02019.1|  Heparanase-like protein 2                               166   3e-43   Glycine soja [wild soybean]
ref|XP_009801842.1|  PREDICTED: heparanase-like protein 1 isoform X2    166   3e-43   Nicotiana sylvestris
gb|KDO54577.1|  hypothetical protein CISIN_1g008834mg                   166   3e-43   Citrus sinensis [apfelsine]
ref|XP_007209868.1|  hypothetical protein PRUPE_ppa003813mg             166   3e-43   Prunus persica
ref|XP_006477619.1|  PREDICTED: heparanase-like protein 1-like is...    166   3e-43   Citrus sinensis [apfelsine]
ref|XP_009395254.1|  PREDICTED: heparanase-like protein 1               166   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006440691.1|  hypothetical protein CICLE_v10019304mg             166   3e-43   
ref|XP_010096576.1|  Heparanase-like protein 2                          165   3e-43   
ref|XP_004985229.1|  PREDICTED: heparanase-like protein 1-like is...    166   3e-43   Setaria italica
ref|XP_008805083.1|  PREDICTED: heparanase-like protein 2               166   3e-43   Phoenix dactylifera
ref|XP_009801838.1|  PREDICTED: heparanase-like protein 2 isoform X1    166   4e-43   Nicotiana sylvestris
gb|KJB74275.1|  hypothetical protein B456_011G2845002                   159   4e-43   Gossypium raimondii
ref|XP_006374166.1|  hypothetical protein POPTR_0015s03440g             165   4e-43   
ref|XP_008785953.1|  PREDICTED: heparanase-like protein 2 isoform X2    166   5e-43   Phoenix dactylifera
ref|XP_010258149.1|  PREDICTED: heparanase-like protein 1 isoform X4    166   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010258146.1|  PREDICTED: heparanase-like protein 1 isoform X1    166   5e-43   
ref|XP_010258148.1|  PREDICTED: heparanase-like protein 1 isoform X3    166   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010258147.1|  PREDICTED: heparanase-like protein 1 isoform X2    166   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_011013080.1|  PREDICTED: heparanase-like protein 1 isoform X2    163   5e-43   Populus euphratica
ref|XP_006440690.1|  hypothetical protein CICLE_v10019304mg             166   6e-43   
ref|XP_006574930.1|  PREDICTED: heparanase-like protein 2-like is...    165   6e-43   Glycine max [soybeans]
ref|XP_007209866.1|  hypothetical protein PRUPE_ppa003804mg             165   7e-43   Prunus persica
ref|XP_006374165.1|  hypothetical protein POPTR_0015s03440g             165   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010068782.1|  PREDICTED: heparanase-like protein 1               164   1e-42   Eucalyptus grandis [rose gum]
ref|XP_007037489.1|  Glucuronidase 2 isoform 3                          162   2e-42   
dbj|BAJ97219.1|  predicted protein                                      164   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004962990.1|  PREDICTED: heparanase-like protein 2-like          164   2e-42   Setaria italica
ref|XP_008672060.1|  PREDICTED: uncharacterized protein LOC100192...    164   3e-42   Zea mays [maize]
gb|KJB74286.1|  hypothetical protein B456_011G285200                    163   3e-42   Gossypium raimondii
ref|NP_001067122.1|  Os12g0578400                                       164   3e-42   
ref|XP_007157579.1|  hypothetical protein PHAVU_002G081000g             163   3e-42   Phaseolus vulgaris [French bean]
ref|XP_011013079.1|  PREDICTED: heparanase-like protein 1 isoform X1    163   3e-42   Populus euphratica
ref|NP_001130921.1|  uncharacterized protein LOC100192026 precursor     163   4e-42   Zea mays [maize]
ref|XP_008672059.1|  PREDICTED: uncharacterized protein LOC100192...    163   4e-42   Zea mays [maize]
ref|XP_010923583.1|  PREDICTED: heparanase-like protein 2 isoform X2    163   4e-42   Elaeis guineensis
ref|XP_008792775.1|  PREDICTED: heparanase-like protein 2               163   5e-42   
ref|XP_009399121.1|  PREDICTED: heparanase-like protein 1               163   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB74280.1|  hypothetical protein B456_011G285000                    162   6e-42   Gossypium raimondii
ref|XP_007037487.1|  Glucuronidase 2 isoform 1                          162   7e-42   
ref|XP_008661167.1|  PREDICTED: heparanase-like protein 1               162   7e-42   Zea mays [maize]
ref|XP_004235980.1|  PREDICTED: heparanase-like protein 1               162   7e-42   Solanum lycopersicum
ref|XP_011072825.1|  PREDICTED: heparanase-like protein 1 isoform X2    162   8e-42   
dbj|BAB08480.1|  unnamed protein product                                162   8e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ACR10240.1|  heparanase                                              162   8e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_011072824.1|  PREDICTED: heparanase-like protein 1 isoform X1    162   9e-42   Sesamum indicum [beniseed]
ref|XP_008340307.1|  PREDICTED: heparanase-like protein 2               162   9e-42   
ref|NP_200933.2|  glucuronidase 1                                       162   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002442385.1|  hypothetical protein SORBIDRAFT_08g019250          162   1e-41   Sorghum bicolor [broomcorn]
ref|XP_008785952.1|  PREDICTED: heparanase-like protein 2 isoform X1    161   1e-41   Phoenix dactylifera
gb|KHN48723.1|  Heparanase-like protein 2                               160   1e-41   Glycine soja [wild soybean]
ref|XP_008453243.1|  PREDICTED: heparanase-like protein 1               161   2e-41   
ref|XP_006281918.1|  hypothetical protein CARUB_v10028123mg             161   2e-41   Capsella rubella
ref|XP_007155261.1|  hypothetical protein PHAVU_003G186600g             161   3e-41   Phaseolus vulgaris [French bean]
gb|ERM99894.1|  hypothetical protein AMTR_s00110p00044140               160   3e-41   Amborella trichopoda
ref|XP_004508702.1|  PREDICTED: heparanase-like protein 2-like is...    159   3e-41   
ref|XP_011656257.1|  PREDICTED: heparanase-like protein 1               160   3e-41   
ref|XP_011621075.1|  PREDICTED: heparanase-like protein 1 isoform X1    160   3e-41   
gb|KGN51965.1|  hypothetical protein Csa_5G606560                       160   3e-41   
ref|XP_006837041.2|  PREDICTED: heparanase-like protein 1 isoform X2    160   4e-41   
emb|CDP00405.1|  unnamed protein product                                160   4e-41   
ref|XP_010457069.1|  PREDICTED: heparanase-like protein 2               160   5e-41   
ref|XP_012067747.1|  PREDICTED: heparanase-like protein 2               160   5e-41   
ref|XP_003525455.1|  PREDICTED: heparanase-like protein 1-like is...    160   6e-41   
gb|KHN02016.1|  Heparanase-like protein 2                               159   7e-41   
ref|XP_010452749.1|  PREDICTED: heparanase-like protein 1               160   7e-41   
ref|XP_011660285.1|  PREDICTED: heparanase-like protein 1               159   7e-41   
ref|XP_010443938.1|  PREDICTED: heparanase-like protein 2               159   8e-41   
ref|XP_009397277.1|  PREDICTED: heparanase-like protein 1               159   8e-41   
tpg|DAA47198.1|  TPA: hypothetical protein ZEAMMB73_798346              162   9e-41   
ref|XP_008446419.1|  PREDICTED: heparanase-like protein 1               159   1e-40   
ref|XP_008447189.1|  PREDICTED: heparanase-like protein 1               159   1e-40   
ref|XP_004508697.1|  PREDICTED: heparanase-like protein 2-like is...    159   1e-40   
ref|XP_004137422.1|  PREDICTED: heparanase-like protein 1               159   1e-40   
ref|XP_004508698.1|  PREDICTED: heparanase-like protein 2-like is...    159   1e-40   
ref|XP_010923582.1|  PREDICTED: heparanase-like protein 2 isoform X1    159   2e-40   
ref|XP_006574932.1|  PREDICTED: heparanase-like protein 2-like          158   2e-40   
ref|XP_010491400.1|  PREDICTED: heparanase-like protein 1               159   2e-40   
gb|KJB33257.1|  hypothetical protein B456_006G004300                    158   2e-40   
gb|KJB74088.1|  hypothetical protein B456_011G271100                    158   2e-40   
emb|CAB62595.1|  putative protein                                       158   3e-40   
gb|KJB84293.1|  hypothetical protein B456_N016700                       157   3e-40   
ref|NP_196400.2|  glucuronidase 2                                       157   3e-40   
ref|XP_006289223.1|  hypothetical protein CARUB_v10002679mg             157   3e-40   
ref|XP_002871291.1|  hypothetical protein ARALYDRAFT_350042             157   4e-40   
ref|XP_010483789.1|  PREDICTED: heparanase-like protein 2               157   5e-40   
ref|XP_006581996.1|  PREDICTED: heparanase-like protein 1-like is...    156   5e-40   
ref|XP_010037191.1|  PREDICTED: heparanase-like protein 2               156   9e-40   
gb|KHN04137.1|  Heparanase-like protein 1                               156   1e-39   
ref|XP_003527099.1|  PREDICTED: heparanase-like protein 1-like is...    156   1e-39   
ref|XP_009136454.1|  PREDICTED: heparanase-like protein 2               156   1e-39   
ref|XP_006399265.1|  hypothetical protein EUTSA_v10013186mg             156   2e-39   
ref|XP_006578556.1|  PREDICTED: heparanase-like protein 1-like is...    155   2e-39   
ref|XP_010423168.1|  PREDICTED: heparanase-like protein 1 isoform X4    155   2e-39   
ref|XP_010423164.1|  PREDICTED: heparanase-like protein 1 isoform X1    155   2e-39   
ref|XP_010423167.1|  PREDICTED: heparanase-like protein 1 isoform X3    155   2e-39   
ref|XP_010423166.1|  PREDICTED: heparanase-like protein 1 isoform X2    155   2e-39   
gb|KEH31991.1|  glycoside hydrolase family 79 amino-terminal doma...    153   2e-39   
ref|XP_010546171.1|  PREDICTED: heparanase-like protein 1 isoform X1    155   3e-39   
gb|KEH33104.1|  glycoside hydrolase family 79 amino-terminal doma...    155   3e-39   
gb|KJB60459.1|  hypothetical protein B456_009G305800                    155   3e-39   
gb|KJB33258.1|  hypothetical protein B456_006G004400                    154   3e-39   
emb|CDP17495.1|  unnamed protein product                                155   3e-39   
gb|KHN36951.1|  Heparanase-like protein 1                               155   3e-39   
ref|XP_010106651.1|  Heparanase-like protein 1                          154   6e-39   
ref|XP_006600562.1|  PREDICTED: heparanase-like protein 1-like is...    153   8e-39   
ref|XP_009122405.1|  PREDICTED: heparanase-like protein 1 isoform X1    154   8e-39   
ref|XP_006394524.1|  hypothetical protein EUTSA_v10003960mg             154   9e-39   
ref|XP_010904949.1|  PREDICTED: heparanase-like protein 1               153   1e-38   
ref|XP_003549557.1|  PREDICTED: heparanase-like protein 1-like is...    153   1e-38   
gb|KEH31990.1|  glycoside hydrolase family 79 amino-terminal doma...    153   2e-38   
gb|KEH31989.1|  glycoside hydrolase family 79 amino-terminal doma...    153   2e-38   
sp|Q9LRC8.1|BAGLU_SCUBA  RecName: Full=Baicalin-beta-D-glucuronid...    152   2e-38   
emb|CBI27258.3|  unnamed protein product                                152   2e-38   
ref|XP_002274743.1|  PREDICTED: heparanase-like protein 2               152   2e-38   
emb|CDX99032.1|  BnaC09g48030D                                          152   4e-38   
gb|KJB33259.1|  hypothetical protein B456_006G004500                    150   6e-38   
gb|KJB84191.1|  hypothetical protein B456_N009200                       150   8e-38   
ref|XP_002976895.1|  hypothetical protein SELMODRAFT_105931             150   8e-38   
emb|CDX69989.1|  BnaA10g23380D                                          150   9e-38   
gb|EYU43518.1|  hypothetical protein MIMGU_mgv1a004063mg                150   2e-37   
ref|XP_010552799.1|  PREDICTED: heparanase-like protein 2               150   2e-37   
gb|KEH33103.1|  glycoside hydrolase family 79 amino-terminal doma...    149   2e-37   
gb|AES96970.2|  glycoside hydrolase family 79 amino-terminal doma...    149   4e-37   
ref|XP_003614012.1|  Heparanase-like protein                            149   4e-37   
gb|EEE53489.1|  hypothetical protein OsJ_36644                          148   9e-37   
gb|EAZ04591.1|  hypothetical protein OsI_26741                          147   1e-36   
gb|KEH33102.1|  glycoside hydrolase family 79 amino-terminal doma...    146   1e-36   
gb|KJB84192.1|  hypothetical protein B456_N009300                       147   2e-36   
ref|XP_001769830.1|  predicted protein                                  147   3e-36   
gb|KHN18337.1|  Heparanase-like protein 1                               146   3e-36   
gb|KEH33101.1|  glycoside hydrolase family 79 amino-terminal doma...    146   3e-36   
ref|XP_001770123.1|  predicted protein                                  146   4e-36   
tpg|DAA57913.1|  TPA: hypothetical protein ZEAMMB73_865151              145   4e-36   
ref|NP_001060182.1|  Os07g0598400                                       145   5e-36   
gb|EEC69565.1|  hypothetical protein OsI_38868                          148   9e-36   
ref|XP_001774747.1|  predicted protein                                  142   4e-35   
ref|XP_002991174.1|  hypothetical protein SELMODRAFT_133100             142   7e-35   
ref|XP_008453728.1|  PREDICTED: heparanase-like protein 1               136   7e-35   
ref|XP_002991234.1|  hypothetical protein SELMODRAFT_133227             142   8e-35   
ref|XP_007045929.1|  Heparanase, putative                               142   9e-35   
gb|EMS65630.1|  Heparanase-like protein 3                               134   1e-34   
ref|XP_001767170.1|  predicted protein                                  140   3e-34   
gb|KEH31988.1|  glycoside hydrolase family 79 amino-terminal doma...    140   5e-34   
gb|KFK32018.1|  hypothetical protein AALP_AA6G189500                    139   9e-34   
ref|NP_001183276.1|  uncharacterized protein LOC100501670 precursor     137   6e-33   
gb|EAY89013.1|  hypothetical protein OsI_10495                          136   9e-33   
gb|KJB84190.1|  hypothetical protein B456_N009100                       134   2e-32   
ref|XP_004134497.1|  PREDICTED: heparanase-like protein 2 isoform X2    134   4e-32   
ref|XP_011651069.1|  PREDICTED: heparanase-like protein 2 isoform X1    135   4e-32   
ref|XP_008438923.1|  PREDICTED: heparanase-like protein 2               134   5e-32   
ref|XP_004140375.1|  PREDICTED: heparanase-like protein 1               133   1e-31   
gb|KGN51001.1|  hypothetical protein Csa_5G390000                       133   1e-31   
ref|XP_004146543.1|  PREDICTED: heparanase-like protein 1               128   4e-30   
ref|XP_008681323.1|  PREDICTED: uncharacterized protein LOC100217...    124   5e-30   
gb|KGN53270.1|  hypothetical protein Csa_4G043860                       128   5e-30   
gb|KJB64651.1|  hypothetical protein B456_010G059600                    127   9e-30   
emb|CDY02161.1|  BnaA03g40060D                                          127   1e-29   
ref|XP_003609471.1|  Heparanase-like protein                            125   2e-29   
ref|XP_006658769.1|  PREDICTED: heparanase-like protein 1-like          127   2e-29   
emb|CDY23075.1|  BnaC07g31120D                                          126   2e-29   
gb|KDP41275.1|  hypothetical protein JCGZ_15682                         117   4e-26   
gb|KCW81361.1|  hypothetical protein EUGRSUZ_C02742                     116   5e-26   
ref|XP_002980613.1|  hypothetical protein SELMODRAFT_52894              114   3e-25   
gb|EPS63505.1|  heparanase-like protein 1                               112   1e-24   
gb|KCW83013.1|  hypothetical protein EUGRSUZ_C04395                     109   1e-24   
gb|KDO54583.1|  hypothetical protein CISIN_1g008834mg                   110   4e-24   
gb|EMT08055.1|  Heparanase-like protein 1                               109   1e-23   
emb|CDP16528.1|  unnamed protein product                                102   1e-23   
ref|XP_002976894.1|  hypothetical protein SELMODRAFT_32458              108   3e-23   
ref|XP_002512115.1|  conserved hypothetical protein                     105   3e-23   
gb|KDO54582.1|  hypothetical protein CISIN_1g008834mg                   107   5e-23   
emb|CDP14477.1|  unnamed protein product                              99.8    1e-22   
gb|EYU40129.1|  hypothetical protein MIMGU_mgv1a025097mg                104   2e-22   
tpg|DAA47199.1|  TPA: hypothetical protein ZEAMMB73_798346              107   6e-22   
gb|KHG13978.1|  hypothetical protein F383_01956                         104   1e-21   
gb|KJB74093.1|  hypothetical protein B456_011G271700                  99.8    3e-21   
ref|XP_006483407.1|  PREDICTED: heparanase-like protein 3-like is...    102   5e-21   
gb|KHN02017.1|  Heparanase-like protein 2                             94.0    7e-20   
ref|XP_010546175.1|  PREDICTED: heparanase-like protein 1 isoform X2  96.3    6e-19   
ref|XP_003630110.1|  Heparanase-like protein                          81.6    2e-17   
ref|XP_006601533.1|  PREDICTED: heparanase-like protein 1-like        89.4    2e-17   
gb|EEE67528.1|  hypothetical protein OsJ_24994                        90.5    6e-17   
gb|KDP41274.1|  hypothetical protein JCGZ_15681                       89.7    1e-16   
gb|EWM24999.1|  heparanase-like protein 3                             89.7    2e-16   
ref|XP_006590142.1|  PREDICTED: heparanase-like protein 1-like        83.6    2e-16   
emb|CAN63833.1|  hypothetical protein VITISV_009131                   89.7    3e-16   
ref|XP_006596849.1|  PREDICTED: uncharacterized protein LOC102669243  84.3    2e-15   
gb|AFK39031.1|  unknown                                               80.5    6e-15   
ref|XP_006582719.1|  PREDICTED: heparanase-like protein 1-like        80.9    6e-15   
ref|XP_001742736.1|  hypothetical protein                             80.9    7e-15   
ref|WP_035663184.1|  hypothetical protein                             83.6    1e-14   
gb|KJB33253.1|  hypothetical protein B456_006G004200                  82.8    3e-14   
ref|WP_043978178.1|  hypothetical protein                             82.8    3e-14   
ref|WP_035215244.1|  hypothetical protein                             82.8    3e-14   
gb|KJB33611.1|  hypothetical protein B456_006G021700                  80.5    1e-13   
ref|WP_035177679.1|  hypothetical protein                             80.5    2e-13   
ref|WP_045861183.1|  glycoside hydrolase                              80.5    2e-13   
ref|WP_027535911.1|  hypothetical protein                             79.7    3e-13   
gb|KDR18877.1|  Heparanase                                            79.7    3e-13   
gb|KJB84361.1|  hypothetical protein B456_N0210001                    78.6    5e-13   
ref|WP_011686731.1|  hypothetical protein                             79.0    5e-13   
ref|WP_028670294.1|  hypothetical protein                             78.6    7e-13   
ref|WP_035729267.1|  MULTISPECIES: hypothetical protein               78.6    8e-13   
ref|WP_036048072.1|  hypothetical protein                             77.4    2e-12   
ref|WP_006954143.1|  hypothetical protein                             77.4    2e-12   
ref|WP_035959084.1|  hypothetical protein                             76.6    3e-12   
ref|WP_038956998.1|  hypothetical protein                             76.3    5e-12   
ref|WP_033317620.1|  hypothetical protein                             75.9    5e-12   
ref|WP_028174514.1|  MULTISPECIES: hypothetical protein               75.9    5e-12   
ref|WP_039157801.1|  hypothetical protein                             75.9    6e-12   
ref|XP_004998289.1|  hypothetical protein PTSG_00821                  75.9    6e-12   
gb|AHY53931.1|  hypothetical protein BJS_01312                        75.9    6e-12   
ref|WP_038934864.1|  hypothetical protein                             74.7    1e-11   
ref|XP_002166563.2|  PREDICTED: heparanase-like                       72.0    1e-11   
gb|KJC38324.1|  hypothetical protein UB31_31870                       74.7    1e-11   
ref|XP_006604018.1|  PREDICTED: heparanase-like protein 1-like is...  69.3    1e-11   
ref|WP_045013927.1|  hypothetical protein                             74.7    1e-11   
ref|XP_791715.3|  PREDICTED: heparanase                               74.3    2e-11   
ref|YP_001340501.1|  hypothetical protein Mmwyl1_1639                 73.9    2e-11   
gb|KHG12946.1|  hypothetical protein F383_07365                       73.9    3e-11   
gb|AET04586.2|  glycoside hydrolase family 79 amino-terminal doma...  72.4    3e-11   
ref|XP_002167980.1|  PREDICTED: heparanase-like                       73.6    3e-11   
ref|WP_028160701.1|  hypothetical protein                             73.2    5e-11   
ref|XP_002154393.2|  PREDICTED: heparanase-like                       72.8    6e-11   
ref|WP_036007187.1|  hypothetical protein                             72.0    1e-10   
ref|WP_027583103.1|  hypothetical protein                             71.2    2e-10   
ref|WP_029078282.1|  hypothetical protein                             71.2    2e-10   
ref|XP_011863950.1|  PREDICTED: heparanase-like                       71.2    2e-10   
ref|WP_018415804.1|  glycoside hydrolase                              71.2    2e-10   
ref|WP_045826321.1|  glycoside hydrolase                              71.2    2e-10   
ref|WP_028885873.1|  glycoside hydrolase                              71.2    2e-10   
ref|WP_018275967.1|  glycoside hydrolase                              71.2    2e-10   
gb|ENN73698.1|  hypothetical protein YQE_09695                        71.2    2e-10   
ref|WP_019604221.1|  glycoside hydrolase                              71.2    2e-10   
ref|WP_013662017.1|  glycoside hydrolase                              71.2    2e-10   
ref|WP_035714031.1|  hypothetical protein                             68.2    3e-10   
ref|WP_044952250.1|  hypothetical protein                             70.9    3e-10   
ref|WP_036027390.1|  hypothetical protein                             70.9    3e-10   
ref|WP_035688244.1|  hypothetical protein                             70.9    3e-10   
ref|XP_001634849.1|  predicted protein                                70.9    3e-10   
ref|WP_028170627.1|  hypothetical protein                             70.5    3e-10   
ref|XP_011298477.1|  PREDICTED: heparanase-like                       70.5    3e-10   
ref|WP_014492743.1|  hypothetical protein                             70.5    3e-10   
ref|WP_029582693.1|  hypothetical protein                             70.5    4e-10   
ref|XP_002170740.2|  PREDICTED: heparanase-like                       70.1    4e-10   
ref|WP_024024806.1|  glycoside hydrolase                              70.1    4e-10   
ref|WP_028876470.1|  glycoside hydrolase                              70.1    5e-10   
ref|WP_027572739.1|  hypothetical protein                             70.1    5e-10   
ref|WP_036042402.1|  hypothetical protein                             70.1    5e-10   
ref|WP_015819393.1|  glycoside hydrolase                              70.1    5e-10   
ref|WP_018014255.1|  glycoside hydrolase                              70.1    5e-10   
ref|WP_043855506.1|  hypothetical protein                             70.1    5e-10   
ref|WP_029879028.1|  hypothetical protein                             70.1    5e-10   
emb|CBY12659.1|  unnamed protein product                              69.3    6e-10   
gb|EKC37951.1|  Heparanase                                            69.3    8e-10   
ref|XP_011438298.1|  PREDICTED: heparanase-like                       69.3    9e-10   
ref|WP_038941822.1|  hypothetical protein                             69.3    9e-10   
ref|WP_028147103.1|  hypothetical protein                             69.3    9e-10   
ref|NP_001120267.1|  heparanase precursor                             69.3    1e-09   
gb|KJB84362.1|  hypothetical protein B456_N0210002                    65.1    1e-09   
emb|CBY33808.1|  unnamed protein product                              68.9    1e-09   
ref|XP_003383078.1|  PREDICTED: heparanase-like                       68.9    1e-09   
ref|XP_002309644.2|  hypothetical protein POPTR_0006s27360g           65.5    1e-09   
ref|WP_021077476.1|  UMF1 family MFS transporter                      68.9    1e-09   
ref|XP_002162074.2|  PREDICTED: heparanase-like                       68.6    1e-09   
ref|WP_024019241.1|  hypothetical protein                             68.6    1e-09   
ref|XP_001747086.1|  hypothetical protein                             68.6    2e-09   
ref|XP_011626457.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...  67.0    2e-09   
ref|XP_009037281.1|  hypothetical protein AURANDRAFT_64495            68.2    2e-09   
gb|ELU16082.1|  hypothetical protein CAPTEDRAFT_223505                68.2    2e-09   
ref|WP_045002231.1|  hypothetical protein                             68.2    2e-09   
ref|WP_013796664.1|  glycoside hydrolase                              68.2    2e-09   
ref|WP_035727815.1|  hypothetical protein                             68.2    2e-09   
gb|KJC60860.1|  hypothetical protein UP10_10895                       68.2    2e-09   
ref|WP_035689986.1|  hypothetical protein                             68.2    2e-09   
ref|XP_008666379.1|  PREDICTED: uncharacterized protein LOC103645024  68.6    2e-09   



>ref|XP_006359499.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=536

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 155/203 (76%), Gaps = 7/203 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN L+TSFSG
Sbjct  340  LDQLGMSAAYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLATSFSG  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAYAHCAKQS GITLLLINLD NTT+ A V +NG+ +H RKH  H NH        
Sbjct  400  TKKIRAYAHCAKQSQGITLLLINLDGNTTIHARVDFNGTMLHRRKHRHHHNHRKSSIKL-  458

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  PRS K  + TREEYHLTAK G+L SQTMLLNGN L VDSSG+IP  +P Y+NS+
Sbjct  459  ------PRSSKIASNTREEYHLTAKDGNLQSQTMLLNGNALIVDSSGNIPTFEPIYVNST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            E ITVAPFSIVF HIPYV LPAC
Sbjct  513  EAITVAPFSIVFVHIPYVLLPAC  535



>ref|XP_009625836.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=538

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 158/203 (78%), Gaps = 7/203 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  342  LDQLGMSAAYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +KKIRAY HCAKQS GITLLLINLD NTT+ AN+A+NG+ +HHRKH  H +         
Sbjct  402  SKKIRAYTHCAKQSQGITLLLINLDGNTTIRANIAFNGTLLHHRKHRHHSHRKSSSIRL-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P+S+K  + TR+EYHLTAK GDL SQTMLLNG  L++DS G+IP ++P ++NS+
Sbjct  461  ------PKSRKIASNTRQEYHLTAKDGDLQSQTMLLNGKPLTIDSFGNIPSLEPIFVNST  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EP+TVAPFSI+F HIPYV LPAC
Sbjct  515  EPLTVAPFSILFVHIPYVILPAC  537



>ref|XP_009757548.1| PREDICTED: heparanase-like protein 3 [Nicotiana sylvestris]
Length=538

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 157/203 (77%), Gaps = 7/203 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LST+FSG
Sbjct  342  LDQLGMSAAYDTKAYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTTFSG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +KKIRAYAHCAKQS GITLLLINLD NTT+ ANVA+NG+ +H RKH  H +         
Sbjct  402  SKKIRAYAHCAKQSRGITLLLINLDGNTTMSANVAFNGTMLHQRKHRHHSHRKSSSIRL-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P+S+K  + TR+EYHLTAK GDL SQTMLLNG  L++DS G+IP ++P ++NS+
Sbjct  461  ------PKSRKIASNTRQEYHLTAKDGDLQSQTMLLNGKPLTIDSFGNIPSLEPIFVNST  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EP+TVAPFSIVF HIPYV LPAC
Sbjct  515  EPLTVAPFSIVFVHIPYVILPAC  537



>ref|XP_004242732.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=536

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 151/203 (74%), Gaps = 7/203 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG
Sbjct  340  LDQLGMSAAYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSG  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAYAHCAKQS GITLLLINLD NTT+   V +NG+ +H +KH  H NH        
Sbjct  400  TKKLRAYAHCAKQSQGITLLLINLDGNTTIHPRVDFNGTMLHQQKHRHHHNHRKSSIKL-  458

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  PRS K  + TREEYHLTAK G+L SQTMLLNG  L VDSSG+IP  +P Y+NS+
Sbjct  459  ------PRSNKVASNTREEYHLTAKDGNLQSQTMLLNGKALIVDSSGNIPTFEPIYVNST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            E ITVAP SIVF HIPYV LPAC
Sbjct  513  EAITVAPLSIVFVHIPYVLLPAC  535



>emb|CBI25561.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 148/204 (73%), Gaps = 11/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  341  LDQLGMASAYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGRNVLSTSFSG  400

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GITLLLINLD++TTVEA VA+NG+     KH  H           
Sbjct  401  PKKIRAYAHCAKQSQGITLLLINLDNSTTVEAKVAFNGTSTLQHKHKLHRTKVIWF----  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                      K   M REEYHLTAK G+LHSQTMLLNGN L+V++SG IP ++P  +NSS
Sbjct  457  -------EGSKTSEMEREEYHLTAKDGNLHSQTMLLNGNILTVNASGDIPPLEPLNVNSS  509

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PIT+APFSIVF H+P V LPACR
Sbjct  510  SPITIAPFSIVFVHMPSVVLPACR  533



>ref|XP_010100865.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB85444.1| Heparanase-like protein 3 [Morus notabilis]
Length=534

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 159/204 (78%), Gaps = 3/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLL+TT   PNPDYYSALLWHRLMGRNALSTSFSG
Sbjct  334  LDQLGMSAAFDTKTYCRQSLIGGNYGLLDTTNLAPNPDYYSALLWHRLMGRNALSTSFSG  393

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAYAHCAKQS GIT+LLINLD++TTV   VA+NG++   +K   H  HHHHHHH  
Sbjct  394  TKKIRAYAHCAKQSKGITVLLINLDNSTTVLGKVAFNGTWSLEQKQTHHHRHHHHHHHRS  453

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  PRS K  T  REEYHL+AK GDLHS+TMLLNGN LS+DSS +IP ++P Y+NSS
Sbjct  454  RTSI--PRSLKSET-AREEYHLSAKDGDLHSRTMLLNGNILSIDSSSNIPTLQPVYINSS  510

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PI V PFSIVFAHIPYV +PAC+
Sbjct  511  KPIVVRPFSIVFAHIPYVVVPACQ  534



>ref|XP_002263173.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=559

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 152/208 (73%), Gaps = 4/208 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  352  LDQLGMASAYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGRNVLSTSFSG  411

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GITLLLINLD++TTVEA VA+NG+     KH  H  H  H +   
Sbjct  412  PKKIRAYAHCAKQSQGITLLLINLDNSTTVEAKVAFNGTSTLQHKHKLHRLHRLHKYRHR  471

Query  521  shgkGSP----RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  354
                 +        K   M REEYHLTAK G+LHSQTMLLNGN L+V++SG IP ++P  
Sbjct  472  HRIHRTKVIWFEGSKTSEMEREEYHLTAKDGNLHSQTMLLNGNILTVNASGDIPPLEPLN  531

Query  353  LNSSEPITVAPFSIVFAHIPYVFLPACR  270
            +NSS PIT+APFSIVF H+P V LPACR
Sbjct  532  VNSSSPITIAPFSIVFVHMPSVVLPACR  559



>ref|XP_010687865.1| PREDICTED: heparanase-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 149/204 (73%), Gaps = 5/204 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWH+LMGRN LSTSFSG
Sbjct  348  LDQLGMAAKYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHKLMGRNVLSTSFSG  407

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAYAHC+K S GIT+LLINLD N+TVEANVA+NG++           H +      
Sbjct  408  TKKVRAYAHCSKLSQGITMLLINLDGNSTVEANVAFNGTWSLLHTRHHIHKHKNRARAIK  467

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             H K +     RG     EYHLTAK GDL SQ MLLNG  LSV+SSG IP++ P ++NSS
Sbjct  468  WHQKKAADGGVRG-----EYHLTAKNGDLQSQIMLLNGEALSVNSSGEIPDLTPLHVNSS  522

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI + PFSIVF H+PY+ LPAC+
Sbjct  523  EPIVLGPFSIVFVHMPYILLPACK  546



>emb|CAN81917.1| hypothetical protein VITISV_038549 [Vitis vinifera]
Length=636

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 152/208 (73%), Gaps = 4/208 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  348  LDQLGMASAYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGRNVLSTSFSG  407

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GITLLLINLD++TTVEA VA+NG+     KH  H  H  H +   
Sbjct  408  PKKIRAYAHCAKQSQGITLLLINLDNSTTVEAKVAFNGTSTLQHKHKLHRLHRLHKYRHR  467

Query  521  shgkGSP----RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  354
                 +        K   M REEYHLTAK G+LHSQTMLLNGN L+V++SG IP ++P  
Sbjct  468  HRIHRTKVIWFEGSKTSEMEREEYHLTAKDGNLHSQTMLLNGNILTVNASGDIPPLEPLN  527

Query  353  LNSSEPITVAPFSIVFAHIPYVFLPACR  270
            +NSS PIT+APFSIVF H+P V LPACR
Sbjct  528  VNSSSPITIAPFSIVFVHMPSVVLPACR  555



>emb|CDP10485.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 154/203 (76%), Gaps = 8/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ+LIGGNYGLL+TTTFVPNPDYYSALLWH+LMGRN L+T+F G
Sbjct  348  LDQLGMASAYDTKAYCRQSLIGGNYGLLDTTTFVPNPDYYSALLWHQLMGRNVLATNFRG  407

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAYAHCAKQS GITLLLINLD + +V+  VAYNG+ +H  KH  H +   +     
Sbjct  408  TKKIRAYAHCAKQSKGITLLLINLDGSNSVQVKVAYNGTILHGHKHGHHHSSPKYIQL--  465

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P+ +K G+ TREEYHLTAKGGDLHS+TMLLNGNEL+V +SG IP++KP+   +S
Sbjct  466  ------PQPRKIGSATREEYHLTAKGGDLHSRTMLLNGNELTVGNSGEIPQLKPQIFPAS  519

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPI VAP+SIVFAHI Y+ L AC
Sbjct  520  EPINVAPYSIVFAHIEYLNLQAC  542



>ref|XP_010250274.1| PREDICTED: heparanase-like protein 3 [Nelumbo nucifera]
Length=551

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGR  LST+F+G
Sbjct  348  LDQLGMSATYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRTVLSTNFTG  407

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAY+HCAKQS GITLLLINLD NTTV+ +V    + ++    +RH + HH H    
Sbjct  408  TKKIRAYSHCAKQSPGITLLLINLDGNTTVQVHVTTQHAALYKTSTLRHKHRHHKHRSHK  467

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +     PR  K   +TREEYHLTAK G+LHSQT+ LNGN L+V+SSG IP ++P  +N S
Sbjct  468  TRFTQMPRDHKNSRITREEYHLTAKDGNLHSQTVHLNGNILTVNSSGDIPPLEPISVNRS  527

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAPFSIVFAHIP + +PACR
Sbjct  528  DPITVAPFSIVFAHIPDIDVPACR  551



>ref|XP_006381083.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58880.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=562

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 160/210 (76%), Gaps = 8/210 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  353  LDQLGMASAYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSG  412

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAY HCAKQS GITLLLINLD++TTVE  V +N ++  H+KH  H +H  H  H  
Sbjct  413  TKKIRAYTHCAKQSKGITLLLINLDNSTTVEVTVTFNSTWRLHQKHKPHRSHKLHKPHRS  472

Query  521  shgkGSPRSQ-----KRGT--MTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMK  363
                 S +S+     +R T  +TREEYHLTAK GDLHSQTMLLNGN L+V+SSG IP ++
Sbjct  473  HRSHKSHKSKVIQQPQRSTSGITREEYHLTAKDGDLHSQTMLLNGNILTVNSSGDIPSLE  532

Query  362  PRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            P ++NSS+PI VAPFSIVF  +PYV LPAC
Sbjct  533  PLHVNSSKPIMVAPFSIVFVQMPYV-LPAC  561



>ref|XP_006381082.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58879.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=554

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 160/210 (76%), Gaps = 8/210 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  345  LDQLGMASAYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSG  404

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAY HCAKQS GITLLLINLD++TTVE  V +N ++  H+KH  H +H  H  H  
Sbjct  405  TKKIRAYTHCAKQSKGITLLLINLDNSTTVEVTVTFNSTWRLHQKHKPHRSHKLHKPHRS  464

Query  521  shgkGSPRSQ-----KRGT--MTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMK  363
                 S +S+     +R T  +TREEYHLTAK GDLHSQTMLLNGN L+V+SSG IP ++
Sbjct  465  HRSHKSHKSKVIQQPQRSTSGITREEYHLTAKDGDLHSQTMLLNGNILTVNSSGDIPSLE  524

Query  362  PRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            P ++NSS+PI VAPFSIVF  +PYV LPAC
Sbjct  525  PLHVNSSKPIMVAPFSIVFVQMPYV-LPAC  553



>ref|XP_006453123.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
 ref|XP_006474380.1| PREDICTED: heparanase-like protein 3-like [Citrus sinensis]
 gb|ESR66363.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
Length=547

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 149/203 (73%), Gaps = 11/203 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG
Sbjct  355  LDQLGMAAAHDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  414

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+YAHCAKQS G+ LLLINLD++TTV A+VA+NG+     KH              
Sbjct  415  TKKIRSYAHCAKQSKGLVLLLINLDNSTTVHASVAFNGTLTSRHKHKSLKMKIIKL----  470

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P++   G   REEYHLTAK GDLHSQTMLLNGN LSV+S G IP ++P  + S+
Sbjct  471  ------PQASVGGN-EREEYHLTAKDGDLHSQTMLLNGNILSVNSIGDIPTLEPLRVKST  523

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +P++V PFSIVF H+P+V LPAC
Sbjct  524  QPVSVGPFSIVFVHMPHVILPAC  546



>gb|KDO73428.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=547

 Score =   251 bits (640),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 149/203 (73%), Gaps = 11/203 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG
Sbjct  355  LDQLGMAAAHDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  414

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+YAHCAKQS G+ LLLINLD++TTV A+VA+NG+     KH              
Sbjct  415  TKKIRSYAHCAKQSKGLVLLLINLDNSTTVHASVAFNGTLTSRHKHKSLKMKIIKL----  470

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P++   G   REEYHLTAK GDLHSQTMLLNGN LSV+S G IP ++P  + S+
Sbjct  471  ------PQASVGGN-EREEYHLTAKDGDLHSQTMLLNGNILSVNSIGDIPTLEPLRVKST  523

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +P++V PFSIVF H+P+V LPAC
Sbjct  524  QPVSVGPFSIVFVHMPHVILPAC  546



>gb|KDO73427.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=554

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 149/203 (73%), Gaps = 11/203 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG
Sbjct  362  LDQLGMAAAHDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  421

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+YAHCAKQS G+ LLLINLD++TTV A+VA+NG+     KH              
Sbjct  422  TKKIRSYAHCAKQSKGLVLLLINLDNSTTVHASVAFNGTLTSRHKHKSLKMKIIKL----  477

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P++   G   REEYHLTAK GDLHSQTMLLNGN LSV+S G IP ++P  + S+
Sbjct  478  ------PQASVGGN-EREEYHLTAKDGDLHSQTMLLNGNILSVNSIGDIPTLEPLRVKST  530

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +P++V PFSIVF H+P+V LPAC
Sbjct  531  QPVSVGPFSIVFVHMPHVILPAC  553



>ref|XP_009358543.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 145/204 (71%), Gaps = 8/204 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       +TYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG
Sbjct  347  LDQLGMSATYDTRTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GIT+LLINL + T +EA VA+N ++    KH  H  H        
Sbjct  407  PKKIRAYAHCAKQSKGITVLLINLHNTTAIEARVAFNTTWTLRHKHKSHKLHRSQVAKL-  465

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R   R +  REEYHLTAK G++ SQTMLLNGN L VDSSG+IP + P Y+N+S
Sbjct  466  -------RQGLRSSTEREEYHLTAKDGNIQSQTMLLNGNALRVDSSGTIPSLNPVYVNAS  518

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI V P SIVFAHIPYV  PACR
Sbjct  519  EPILVGPSSIVFAHIPYVVPPACR  542



>ref|XP_009338385.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 145/204 (71%), Gaps = 8/204 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       +TYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG
Sbjct  347  LDQLGMSATYDTRTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GIT+LLINL + T +EA VA+N ++    KH  H  H        
Sbjct  407  PKKIRAYAHCAKQSKGITVLLINLHNTTAIEARVAFNTTWTLRHKHKSHKLHRSQVAKL-  465

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R   R +  REEYHLTAK G++ SQTMLLNGN L VDSSG+IP + P Y+N+S
Sbjct  466  -------RQGLRSSTEREEYHLTAKDGNIQSQTMLLNGNALRVDSSGTIPSLNPVYVNAS  518

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI V P SIVFAHIPYV  PACR
Sbjct  519  EPILVGPSSIVFAHIPYVVPPACR  542



>ref|XP_007203617.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
 gb|EMJ04816.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
Length=542

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 142/198 (72%), Gaps = 21/198 (11%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQTLIGGNYGLLNTTT+ PNPDYYSALLWHRLMGRN L+TSFSG KKIRAYAHCAK
Sbjct  360  KTYCRQTLIGGNYGLLNTTTYEPNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAHCAK  419

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQ--  492
            QS GIT+LLINL + TTVEA VA+N S+                         S R+Q  
Sbjct  420  QSKGITVLLINLQNTTTVEARVAFNTSWT---------------LRHKHKSHKSHRAQLK  464

Query  491  ----KRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  324
                 R    REEYHLTAK G+L SQTMLLNGN L+++SSG IP + P Y+NSSEPI V 
Sbjct  465  FHQGLRSETVREEYHLTAKDGNLQSQTMLLNGNALTLNSSGIIPNLDPVYVNSSEPILVG  524

Query  323  PFSIVFAHIPYVFLPACR  270
            P SIVFAHIPYV LPACR
Sbjct  525  PSSIVFAHIPYVVLPACR  542



>ref|XP_008457259.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3 [Cucumis 
melo]
Length=538

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 150/205 (73%), Gaps = 10/205 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+  F+G
Sbjct  343  LDQLGMAAAYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLTAGFNG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T+KIRAYAHC+KQS GITLLL+NLD NTTV A +A+N +            HH H  H H
Sbjct  403  TEKIRAYAHCSKQSKGITLLLLNLDGNTTVHAEIAFNRA---------RGLHHKHRSHKH  453

Query  521  shgkGSPRSQK-RGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                  PR     G   REEYHLTAK G+LHSQT+LLNGN LSV+SSG+IP ++P+++NS
Sbjct  454  KSNARIPRPHGLEGEAFREEYHLTAKDGNLHSQTVLLNGNILSVNSSGNIPPLEPQHVNS  513

Query  344  SEPITVAPFSIVFAHIPYVFLPACR  270
            SEPI VAPFSIVF HIP + LPACR
Sbjct  514  SEPIMVAPFSIVFIHIPNIVLPACR  538



>ref|XP_008336960.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 144/204 (71%), Gaps = 8/204 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG
Sbjct  347  LDQLGMSATYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GIT+LLINL + T +EA VA+N ++    KH  H  H  H     
Sbjct  407  PKKIRAYAHCAKQSKGITVLLINLHNTTAIEARVAFNATWTLRHKHKSHKLHRSHVAKL-  465

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     +  REEYHLTAK G + SQTMLLNGN L VDSSG+IP + P Y+N+S
Sbjct  466  -------RQGLESSTEREEYHLTAKDGXIQSQTMLLNGNALRVDSSGTIPSLNPVYVNAS  518

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI V P SIVFAHIPYV  PACR
Sbjct  519  EPIVVGPSSIVFAHIPYVVPPACR  542



>ref|XP_008242878.1| PREDICTED: heparanase-like protein 3 [Prunus mume]
Length=542

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 142/198 (72%), Gaps = 21/198 (11%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQTLIGGNYGLLNTTT+ PNPDYYSALLWHRLMGRN L+TSFSG KKIRAYAHCAK
Sbjct  360  KTYCRQTLIGGNYGLLNTTTYEPNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAHCAK  419

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQ--  492
            QS GIT+LLINL + TTVEA VA+N S+                         S R+Q  
Sbjct  420  QSKGITVLLINLQNTTTVEARVAFNTSWT---------------LRHKHKSHRSHRAQLK  464

Query  491  ----KRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVA  324
                 R    REEYHLTAK G+L SQTMLLNGN L+++SSG IP + P Y+NSSEPI V 
Sbjct  465  FHQGLRSETVREEYHLTAKDGNLQSQTMLLNGNALTLNSSGIIPNLDPVYVNSSEPILVG  524

Query  323  PFSIVFAHIPYVFLPACR  270
            P SIVFAHIPYV LPACR
Sbjct  525  PSSIVFAHIPYVVLPACR  542



>ref|XP_009363939.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 144/204 (71%), Gaps = 8/204 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN L+TSFSG
Sbjct  347  LDQLGMSASYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLATSFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GIT+LLINL + TT EA VA+N ++            H  H    
Sbjct  407  PKKIRAYAHCAKQSKGITVLLINLHNTTTAEARVAFNTTWT----LRHKHKSHKPHRSHV  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +  +  PRS    +  REEYHLT K G++ SQTMLLNGN L VDSSG IP + P Y+N+S
Sbjct  463  TKLQQGPRS----STEREEYHLTPKDGNIQSQTMLLNGNALRVDSSGIIPSLNPVYVNAS  518

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI V P SIVFAHIPYV  PACR
Sbjct  519  EPILVGPSSIVFAHIPYVVPPACR  542



>ref|XP_011457618.1| PREDICTED: heparanase-like protein 3 [Fragaria vesca subsp. vesca]
Length=559

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTL+GGNYGLLNTTTFVPNPDYYSALLWHRLMGRN L+T F G
Sbjct  358  LDQLGMSAVYDTKTYCRQTLVGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLATRFGG  417

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAY HCAKQS GI +LLINL + T V+A VA+N ++    +H  H ++  H    +
Sbjct  418  PKKIRAYTHCAKQSKGIVVLLINLHNTTVVQARVAFNSTWSLRHRHKSHKSYRSHMKELN  477

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 + R   RG   REEYHLT K G++ SQTMLLNGN L++DSSG+IP ++P ++NSS
Sbjct  478  GLRSRAERV--RGDREREEYHLTPKDGNIQSQTMLLNGNALNLDSSGNIPTLEPVFVNSS  535

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PI VAPFSIVF HIPYV  PACR
Sbjct  536  QPIIVAPFSIVFVHIPYVVPPACR  559



>ref|XP_006389405.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
 gb|ERP48319.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
Length=547

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 147/203 (72%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  353  LDQLGMASSYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSG  412

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAY HCAKQS GITLLLINLDS+TTV+ NV +N +   HRKH  H +H        
Sbjct  413  TKKIRAYTHCAKQSKGITLLLINLDSSTTVDVNVKFNSTLGLHRKHKTHRSHETKVIRLL  472

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                          +TREEYHLTAK GDLHS+ MLLNGN L+V+SSG IP  +P  +NSS
Sbjct  473  EGSTSE--------ITREEYHLTAKDGDLHSRIMLLNGNILTVNSSGDIPSFEPLLVNSS  524

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI VAPFSIVF  + YV LPAC
Sbjct  525  KPIMVAPFSIVFVQMSYV-LPAC  546



>ref|XP_002533671.1| heparanase, putative [Ricinus communis]
 gb|EEF28717.1| heparanase, putative [Ricinus communis]
Length=551

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 149/213 (70%), Gaps = 20/213 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LST+FSG
Sbjct  350  LDQLGMSAVYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTNFSG  409

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAK+S G+TLLLINLD++TTV+ +V  N               H  + H  
Sbjct  410  MKKIRAYAHCAKESKGVTLLLINLDNSTTVQVHVTLN----------TTATLHDKYRHHS  459

Query  521  shgkGSPRSQKRGTM---------TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPE  369
                 S RS +  T+         TREEYHLTAK G+LHSQTMLLNGN L V+SSG IP 
Sbjct  460  HRSFKSHRSHRTRTILLPKGSADSTREEYHLTAKDGNLHSQTMLLNGNILDVNSSGDIPT  519

Query  368  MKPRYLNSSEPITVAPFSIVFAHIPYVFLPACR  270
            ++P  +NSS+PITV PFSIVF H+PY  LPACR
Sbjct  520  LEPLRVNSSQPITVTPFSIVFVHLPYD-LPACR  551



>ref|XP_011020240.1| PREDICTED: heparanase-like protein 3 [Populus euphratica]
Length=559

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 156/208 (75%), Gaps = 7/208 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSFSG
Sbjct  353  LDQLGMASAYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFSG  412

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAY HCAKQS GITLLLINLD+ TTVE +V +N ++  H+KH  H +H  H HH  
Sbjct  413  TKKIRAYTHCAKQSKGITLLLINLDNITTVEVSVTFNSTWRLHQKHKPHRSHKLHKHHRS  472

Query  521  shgkGS-----PRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
                 S     P+    G +TREEYHLTAK GDLHSQTMLLNGN L+V+SSG IP ++P 
Sbjct  473  HKSHKSKVTHLPQRSTSG-ITREEYHLTAKDGDLHSQTMLLNGNILTVNSSGDIPYLEPL  531

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            ++NSS+PI VAPFSIVF  +PY   PAC
Sbjct  532  HVNSSKPIMVAPFSIVFVQMPYD-SPAC  558



>gb|AFK44771.1| unknown [Medicago truncatula]
Length=186

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 137/191 (72%), Gaps = 13/191 (7%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR  LST+FSGT KIRAYAHCAK
Sbjct  8    KTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRGVLSTTFSGTNKIRAYAHCAK  67

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQKR  486
            QS GIT+LLINLD++TTVEA  +   S +H +                         Q  
Sbjct  68   QSKGITILLINLDNSTTVEATFSDGKSSLHRKMPYYSRMMKLPL-------------QSS  114

Query  485  GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVF  306
               +REEYHLT +GG++HSQ MLLNGN LSV+S G IP +KP Y++SS+PI +APFSIVF
Sbjct  115  IEKSREEYHLTPQGGNIHSQVMLLNGNVLSVNSDGDIPPLKPLYVSSSKPIRIAPFSIVF  174

Query  305  AHIPYVFLPAC  273
            +HIP   + AC
Sbjct  175  SHIPDAVVSAC  185



>ref|XP_012081146.1| PREDICTED: heparanase-like protein 3 isoform X2 [Jatropha curcas]
Length=422

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 145/201 (72%), Gaps = 16/201 (8%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQ+LIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN L  +FSGTKKIRAYAHC K
Sbjct  229  KTYCRQSLIGGNYGLLNTATFVPNPDYYSALLWHRLMGRNVLLANFSGTKKIRAYAHCTK  288

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQK-  489
            +S GITLLLINLD++TTV+ NVA+NG+         H  H HH            RS K 
Sbjct  289  ESKGITLLLINLDNSTTVQVNVAFNGT------EKLHQKHWHHRSFRSHRSFRPHRSHKT  342

Query  488  --------RGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  333
                      + TREEYHLTAK  DLHSQTMLLNG  L+V+SSG IP ++P  +NSS PI
Sbjct  343  RIIQMHEGSASSTREEYHLTAKDRDLHSQTMLLNGKTLTVNSSGDIPILEPINVNSSTPI  402

Query  332  TVAPFSIVFAHIPYVFLPACR  270
             VAPFSIVFA++PY  +PACR
Sbjct  403  IVAPFSIVFANLPYD-IPACR  422



>gb|AFK40288.1| unknown [Lotus japonicus]
Length=529

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 145/204 (71%), Gaps = 13/204 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTF+PNPDYYSALLWHRLMGR+ LST+FSG
Sbjct  337  LDQLGMSASYDTKTYCRQTLIGGNYGLLNTTTFLPNPDYYSALLWHRLMGRSVLSTTFSG  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAY-NGSFVhhrkhirhinhhhhhhhs  525
            TKKIRAYAHCAKQS GI +LLINLDS+T +EA V   +  F+ HRK   +          
Sbjct  397  TKKIRAYAHCAKQSKGIIILLINLDSSTAIEAEVTLSDNKFLRHRKMADNSKLTEL----  452

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                   P     GT  REEYHLT  GGD+HSQ M+LNGN L+V+S+G IP ++P ++NS
Sbjct  453  -------PLRGASGT-AREEYHLTPGGGDIHSQIMVLNGNALTVNSAGDIPALEPLFVNS  504

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            S PITVAPFSIVFAHIP   + AC
Sbjct  505  SMPITVAPFSIVFAHIPDAVVAAC  528



>ref|XP_008385022.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 141/204 (69%), Gaps = 8/204 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TF PNPDYYSALLWHRLMGRN L+TSFSG
Sbjct  347  LDQLGMSASYDTKTYCRQTLIGGNYGLLNTXTFEPNPDYYSALLWHRLMGRNVLATSFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIRAYAHCAKQS GIT+LLINL + TT E  VA+N ++            H  H    
Sbjct  407  PKKIRAYAHCAKQSKGITVLLINLHNTTTAEVRVAFNTTWT----LRHKHKSHKPHRSHV  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +  +  PRS    +  REEYHLT K G++ SQTMLLNGN L VDSSG IP + P Y+N+S
Sbjct  463  TKLQQGPRS----STEREEYHLTPKDGNIQSQTMLLNGNALRVDSSGIIPSLNPVYVNAS  518

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI   P SIVFAHIPYV  PACR
Sbjct  519  EPILXGPSSIVFAHIPYVVPPACR  542



>ref|XP_007013614.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY31233.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=554

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 150/204 (74%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQ+LIGGNYGLLNT  FVPNPDYYSALLWH+LMGRN LSTSF+G
Sbjct  352  LDQLGMASKYDTKTYCRQSLIGGNYGLLNTANFVPNPDYYSALLWHQLMGRNVLSTSFAG  411

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCAKQS GITLLLINLD++TTV+A +A+N +     KH     HH H  H  
Sbjct  412  TKKIRSYTHCAKQSKGITLLLINLDNSTTVQAKLAFNSTMTLQHKHRSRTLHHKHRSHKK  471

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S  +    +     + REEYHLTAK G+LHSQTMLLNGN LSV+SSG IP ++P  +NS 
Sbjct  472  SIIQLPQGTDAE--IRREEYHLTAKDGNLHSQTMLLNGNILSVNSSGIIPPLEPLLVNSP  529

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PI VAP SIVF H+P V +PAC+
Sbjct  530  KPIMVAPLSIVFIHMPDVIVPACK  553



>gb|AAC62794.1| T2L5.6 gene product [Arabidopsis thaliana]
Length=190

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 133/191 (70%), Gaps = 9/191 (5%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSGTKKIR+Y HCA+
Sbjct  8    KTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSGTKKIRSYTHCAR  67

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQKR  486
            QS GIT+LL+NLD+ TTV A V  N SF                                
Sbjct  68   QSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLF---------GGPN  118

Query  485  GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVF  306
            G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+EPIT+AP+SIVF
Sbjct  119  GVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINSTEPITIAPYSIVF  178

Query  305  AHIPYVFLPAC  273
             H+  V +PAC
Sbjct  179  VHMRNVVVPAC  189



>ref|XP_007013613.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY31232.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=615

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 150/204 (74%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQ+LIGGNYGLLNT  FVPNPDYYSALLWH+LMGRN LSTSF+G
Sbjct  352  LDQLGMASKYDTKTYCRQSLIGGNYGLLNTANFVPNPDYYSALLWHQLMGRNVLSTSFAG  411

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCAKQS GITLLLINLD++TTV+A +A+N +     KH     HH H  H  
Sbjct  412  TKKIRSYTHCAKQSKGITLLLINLDNSTTVQAKLAFNSTMTLQHKHRSRTLHHKHRSHKK  471

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S  +    +     + REEYHLTAK G+LHSQTMLLNGN LSV+SSG IP ++P  +NS 
Sbjct  472  SIIQLPQGTDAE--IRREEYHLTAKDGNLHSQTMLLNGNILSVNSSGIIPPLEPLLVNSP  529

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PI VAP SIVF H+P V +PAC+
Sbjct  530  KPIMVAPLSIVFIHMPDVIVPACK  553



>ref|XP_003533856.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN48130.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 143/203 (70%), Gaps = 12/203 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTT F+PNPDYYSALLWHRLMGR+ LST+FSG
Sbjct  347  LDQLGMSAAYDTKTYCRQTLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRHVLSTTFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCAKQS GIT+LLINLDSNTTVEA V +N +           +  H    +H
Sbjct  407  TNKIRAYAHCAKQSKGITVLLINLDSNTTVEAEVTFNNA---------AKSLRHRKMSTH  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S     P + +     REEYHLT + GD+HSQ M+LNGN LSV S G IP ++P  +NSS
Sbjct  458  SKVMELPLASE---TAREEYHLTPQDGDIHSQIMVLNGNPLSVSSDGDIPPLEPINVNSS  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPI VAPFSIVFAH+P   + AC
Sbjct  515  EPIRVAPFSIVFAHLPDAVVSAC  537



>ref|XP_010533116.1| PREDICTED: heparanase-like protein 3 [Tarenaya hassleriana]
Length=547

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 143/204 (70%), Gaps = 4/204 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRNAL TSFSG
Sbjct  346  LDQLGMSSLYDTKTYCRQSLVGGNYGLLNTTNFTPNPDYYSALLWHRLMGRNALFTSFSG  405

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +KKIR+Y HCAKQS GIT+LL+NLD+ TTV+A V +NGS +                 + 
Sbjct  406  SKKIRSYTHCAKQSKGITVLLMNLDNTTTVQARVEFNGSSILRHTVHHRHGSKSSRKRAF  465

Query  521  shgkGSPRSQ-KRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                  PR    +G M REEYHLT K GDLHSQ++LLNGN LSV  +G +P ++PR ++S
Sbjct  466  PGL---PRPWVSKGLMGREEYHLTPKDGDLHSQSVLLNGNVLSVSPTGEMPSLEPRSVSS  522

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PITV+P SIVF H+P V  PAC
Sbjct  523  TDPITVSPLSIVFVHMPNVVAPAC  546



>ref|XP_003546578.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN37477.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 144/203 (71%), Gaps = 12/203 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR+ LST+FSG
Sbjct  347  LDQLGMSAAYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRHVLSTTFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCAKQS GIT+LLINLDSNTTVEA V +N +           +  H    SH
Sbjct  407  TNKIRAYAHCAKQSKGITVLLINLDSNTTVEAEVTFNNN---------AESLRHRKMSSH  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S     P + +     REEYHLT + GD+HSQTM+LNG  LSV+S G IP ++P Y+NSS
Sbjct  458  SKRMELPLASE---TAREEYHLTPQDGDIHSQTMVLNGKALSVNSDGDIPPLEPIYVNSS  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPI VA FSIVFAH+P   + AC
Sbjct  515  EPIRVAAFSIVFAHLPDAVVSAC  537



>ref|XP_012081145.1| PREDICTED: heparanase-like protein 3 isoform X1 [Jatropha curcas]
 gb|KDP30214.1| hypothetical protein JCGZ_16996 [Jatropha curcas]
Length=555

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 145/201 (72%), Gaps = 16/201 (8%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQ+LIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN L  +FSGTKKIRAYAHC K
Sbjct  362  KTYCRQSLIGGNYGLLNTATFVPNPDYYSALLWHRLMGRNVLLANFSGTKKIRAYAHCTK  421

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQK-  489
            +S GITLLLINLD++TTV+ NVA+NG+         H  H HH            RS K 
Sbjct  422  ESKGITLLLINLDNSTTVQVNVAFNGT------EKLHQKHWHHRSFRSHRSFRPHRSHKT  475

Query  488  --------RGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPI  333
                      + TREEYHLTAK  DLHSQTMLLNG  L+V+SSG IP ++P  +NSS PI
Sbjct  476  RIIQMHEGSASSTREEYHLTAKDRDLHSQTMLLNGKTLTVNSSGDIPILEPINVNSSTPI  535

Query  332  TVAPFSIVFAHIPYVFLPACR  270
             VAPFSIVFA++PY  +PACR
Sbjct  536  IVAPFSIVFANLPYD-IPACR  555



>gb|KHG18442.1| hypothetical protein F383_07597 [Gossypium arboreum]
Length=545

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 142/204 (70%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQ+LIGGNYGLL+T+TFVPNPDYYSALLWH+LMGRN LSTSF G
Sbjct  343  LDQLGMASKYDTKTYCRQSLIGGNYGLLDTSTFVPNPDYYSALLWHQLMGRNVLSTSFDG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y+HCAKQS GI +L INLD +TTV+A +A+N +      H              
Sbjct  403  TKKIRSYSHCAKQSEGIVVLFINLDKSTTVQAKLAFNSTMTLRHNHESRTLRIQRMSSKK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
               +          + REEYHLTAK G+L S+TMLLNGN L VDSSG+IP +KP Y+NS+
Sbjct  463  MIIELPQMVDAE--IRREEYHLTAKDGNLQSRTMLLNGNILGVDSSGNIPPLKPLYVNSA  520

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITV P SIVF H+  V LPAC+
Sbjct  521  KPITVEPLSIVFIHLSDVILPACK  544



>ref|XP_002324878.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
 gb|EEF03443.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
Length=563

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 142/209 (68%), Gaps = 18/209 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LST+FSG
Sbjct  365  LDQLGMASSYDTKTYCRQTLIGGNYGLLNTGTFVPNPDYYSALLWHRLMGRNVLSTTFSG  424

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEA-----NVAYNGSFVhhrkhirhinhhhh  537
            T  IRAYAHCAK S GITLLLINLD NTTVE      NV  NG+ V  +++    +    
Sbjct  425  TNNIRAYAHCAKASKGITLLLINLDGNTTVEVHVSTENVTGNGTLVTQQQNQTKFSGMS-  483

Query  536  hhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
                        +       TREEYHLTA  GDLHSQT+LLNGN LSV+SSGS+P ++P 
Sbjct  484  ------------KGSNIDVSTREEYHLTALNGDLHSQTVLLNGNILSVNSSGSVPPLEPI  531

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPACR  270
              + S+PITVAPFSIVFAHI    +PAC 
Sbjct  532  ETSQSDPITVAPFSIVFAHIANSTVPACE  560



>ref|XP_011017900.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
 ref|XP_011017901.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=547

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 144/203 (71%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LST  SG
Sbjct  353  LDQLGMASSYDTKTYCRQSLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTRSSG  412

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAY HCAKQS GITLLLINLDS+TTV+ NV +N +   HRKH  H +H        
Sbjct  413  TKKIRAYTHCAKQSKGITLLLINLDSSTTVDVNVKFNSTLGLHRKHKTHRSHETKVIRLL  472

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                          +TREEYHLTAK GDLHS+ MLLNGN L+V+SSG IP  +P  +NSS
Sbjct  473  EGSTSE--------ITREEYHLTAKDGDLHSRIMLLNGNILTVNSSGDIPSFEPLLVNSS  524

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI V P+SIVF  + YV LPAC
Sbjct  525  KPIVVGPYSIVFVQMSYV-LPAC  546



>ref|XP_008219534.1| PREDICTED: heparanase-like protein 3 isoform X1 [Prunus mume]
Length=535

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 136/204 (67%), Gaps = 17/204 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LSTSF G
Sbjct  349  LDQLGMSASYDTKTYCRQTLIGGNYGLLDTNTFVPNPDYYSALLWHRLMGNKVLSTSFPG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAYAHC+K++ GIT+LLINLDSNT V+  V+                         
Sbjct  409  TKKLRAYAHCSKKTQGITVLLINLDSNTKVQVRVS-----------------TESPGRLS  451

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R  K     REEYHLTAK GDLHS+ MLLNG  LSVDSSG+IP ++P  + SS
Sbjct  452  YLNFQGLRGSKGSQNVREEYHLTAKDGDLHSKVMLLNGKALSVDSSGNIPALEPITVGSS  511

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAPFSIVF HIP + +PAC+
Sbjct  512  DPITVAPFSIVFVHIPSIIVPACK  535



>ref|XP_007138475.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
 gb|ESW10469.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
Length=536

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 144/203 (71%), Gaps = 14/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGRN LST+FSG
Sbjct  347  LDQLGMSAAYNTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRNVLSTTFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TK IRAYAHCAKQS GIT+LLINLD NT+VEA+V ++ +                   SH
Sbjct  407  TKMIRAYAHCAKQSKGITVLLINLDGNTSVEADVTFDNN-----------AKSLRKMFSH  455

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S+    P + +     REEYHLT + G++HSQ M+LNG  L V+S+G IP + P Y+NSS
Sbjct  456  SNMMELPLASE---TAREEYHLTPQDGNIHSQIMVLNGKPLRVNSAGDIPPLDPIYVNSS  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPI VAPFSIVFAH+P+V + AC
Sbjct  513  EPINVAPFSIVFAHLPHVVVTAC  535



>ref|XP_010435392.1| PREDICTED: heparanase-like protein 3, partial [Camelina sativa]
Length=315

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 136/203 (67%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSG
Sbjct  121  LDQLGMSSVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSG  180

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV A V  N +F                    
Sbjct  181  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNNTFSLRHTKHMKSYKRETSQLP-  239

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    S   G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+
Sbjct  240  --------SDSNGEIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINST  291

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP SIVF H+  V +PAC
Sbjct  292  EPITIAPHSIVFVHMRSVVVPAC  314



>gb|KJB64649.1| hypothetical protein B456_010G059600 [Gossypium raimondii]
Length=545

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 141/204 (69%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQ+LIGGNYGLL+T+TFVPNPDYYSALLWHRLMGRN LSTSF G
Sbjct  343  LDQLGMASKYDTKTYCRQSLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGRNVLSTSFDG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCAKQS GI +L INLD +TTV+A +A+N +      H              
Sbjct  403  TKKIRSYTHCAKQSEGIMVLFINLDKSTTVQAKLAFNSTMTLRHNHESRTLRIQRMSSKK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
               +          + REEYHL AK G+L S+TMLLNGN LSVDSSG+IP ++P Y+NS+
Sbjct  463  MIIELPQMVDAE--IRREEYHLRAKDGNLQSRTMLLNGNILSVDSSGNIPPLEPLYVNSA  520

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITV P SIVF H+  V LPAC+
Sbjct  521  KPITVEPLSIVFIHLSDVILPACK  544



>ref|XP_009409980.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 143/209 (68%), Gaps = 15/209 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMGR  LST+ +G
Sbjct  351  LDQLGMSSTYDTKTYCRQSLIGGNYGLLNTTTFHPNPDYYSALLWHRLMGRRVLSTNITG  410

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTT-----VEANVAYNGSFVhhrkhirhinhhhh  537
            T KIRAYAHCA++S GITLLLINL  N +     V     Y+ +             H  
Sbjct  411  TNKIRAYAHCARESPGITLLLINLSGNNSTTPVFVTTQTVYSAAL----------KQHRR  460

Query  536  hhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
            H    +     PR  K    TREEYHLTAK GD+HSQT+LLNGN L+VDSSG+IPE++P 
Sbjct  461  HGAHRTRFNHIPRLGKTSEFTREEYHLTAKDGDIHSQTVLLNGNILAVDSSGNIPELEPV  520

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPACR  270
             + +++PITVAPFSIVFAHIPY + PACR
Sbjct  521  KVEATQPITVAPFSIVFAHIPYFYAPACR  549



>ref|XP_008801894.1| PREDICTED: heparanase-like protein 3 isoform X2 [Phoenix dactylifera]
Length=499

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 141/204 (69%), Gaps = 10/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L T+F+G
Sbjct  306  LDQLGMSSTYDTKSYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGSKVLPTNFTG  365

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TK IRAYAHCA++S GITLLLINL SNTT    V    +F          +    H+   
Sbjct  366  TKNIRAYAHCARESQGITLLLINLSSNTTTRVFVTTASAF----------SMASKHYIPR  415

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +     P  Q++    REEYHLTA  G+LHSQTMLLNGN LSVDS G+IP +KP  +++S
Sbjct  416  TRFNHVPGLQRKLGFIREEYHLTANKGNLHSQTMLLNGNILSVDSEGNIPTLKPIEVDAS  475

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PITVAPFSIVFAHIPY + PACR
Sbjct  476  LPITVAPFSIVFAHIPYFYAPACR  499



>ref|XP_006283483.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
 gb|EOA16381.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
Length=544

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 139/203 (68%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSG
Sbjct  350  LDQLGMASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRKLMGRKALFTSFSG  409

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+YAHCA+QS GIT+LL+NLD+ TTV A V  N +F                  S 
Sbjct  410  TKKIRSYAHCARQSKGITVLLMNLDNTTTVLAKVELNNTFSLRHTKHVKSYKRATSQLSW  469

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G + REEYHLTAK G+LHSQTMLLNGN L V+S G IP ++P ++NS+
Sbjct  470  ---------DSDGEVQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDIPPIEPIHINST  520

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP+SIVF H+P V +PAC
Sbjct  521  EPITIAPYSIVFVHMPSVVVPAC  543



>gb|EYU34947.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=549

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMG++ LSTSF+G
Sbjct  343  LDQLGASSTYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGKSVLSTSFTG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            ++KIRAYAHCAK+S GITLLLIN+D NTTV A V  +G  V  + H     HHH   H H
Sbjct  403  SRKIRAYAHCAKKSQGITLLLINIDGNTTVNAKVDIHGRVVRMQNHSNIHPHHHMPRHHH  462

Query  521  shgkGSP---RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYL  351
               KG+P     Q      REEYHLT  GGD+HSQT+LLNG +L+VDSSG IP + P  +
Sbjct  463  RRSKGTPLHHNKQVSANNVREEYHLTPLGGDIHSQTVLLNGKKLTVDSSGVIPALDPVTV  522

Query  350  NSSEPITVAPFSIVFAHIPYVFLPAC  273
            +S EP+ VAP+SIVF H+P   + AC
Sbjct  523  DSLEPLIVAPYSIVFVHMPNFDVSAC  548



>ref|XP_006852836.2| PREDICTED: heparanase-like protein 3 [Amborella trichopoda]
Length=537

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTT+ PNPDYYSALLWHRLMG   LST+F+ 
Sbjct  342  LDQLGMASNFNTKTYCRQSLIGGNYGLLNTTTYEPNPDYYSALLWHRLMGTRVLSTNFTA  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
              KIRAYAHCAK++ GITLLLINLD NTTV A V  + + ++  KH     H + +    
Sbjct  402  KSKIRAYAHCAKRTKGITLLLINLDGNTTVNARVTMDSAIINSSKHQNMFPHTNFNRM--  459

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  PR Q+   + REEYHLTAK GDLHSQTMLLNG  L V+  G IP M+P  +NSS
Sbjct  460  ------PRKQRATEIIREEYHLTAKDGDLHSQTMLLNGKILGVNQQGKIPRMEPIRVNSS  513

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPI VAPFSIVF H+P +  P C
Sbjct  514  EPIVVAPFSIVFVHMPLIHAPVC  536



>gb|KHG18266.1| hypothetical protein F383_21213 [Gossypium arboreum]
Length=519

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 150/204 (74%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRN LSTSF+G
Sbjct  315  LDQLGMASKYDTKTYCRQSLVGGNYGLLNTTNFEPNPDYYSALLWHRLMGRNVLSTSFTG  374

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIR+Y HCAKQS GITLLLINL+++TTV A +A+N S +  +   R    HH H    
Sbjct  375  TDKIRSYTHCAKQSKGITLLLINLNNSTTVRAKLAFN-STMSLQHKHRSRISHHKHKIHK  433

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +     P+    G + REEYHLTAKGG+L SQ++LLNGN LSV+SSG IP ++P ++ S+
Sbjct  434  TTIIKLPQGID-GKIRREEYHLTAKGGNLQSQSILLNGNILSVNSSGFIPHLEPLHVKSA  492

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PI VAP SIVF H+P V +PAC+
Sbjct  493  KPIMVAPLSIVFTHMPDVTVPACK  516



>gb|ERN14303.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
Length=544

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTT+ PNPDYYSALLWHRLMG   LST+F+ 
Sbjct  349  LDQLGMASNFNTKTYCRQSLIGGNYGLLNTTTYEPNPDYYSALLWHRLMGTRVLSTNFTA  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
              KIRAYAHCAK++ GITLLLINLD NTTV A V  + + ++  KH     H + +    
Sbjct  409  KSKIRAYAHCAKRTKGITLLLINLDGNTTVNARVTMDSAIINSSKHQNMFPHTNFNRM--  466

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  PR Q+   + REEYHLTAK GDLHSQTMLLNG  L V+  G IP M+P  +NSS
Sbjct  467  ------PRKQRATEIIREEYHLTAKDGDLHSQTMLLNGKILGVNQQGKIPRMEPIRVNSS  520

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPI VAPFSIVF H+P +  P C
Sbjct  521  EPIVVAPFSIVFVHMPLIHAPVC  543



>ref|XP_008801893.1| PREDICTED: heparanase-like protein 3 isoform X1 [Phoenix dactylifera]
Length=548

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 141/204 (69%), Gaps = 10/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L T+F+G
Sbjct  355  LDQLGMSSTYDTKSYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGSKVLPTNFTG  414

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TK IRAYAHCA++S GITLLLINL SNTT    V    +F          +    H+   
Sbjct  415  TKNIRAYAHCARESQGITLLLINLSSNTTTRVFVTTASAF----------SMASKHYIPR  464

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +     P  Q++    REEYHLTA  G+LHSQTMLLNGN LSVDS G+IP +KP  +++S
Sbjct  465  TRFNHVPGLQRKLGFIREEYHLTANKGNLHSQTMLLNGNILSVDSEGNIPTLKPIEVDAS  524

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PITVAPFSIVFAHIPY + PACR
Sbjct  525  LPITVAPFSIVFAHIPYFYAPACR  548



>ref|XP_010648741.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=567

 Score =   231 bits (588),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 143/205 (70%), Gaps = 19/205 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF+G
Sbjct  349  LDQLGMASSYGNKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFNG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAY+HC+KQS GITLLLINLD NTT+   V+                   +  ++ 
Sbjct  409  TKKIRAYSHCSKQSPGITLLLINLDGNTTLRVQVS-----------------TENDGNNR  451

Query  521  shgkGSPRSQKRGTM--TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
            +    S    +R     TREEYHLTAK G+LHSQT+LLNG  L+V+SSGSIP ++P  ++
Sbjct  452  TSTLQSKNQTQRSNFASTREEYHLTAKDGNLHSQTLLLNGKVLTVNSSGSIPPLEPISVS  511

Query  347  SSEPITVAPFSIVFAHIPYVFLPAC  273
            S +PITVAPFS+VFA  P V  PAC
Sbjct  512  SLDPITVAPFSVVFARFPDVNYPAC  536



>ref|XP_008219535.1| PREDICTED: heparanase-like protein 3 isoform X2 [Prunus mume]
Length=534

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 136/204 (67%), Gaps = 18/204 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LSTSF G
Sbjct  349  LDQLGMSASYDTKTYCRQTLIGGNYGLLDTNTFVPNPDYYSALLWHRLMGNKVLSTSFPG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAYAHC+K++ GIT+LLINLDSNT V+  V+                         
Sbjct  409  TKKLRAYAHCSKKT-GITVLLINLDSNTKVQVRVS-----------------TESPGRLS  450

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R  K     REEYHLTAK GDLHS+ MLLNG  LSVDSSG+IP ++P  + SS
Sbjct  451  YLNFQGLRGSKGSQNVREEYHLTAKDGDLHSKVMLLNGKALSVDSSGNIPALEPITVGSS  510

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAPFSIVF HIP + +PAC+
Sbjct  511  DPITVAPFSIVFVHIPSIIVPACK  534



>ref|XP_004139281.1| PREDICTED: heparanase-like protein 3 [Cucumis sativus]
Length=539

 Score =   229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 152/204 (75%), Gaps = 7/204 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMGRN LST F+G
Sbjct  343  LDQLGMAAAYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGRNVLSTGFNG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T+KIRAYAHC+KQS GITLLL+NLD N TV A +A+N +         H  H  + H S+
Sbjct  403  TEKIRAYAHCSKQSKGITLLLLNLDGNNTVHAGIAFNRT------TALHHKHRSNKHKSN  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  PR  + G   REEYHLTAK G+LHSQT+LLNGN LSV+SSG+IP ++P+++NSS
Sbjct  457  IVRIPRPRGLE-GEAFREEYHLTAKDGNLHSQTVLLNGNILSVNSSGNIPPLEPQHVNSS  515

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI VAPFSIVF HIP + LPACR
Sbjct  516  EPIMVAPFSIVFIHIPNIILPACR  539



>ref|NP_851092.1| glucuronidase 3 [Arabidopsis thaliana]
 gb|AED93922.1| glucuronidase 3 [Arabidopsis thaliana]
Length=401

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 136/203 (67%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSG
Sbjct  207  LDQLGMASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSG  266

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV A V  N SF                    
Sbjct  267  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLF-  325

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+
Sbjct  326  --------GGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINST  377

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP+SIVF H+  V +PAC
Sbjct  378  EPITIAPYSIVFVHMRNVVVPAC  400



>ref|XP_009355782.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=533

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 136/203 (67%), Gaps = 19/203 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TF PNPDYYSALLWHRLMG  ALSTSFSG
Sbjct  349  LDQLGLAASYDTKTYCRQTLIGGNYGLLDTNTFQPNPDYYSALLWHRLMGNKALSTSFSG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAYAHC+K++ GIT+LLINLDSNTTV+  V+ + +                     
Sbjct  409  TKKIRAYAHCSKKTKGITVLLINLDSNTTVQVRVSTDST-------------------GR  449

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 S +S K     REEYHLTA+ GDL S+ MLLNG  LSVDSSG IP ++P  +  S
Sbjct  450  PVSSESLQSSKDSDDVREEYHLTAQDGDLQSKVMLLNGKALSVDSSGDIPPLEPITVRLS  509

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +P TVAPFSIVF HIP   +PAC
Sbjct  510  DPTTVAPFSIVFVHIPNTTVPAC  532



>gb|KJB23650.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=546

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRN LSTSF+G
Sbjct  342  LDQLGMASKYDTKTYCRQSLVGGNYGLLNTTNFEPNPDYYSALLWHRLMGRNVLSTSFTG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIR+Y HCAKQS GITLLLINL+++TTV+A +A+N S +  R   R    H+ H    
Sbjct  402  TDKIRSYTHCAKQSKGITLLLINLNNSTTVQAKLAFN-STMSLRHKHRSRISHNKHRIHK  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +     P+    G + REEYHLTAK G+L SQ+MLLNGN LSV SSG IP ++P ++ S+
Sbjct  461  TTIIKLPQGID-GKIRREEYHLTAKDGNLQSQSMLLNGNILSVSSSGIIPHLEPLHVKSA  519

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PI VAP SIVF H+P V +PAC+
Sbjct  520  KPIMVAPLSIVFTHMPDVTVPACK  543



>gb|KJB23649.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=554

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQ+L+GGNYGLLNTT F PNPDYYSALLWHRLMGRN LSTSF+G
Sbjct  342  LDQLGMASKYDTKTYCRQSLVGGNYGLLNTTNFEPNPDYYSALLWHRLMGRNVLSTSFTG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIR+Y HCAKQS GITLLLINL+++TTV+A +A+N S +  R   R    H+ H    
Sbjct  402  TDKIRSYTHCAKQSKGITLLLINLNNSTTVQAKLAFN-STMSLRHKHRSRISHNKHRIHK  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +     P+    G + REEYHLTAK G+L SQ+MLLNGN LSV SSG IP ++P ++ S+
Sbjct  461  TTIIKLPQGID-GKIRREEYHLTAKDGNLQSQSMLLNGNILSVSSSGIIPHLEPLHVKSA  519

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PI VAP SIVF H+P V +PAC+
Sbjct  520  KPIMVAPLSIVFTHMPDVTVPACK  543



>ref|XP_010906003.1| PREDICTED: heparanase-like protein 3 [Elaeis guineensis]
Length=545

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 138/204 (68%), Gaps = 10/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  352  LDQLGMSSTYDTKSYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGSKVLSTNFTG  411

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TK IRAYAHCA++S GITLLLINL  NTT E  V    +F    KH       +H     
Sbjct  412  TKNIRAYAHCARESQGITLLLINLSGNTTTEVFVTTASAFAIASKHYIPRTRFNHV----  467

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P  Q+     REEYHLTA  G+LHSQTMLLNGN L VDS G IP +KP  +++S
Sbjct  468  ------PGFQRTLAFMREEYHLTAGDGNLHSQTMLLNGNILHVDSEGKIPTLKPIEVDAS  521

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PITV PFSIVFAHIPY + PACR
Sbjct  522  LPITVTPFSIVFAHIPYFYAPACR  545



>gb|ACJ85694.1| unknown [Medicago truncatula]
Length=176

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 130/182 (71%), Gaps = 13/182 (7%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR  LST+FSGT KIRAYAHCAK
Sbjct  8    KTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRGVLSTTFSGTNKIRAYAHCAK  67

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQKR  486
            QS GIT+LLINLD++TTVEA  +   S +H +                         Q  
Sbjct  68   QSKGITILLINLDNSTTVEATFSDGKSSLHRKMPYYSRMMKLPL-------------QSS  114

Query  485  GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVF  306
               +REEYHLT +GG++HSQ MLLNGN LSV+S G IP +KP Y++SS+PI + PFSIVF
Sbjct  115  IEKSREEYHLTPQGGNIHSQVMLLNGNVLSVNSDGDIPPLKPLYVSSSKPIRIVPFSIVF  174

Query  305  AH  300
             H
Sbjct  175  FH  176



>ref|XP_011036604.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=520

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 140/209 (67%), Gaps = 18/209 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LST+FSG
Sbjct  322  LDQLGMASSYDTKTYCRQTLIGGNYGLLNTGTFVPNPDYYSALLWHRLMGRNVLSTTFSG  381

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEA-----NVAYNGSFVhhrkhirhinhhhh  537
            T  IRAYAHCAK S GITLLLINLD NTTV+      NV  NG+ V  +++    +    
Sbjct  382  TNNIRAYAHCAKASKGITLLLINLDGNTTVKVHVANENVTSNGTLVTQQQNQTTFSGMS-  440

Query  536  hhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
                        R       TREEYHLTA  GDLH QT+LLNGN LSV+SSGS+P ++P 
Sbjct  441  ------------RGSNIDVSTREEYHLTALNGDLHCQTVLLNGNILSVNSSGSVPPLEPI  488

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPACR  270
              + S+PIT APFSIVFAH+    +PAC 
Sbjct  489  ETSQSDPITGAPFSIVFAHLANSTVPACE  517



>gb|KEH37925.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=537

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 140/203 (69%), Gaps = 13/203 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR  LST+FSG
Sbjct  347  LDQLGMSASYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRGVLSTTFSG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCAKQS GIT+LLINLD++TTVEA  +   S +H +                
Sbjct  407  TNKIRAYAHCAKQSKGITILLINLDNSTTVEATFSDGKSSLHRKMPYYSRMMKLPL----  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                     Q     +REEYHLT +GG++HSQ MLLNGN LSV+S G IP +KP Y++SS
Sbjct  463  ---------QSSIEKSREEYHLTPQGGNIHSQVMLLNGNVLSVNSDGDIPPLKPLYVSSS  513

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI +APFSIVF+HIP   + AC
Sbjct  514  KPIRIAPFSIVFSHIPDAVVSAC  536



>ref|XP_007224283.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
 gb|EMJ25482.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
Length=511

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 133/204 (65%), Gaps = 17/204 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   LSTSF G
Sbjct  325  LDQLGMSASYDTKTYCRQTLIGGNYGLLDTNTFVPNPDYYSALLWHRLMGNKVLSTSFPG  384

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAYAHC+K++ GIT+LLINLDSNT V+  V+                         
Sbjct  385  TKKLRAYAHCSKKTQGITVLLINLDSNTKVQVRVS-----------------TESPGKLS  427

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R  K     REEYHLTAK GDLHS+ MLLNG  LSVDSSG+IP ++P  + SS
Sbjct  428  YLNFQGLRGSKASQNVREEYHLTAKDGDLHSKVMLLNGKALSVDSSGNIPALEPITVGSS  487

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             P TVAP SIVF HIP + +PAC+
Sbjct  488  NPTTVAPLSIVFVHIPGITVPACK  511



>ref|XP_002283260.2| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=532

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 138/204 (68%), Gaps = 6/204 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF G
Sbjct  333  LDQLGMASSYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFYG  392

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T+KIRAYAHC+KQS GITLLLINLD NTTV+  V+   +        R            
Sbjct  393  TRKIRAYAHCSKQSPGITLLLINLDGNTTVQVQVSTENA------GNRTSTLQDTDKTQR  446

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S+     R  K     REEYHLTAK GDLHSQT+LLNG  L+++SS  +P ++P  ++S 
Sbjct  447  SNFSRMRRVSKIDASVREEYHLTAKDGDLHSQTLLLNGKVLTINSSRIVPPLEPIRVSSM  506

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +P+ VAPFSIVF   P +  PAC+
Sbjct  507  DPVIVAPFSIVFVRFPNINYPACK  530



>ref|XP_011081531.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=549

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 139/204 (68%), Gaps = 15/204 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTTT+VPNPDYYSALLWHRLMGR  LSTSF G
Sbjct  361  LDQLGMSSSYDTKTYCRQSLIGGNYGLLNTTTYVPNPDYYSALLWHRLMGRKVLSTSFVG  420

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCAK S G+TLLLINLD++T V+  ++        RK      +        
Sbjct  421  TNKIRAYAHCAKNSPGVTLLLINLDNSTAVQVGLSVENIVQQTRKTKFTSIY--------  472

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   +      M REEYHLT K GDLHSQTMLLNG  ++V+SSG IP ++PR ++ S
Sbjct  473  -------KHHTEFEMMREEYHLTPKDGDLHSQTMLLNGEIITVNSSGMIPPLEPRRVDLS  525

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPITVAPFSI+FA IP + LPAC+
Sbjct  526  EPITVAPFSILFARIPSIQLPACK  549



>ref|XP_011036603.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
Length=563

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 140/209 (67%), Gaps = 18/209 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMGRN LST+FSG
Sbjct  365  LDQLGMASSYDTKTYCRQTLIGGNYGLLNTGTFVPNPDYYSALLWHRLMGRNVLSTTFSG  424

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEA-----NVAYNGSFVhhrkhirhinhhhh  537
            T  IRAYAHCAK S GITLLLINLD NTTV+      NV  NG+ V  +++    +    
Sbjct  425  TNNIRAYAHCAKASKGITLLLINLDGNTTVKVHVANENVTSNGTLVTQQQNQTTFSGMS-  483

Query  536  hhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
                        R       TREEYHLTA  GDLH QT+LLNGN LSV+SSGS+P ++P 
Sbjct  484  ------------RGSNIDVSTREEYHLTALNGDLHCQTVLLNGNILSVNSSGSVPPLEPI  531

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPACR  270
              + S+PIT APFSIVFAH+    +PAC 
Sbjct  532  ETSQSDPITGAPFSIVFAHLANSTVPACE  560



>emb|CDY12398.1| BnaC08g08070D [Brassica napus]
Length=536

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 138/203 (68%), Gaps = 10/203 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W RLMGR AL TSFSG
Sbjct  343  LDQLGMASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRRLMGRKALFTSFSG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV ANV  N ++    +               
Sbjct  403  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVANVELNNTYKLRHRKTSQKIARTSQMPWV  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTAK G+LHSQTMLLNG+ L V+S G IP ++P ++NS+
Sbjct  463  ----------SDGETQREEYHLTAKDGNLHSQTMLLNGHALQVNSIGDIPPLEPIHVNST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PIT+AP+SIVF H+P V +PAC
Sbjct  513  DPITIAPYSIVFVHMPNVVVPAC  535



>ref|XP_009108062.1| PREDICTED: heparanase-like protein 3 [Brassica rapa]
Length=536

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 138/203 (68%), Gaps = 10/203 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W RLMGRNAL T+FSG
Sbjct  343  LDQLGMASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRRLMGRNALFTTFSG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV ANV  N ++    +               
Sbjct  403  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVANVELNNTYKLRHRKTSQKIARTSQMPWV  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTAK  +LHSQTMLLNG+ L V+S G IP ++P ++NS+
Sbjct  463  ----------SNGETQREEYHLTAKDANLHSQTMLLNGHALQVNSIGDIPPLEPIHVNST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PIT+AP+SIVF H+P V +PAC
Sbjct  513  DPITIAPYSIVFVHMPNVVVPAC  535



>emb|CDY47561.1| BnaA08g07260D [Brassica napus]
Length=536

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 138/203 (68%), Gaps = 10/203 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W RLMGRNAL T+FSG
Sbjct  343  LDQLGMASVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRRLMGRNALFTTFSG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV ANV  N ++    +               
Sbjct  403  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVANVELNNTYKLRHRKTSQKIARTSQMPWV  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTAK  +LHSQTMLLNG+ L V+S G IP ++P ++NS+
Sbjct  463  ----------SNGETQREEYHLTAKDANLHSQTMLLNGHALQVNSIGDIPPLEPIHVNST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PIT+AP+SIVF H+P V +PAC
Sbjct  513  DPITIAPYSIVFVHMPNVVVPAC  535



>ref|XP_010440690.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 138/203 (68%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSG
Sbjct  342  LDQLGMSSVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV A V  N +F          +         
Sbjct  402  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNNTFSLRHTKHMKSSKRATSQLP-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    S   G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+
Sbjct  461  --------SDSNGEIQREEYHLTAKDGNLHSQTMLLNGNPLQVNSMGDLPPIEPIHINST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP+SIVF H+  V +PAC
Sbjct  513  EPITIAPYSIVFVHMRSVVVPAC  535



>gb|EYU20239.1| hypothetical protein MIMGU_mgv1a026019mg [Erythranthe guttata]
Length=544

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 142/208 (68%), Gaps = 10/208 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLL+T T++PNPDYYSALLWHRLMGRN LSTSF G
Sbjct  343  LDQLGMSSSYDSKTYCRQSLIGGNYGLLDTNTYLPNPDYYSALLWHRLMGRNVLSTSFEG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAYAHC+K S GITL+LINLD  TTVE  V+   +F+                   
Sbjct  403  TKKIRAYAHCSKNSIGITLVLINLDKATTVEVGVSIE-NFI-----SNKTLTVEQIVEQT  456

Query  521  shgkGSPRSQKRG---TMTREEYHLTAKGGDLHSQTMLLNGNELSVD-SSGSIPEMKPRY  354
             +   + R +  G    M REEYHLTAK GDLHSQTMLLNG  + V+ SSG IP + PR 
Sbjct  457  RNTNPTSRYKHNGENEMMMREEYHLTAKDGDLHSQTMLLNGEIVKVNTSSGIIPPLVPRR  516

Query  353  LNSSEPITVAPFSIVFAHIPYVFLPACR  270
            + SSEPITVAPFSI+FA IP + +PAC+
Sbjct  517  VISSEPITVAPFSILFAQIPSIQVPACK  544



>ref|XP_004488517.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=536

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 136/203 (67%), Gaps = 13/203 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F+PNPDYYSALLWHRLMGR+ LST+FSG
Sbjct  346  LDQLGMSAAYDTKTYCRQSLIGGNYGLLNTTNFLPNPDYYSALLWHRLMGRHVLSTTFSG  405

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCAKQS GIT+LLINLD++T  E   +   S  H +                
Sbjct  406  TNKIRAYAHCAKQSKGITILLINLDNSTNFEVTYSNTKSLWHRKMSDNSKIMKLPL----  461

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                            REEYHLT + G++HSQ M+LNGN LS++S G IP ++P Y+NSS
Sbjct  462  ---------HSSSVTAREEYHLTPQDGNIHSQIMVLNGNVLSINSDGDIPPLEPLYVNSS  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITVAPFSIVF+HIP   +PAC
Sbjct  513  KPITVAPFSIVFSHIPDAVVPAC  535



>ref|XP_009393723.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=548

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 135/204 (66%), Gaps = 27/204 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG+  L T+F+G
Sbjct  372  LDQLGMSSTYNTKTYCRQSLVGGNYGLLNTTTFHPNPDYYSALLWHRLMGKQVLRTNFTG  431

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            ++  RAY+HCAK+S GITLLLINL  NTT E  V    ++                    
Sbjct  432  SRMTRAYSHCAKESQGITLLLINLSGNTTTEVFVTTKTAY--------------------  471

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    + K    TREEYHLTAK GD+HSQTMLLNG+ L+VDS G IPE++P  + +S
Sbjct  472  -------SALKTAESTREEYHLTAKDGDIHSQTMLLNGHILAVDSDGHIPELEPVKVAAS  524

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPITV PFSIVFAHIPY   PACR
Sbjct  525  EPITVDPFSIVFAHIPYFHAPACR  548



>ref|XP_008394121.1| PREDICTED: heparanase-like protein 3 isoform X2 [Malus domestica]
Length=533

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 134/203 (66%), Gaps = 19/203 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TF PNPDYYSALLWHRLMG  ALSTSFSG
Sbjct  349  LDQLGLAASYDTKTYCRQTLIGGNYGLLDTNTFQPNPDYYSALLWHRLMGNKALSTSFSG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAYAHC+K++ GIT+LLINLD NTTV+  V+ + +                     
Sbjct  409  TKKIRAYAHCSKKTKGITVLLINLDGNTTVQVRVSTDST-------------------GR  449

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 S +S K     REEYHLTA+ GDL S+ MLLNG  L VDSSG IP ++P  +  S
Sbjct  450  PVSSESLQSSKDSDDVREEYHLTAQDGDLQSKVMLLNGKALIVDSSGDIPPLEPITVRLS  509

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +P TVAPFSIVF H+P   +PAC
Sbjct  510  DPTTVAPFSIVFVHVPNTTVPAC  532



>ref|NP_851093.1| glucuronidase 3 [Arabidopsis thaliana]
 sp|Q9FZP1.2|HPSE3_ARATH RecName: Full=Heparanase-like protein 3; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAF01139.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93923.1| glucuronidase 3 [Arabidopsis thaliana]
Length=536

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 136/203 (67%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSG
Sbjct  342  LDQLGMASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV A V  N SF                    
Sbjct  402  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLF-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+
Sbjct  461  --------GGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP+SIVF H+  V +PAC
Sbjct  513  EPITIAPYSIVFVHMRNVVVPAC  535



>ref|XP_002870409.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH46668.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=536

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 137/203 (67%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSG
Sbjct  342  LDQLGMASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV A V  N +F                    
Sbjct  402  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNKTFSLRHTKHMKSYKRATSQLP-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G + REEYHLTAK G+LHSQTMLLNGN L V+S+G +P ++P ++NS+
Sbjct  461  --------QDPNGEIQREEYHLTAKDGNLHSQTMLLNGNALQVNSTGDLPPIEPIHINST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP+SIVF H+  V +PAC
Sbjct  513  EPITIAPYSIVFVHMRSVVVPAC  535



>dbj|BAB10787.1| unnamed protein product [Arabidopsis thaliana]
Length=536

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 136/203 (67%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL T+FSG
Sbjct  342  LDQLGMASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLD+ TTV A V  N SF                    
Sbjct  402  TKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLF-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G + REEYHLTAK G+LHSQTMLLNGN L V+S G +P ++P ++NS+
Sbjct  461  --------GGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP+SIVF H+  V +PAC
Sbjct  513  EPITIAPYSIVFVHMRNVVVPAC  535



>ref|XP_003609474.1| Heparanase-like protein [Medicago truncatula]
 gb|AES91671.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=529

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 134/203 (66%), Gaps = 25/203 (12%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       +TYCRQTLIGGNYGLLNTTTF+PNPDYYSALLWHRLMG   LST+F G
Sbjct  351  LDQLGMSATYGTRTYCRQTLIGGNYGLLNTTTFMPNPDYYSALLWHRLMGGRVLSTTFYG  410

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR YAHCAK+S GIT+L +NLD++TTV+A VA N                       
Sbjct  411  TKKIRTYAHCAKESKGITILFLNLDNSTTVQARVALN-----------------------  447

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P     G   R EYHLTAK G+LHSQTM+LNGN LS +S+G IP + P Y++SS
Sbjct  448  --FAKKPSPHNVGESQRREYHLTAKDGNLHSQTMVLNGNILSGNSAGDIPSLNPIYVDSS  505

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITV P SIVFAHIP   + AC
Sbjct  506  KPITVRPLSIVFAHIPDAAVKAC  528



>ref|XP_008394120.1| PREDICTED: heparanase-like protein 3 isoform X1 [Malus domestica]
Length=563

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 134/203 (66%), Gaps = 19/203 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TF PNPDYYSALLWHRLMG  ALSTSFSG
Sbjct  379  LDQLGLAASYDTKTYCRQTLIGGNYGLLDTNTFQPNPDYYSALLWHRLMGNKALSTSFSG  438

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIRAYAHC+K++ GIT+LLINLD NTTV+  V+ + +                     
Sbjct  439  TKKIRAYAHCSKKTKGITVLLINLDGNTTVQVRVSTDST-------------------GR  479

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 S +S K     REEYHLTA+ GDL S+ MLLNG  L VDSSG IP ++P  +  S
Sbjct  480  PVSSESLQSSKDSDDVREEYHLTAQDGDLQSKVMLLNGKALIVDSSGDIPPLEPITVRLS  539

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +P TVAPFSIVF H+P   +PAC
Sbjct  540  DPTTVAPFSIVFVHVPNTTVPAC  562



>ref|XP_010450341.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 136/203 (67%), Gaps = 9/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSG
Sbjct  342  LDQLGMSSVYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LLINLD+ TT+   V  N +F               +    
Sbjct  402  TKKIRSYTHCARQSKGITVLLINLDNTTTIVTKVELNNTFSLRHTKHMKSYKRATYQLP-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    S   G + REEYHLTAK G+LHSQTM LNGN L V+S G +P ++P ++NS+
Sbjct  461  --------SDSNGEIQREEYHLTAKDGNLHSQTMQLNGNALQVNSMGDLPPIEPIHINST  512

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPIT+AP+SIVF H+  V +PAC
Sbjct  513  EPITIAPYSIVFVHMRTVVVPAC  535



>ref|XP_007011804.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY29423.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=513

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 137/204 (67%), Gaps = 5/204 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TFVP+PDYYSALLWHRLMG N LSTSFSG
Sbjct  313  LDQLGMASSYDTKTYCRQTLIGGNYGLLDTATFVPHPDYYSALLWHRLMGSNVLSTSFSG  372

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T+ +RAYAHC+KQS GI LLLINL +NTTV+  V+              +          
Sbjct  373  TRNLRAYAHCSKQSQGIALLLINLSANTTVQVRVS-----TESPASNGDVRLQQEDQTPR  427

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             +    PR+ K    TREEYHLTAK G+LHS+ +LLNG  LS++SSG IP M P   +  
Sbjct  428  INFATMPRNSKSNGNTREEYHLTAKDGNLHSKIVLLNGKVLSLNSSGGIPSMDPVNRSML  487

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PITVAPFS+VF+HIP + +PAC+
Sbjct  488  APITVAPFSVVFSHIPSIRIPACK  511



>ref|XP_006483406.1| PREDICTED: heparanase-like protein 3-like isoform X1 [Citrus 
sinensis]
Length=561

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 137/210 (65%), Gaps = 17/210 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMG N LSTS SG
Sbjct  359  LDQLGMASIYGTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGSNVLSTSLSG  418

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEA-------NVAYNGSFVhhrkhirhinhh  543
            T KIRAYAHC+KQS G TLLLINLD NT           N+A NG+ V            
Sbjct  419  TTKIRAYAHCSKQSQGTTLLLINLDGNTAARVRVTISRENLAGNGALV---------VQQ  469

Query  542  hhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMK  363
               +      K S  ++  G M REEYHLTA+ GDLHSQTMLLNG  L+V+SS   P ++
Sbjct  470  EQQNQRKRFAKISQDTKTNGKM-REEYHLTARDGDLHSQTMLLNGEILAVNSSEDFPPLE  528

Query  362  PRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            P Y++ + PI VAPFSIVFA IP   LPAC
Sbjct  529  PIYVSETAPIIVAPFSIVFAEIPSSVLPAC  558



>ref|XP_007011803.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY29422.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=549

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 137/204 (67%), Gaps = 5/204 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TFVP+PDYYSALLWHRLMG N LSTSFSG
Sbjct  349  LDQLGMASSYDTKTYCRQTLIGGNYGLLDTATFVPHPDYYSALLWHRLMGSNVLSTSFSG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T+ +RAYAHC+KQS GI LLLINL +NTTV+  V+              +          
Sbjct  409  TRNLRAYAHCSKQSQGIALLLINLSANTTVQVRVS-----TESPASNGDVRLQQEDQTPR  463

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             +    PR+ K    TREEYHLTAK G+LHS+ +LLNG  LS++SSG IP M P   +  
Sbjct  464  INFATMPRNSKSNGNTREEYHLTAKDGNLHSKIVLLNGKVLSLNSSGGIPSMDPVNRSML  523

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PITVAPFS+VF+HIP + +PAC+
Sbjct  524  APITVAPFSVVFSHIPSIRIPACK  547



>ref|XP_006403100.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
 gb|ESQ44553.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
Length=529

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 140/213 (66%), Gaps = 28/213 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W  LMGR AL TSFSG
Sbjct  334  LDQLGMASIYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRTLMGRKALFTSFSG  393

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KKIR+Y HCA+QS GIT+LL+NLD+ TTV A V  N +F                  S 
Sbjct  394  IKKIRSYTHCARQSKGITVLLMNLDNTTTVVATVELNNTF------------------SL  435

Query  521  shgkGSPRSQKR----------GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIP  372
             H K    SQKR          G + REEYHLTA  G+LHSQTMLLNGN L + S+G IP
Sbjct  436  RHAKHRKSSQKREISQLPWVSNGEIQREEYHLTAMDGNLHSQTMLLNGNALQISSTGDIP  495

Query  371  EMKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             ++P ++NS+EPIT+AP+SIVF H+  V +PAC
Sbjct  496  PLEPIHVNSTEPITIAPYSIVFVHMRTVVVPAC  528



>ref|XP_011078541.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=537

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 140/204 (69%), Gaps = 8/204 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  342  LDQLGLASTYDTKTYCRQTLIGGNYGLLNTTTFAPNPDYYSALLWHRLMGTYVLSTNFTG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             + IRAYAHCAKQS G+TLLLIN+D NTTV A V +NG+    RKH  H +         
Sbjct  402  NRTIRAYAHCAKQSQGVTLLLINIDGNTTVHAKVDFNGTLTRLRKHRHHRHRSTATPLH-  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    +++     REEYHLT   G++ S+T+LLNG  L+V+SSG IP ++P  +NSS
Sbjct  461  -------HNKQVSGKVREEYHLTPADGNIQSRTILLNGKALTVNSSGLIPVLEPVRVNSS  513

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPI VAP+SIVF H+P   +PACR
Sbjct  514  EPIMVAPYSIVFVHMPNAAVPACR  537



>gb|KFK22707.1| hypothetical protein AALP_AAs49083U000200 [Arabis alpina]
Length=535

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNTT F PNPDYYSAL+W +LMGR AL TSFSG
Sbjct  340  LDQLGMASIYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTSFSG  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+Y HCA+QS GIT+LL+NLDS TTV+ NV  N S    R      +         
Sbjct  400  TKKIRSYTHCARQSKGITVLLMNLDSTTTVKVNVELNSSTFSLRHTKHRKSRKTVISQLP  459

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G + REEYHLTAK G+LHSQ+MLLN   L V+S+G IP ++P ++NS+
Sbjct  460  WV--------SNGEIQREEYHLTAKDGNLHSQSMLLNEYILHVNSAGDIPPLEPIFVNST  511

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EPITVAP+SIVF H+  V +PAC
Sbjct  512  EPITVAPYSIVFVHMRSVVVPAC  534



>ref|XP_006450373.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
 gb|ESR63613.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
Length=551

 Score =   220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 137/210 (65%), Gaps = 17/210 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWH LMG N LSTS +G
Sbjct  349  LDQLGMASIYGTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHWLMGSNVLSTSLAG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEA-------NVAYNGSFVhhrkhirhinhh  543
            T KIRAYAHC+KQS G TLLLINLD NTT          N+A NG+ V            
Sbjct  409  TTKIRAYAHCSKQSQGTTLLLINLDGNTTARVRVTISRENLAGNGALV---------VQQ  459

Query  542  hhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMK  363
               +      K    ++  G M REEYHLTA+ GDLHSQT+LLNG  L+V+SSG  P ++
Sbjct  460  EQQNQRKRFAKICQDTKTNGKM-REEYHLTARDGDLHSQTVLLNGEILAVNSSGDFPPLE  518

Query  362  PRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            P Y++ + PI VAPFSIVFA IP   LPAC
Sbjct  519  PIYVSETAPIIVAPFSIVFAEIPSSVLPAC  548



>ref|XP_010927354.1| PREDICTED: heparanase-like protein 3 isoform X2 [Elaeis guineensis]
Length=463

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 135/205 (66%), Gaps = 10/205 (5%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG       K+YCRQ+L+GGNYGLLN  TF PNPDYYSALLWHRLMG   LS  F+
Sbjct  269  FLDQLGMSSTYNTKSYCRQSLVGGNYGLLNRMTFQPNPDYYSALLWHRLMGSKVLSAKFT  328

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT+ IRAYAHCA++S GITLLLINL  NTT +A V    ++    KH       +H    
Sbjct  329  GTESIRAYAHCARESQGITLLLINLSGNTTSQAFVTTASNYTIGLKHHIPRTRFNHIT--  386

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                    R +K  T  REEYHLTAK G+LHSQ MLLNGN LS+DS G+IP  +P  L++
Sbjct  387  --------RLRKTATFMREEYHLTAKDGNLHSQVMLLNGNILSLDSEGNIPTFEPMELDA  438

Query  344  SEPITVAPFSIVFAHIPYVFLPACR  270
            S PITV PFSIVF HIP+   PACR
Sbjct  439  SLPITVTPFSIVFVHIPHFDAPACR  463



>ref|XP_002515478.1| heparanase, putative [Ricinus communis]
 gb|EEF46927.1| heparanase, putative [Ricinus communis]
Length=527

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 136/205 (66%), Gaps = 8/205 (4%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMG NAL+TSFSG
Sbjct  324  LDQLGMASSFNTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGTNALATSFSG  383

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYN--GSFVhhrkhirhinhhhhhhh  528
            TKK+RAYAHC+K + GITLLLINLD NT+ E  ++    GS V                 
Sbjct  384  TKKMRAYAHCSKATQGITLLLINLDGNTSFEVRISTENVGSNVTWTMQDHSNRGEKFARM  443

Query  527  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
            S           K   +TR+EYHLTAK GDLHSQT+LLNG  L+ DSSG+IP ++P   +
Sbjct  444  SRGSV------SKLYEITRDEYHLTAKDGDLHSQTVLLNGKILTPDSSGAIPSLEPIKAS  497

Query  347  SSEPITVAPFSIVFAHIPYVFLPAC  273
               PI VAPFSIVFA I  + +PAC
Sbjct  498  LLNPIAVAPFSIVFAQIANITVPAC  522



>ref|XP_008793957.1| PREDICTED: heparanase-like protein 3 [Phoenix dactylifera]
Length=411

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 134/203 (66%), Gaps = 10/203 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K+YCRQ+L+GGNYGLLNT TF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  218  LDQLGMSSTYNTKSYCRQSLVGGNYGLLNTATFHPNPDYYSALLWHRLMGSKVLSTNFTG  277

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TK IRAYAHCA++S GITLLLINL   TT +  V    +F    KH       +H     
Sbjct  278  TKSIRAYAHCARESLGITLLLINLSGKTTSQVFVTTASAFTLALKHHIPRTRFNHIT---  334

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R  +     REEYHLTAK G+LHSQ MLLNGN LSVDS G+ P +KP  +++S
Sbjct  335  -------RLGRTLAFMREEYHLTAKDGNLHSQAMLLNGNILSVDSEGNFPTLKPMEVDAS  387

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PITVAPFSIVF HIP+   PAC
Sbjct  388  LPITVAPFSIVFVHIPHFHAPAC  410



>emb|CDP13545.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 137/204 (67%), Gaps = 31/204 (15%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQTL+GGNYGLLNTTTFVPNPDYYSALLWHRLMGRN L+T+ + 
Sbjct  342  LDQLGMASSYDTKAYCRQTLVGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLATNLTA  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             K +RAYAHC+K S GIT+LLINLD+  TV+  +++                        
Sbjct  402  IKNLRAYAHCSKLSHGITVLLINLDAYATVQVGLSFT-----------------------  438

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R+    +M R+EYHLTAK G++HSQ +LLNG  LSVDSSG+IP ++PR +N S
Sbjct  439  -------RNNLDSSM-RKEYHLTAKHGNIHSQIVLLNGKILSVDSSGTIPPLEPRTVNPS  490

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PIT+APFSIVFA IP + +PAC+
Sbjct  491  DPITIAPFSIVFADIPNILVPACK  514



>ref|XP_002452991.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
 gb|EES05967.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
Length=540

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 131/203 (65%), Gaps = 12/203 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQT +GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  349  LDQLGMASKYDTKTYCRQTFVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCAK S GITLLLINLD N T    V   G+                     
Sbjct  409  TNKIRAYAHCAKNSEGITLLLINLDGNNTNHICVTSQGA------------QTQSARKES  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P   +   +TR+EYHLT KGG+L SQ MLLNGN L+ D++G IP+++P  +  +
Sbjct  457  RMSYQIPGLGEAAELTRQEYHLTPKGGNLQSQQMLLNGNVLATDANGDIPKLEPVQVEGT  516

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITV P+SIVFAHIP  + PAC
Sbjct  517  QPITVGPYSIVFAHIPSFYAPAC  539



>gb|EPS66918.1| hypothetical protein M569_07858, partial [Genlisea aurea]
Length=523

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 134/203 (66%), Gaps = 15/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGR  LSTSF+G
Sbjct  336  LDQLGMASLYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRQVLSTSFTG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR Y HC+K +GGIT+LL+NLD+ T V+ +++                       S 
Sbjct  396  TKKIRVYTHCSKSTGGITVLLMNLDNTTAVDVDLSVGNGVA---------------DQSF  440

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +  +          + REEYHL+AK GDLHSQT++LNG E+ V +S  IP +KP+ +   
Sbjct  441  AQLRIRESDATENKLMREEYHLSAKDGDLHSQTVILNGEEIHVINSSEIPHLKPKLVEPW  500

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +P+TVAP SIVFA IP + +PAC
Sbjct  501  DPLTVAPLSIVFAQIPTIKVPAC  523



>gb|EMT25528.1| Heparanase-like protein 3 [Aegilops tauschii]
Length=481

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 137/204 (67%), Gaps = 11/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  289  LDQLGMSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNG  348

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAY HCAK S GITLLLINL  N T    V   G+               H H + 
Sbjct  349  TNKIRAYTHCAKDSQGITLLLINLSGNNTNHIYVTSEGA-----------QEVTHPHVAK  397

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             H +  P+  +   + R+EYHLTAK G+L SQ MLLNGN L+  ++G+IP+++P  +  +
Sbjct  398  EHTRSIPKLGETAGLARQEYHLTAKDGNLQSQHMLLNGNVLATGANGAIPKLEPVQVEGT  457

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPITVAP+SIVFAHIP  + PACR
Sbjct  458  EPITVAPYSIVFAHIPGFYAPACR  481



>ref|XP_010927353.1| PREDICTED: heparanase-like protein 3 isoform X1 [Elaeis guineensis]
Length=543

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 135/205 (66%), Gaps = 10/205 (5%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG       K+YCRQ+L+GGNYGLLN  TF PNPDYYSALLWHRLMG   LS  F+
Sbjct  349  FLDQLGMSSTYNTKSYCRQSLVGGNYGLLNRMTFQPNPDYYSALLWHRLMGSKVLSAKFT  408

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT+ IRAYAHCA++S GITLLLINL  NTT +A V    ++    KH       +H    
Sbjct  409  GTESIRAYAHCARESQGITLLLINLSGNTTSQAFVTTASNYTIGLKHHIPRTRFNHIT--  466

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                    R +K  T  REEYHLTAK G+LHSQ MLLNGN LS+DS G+IP  +P  L++
Sbjct  467  --------RLRKTATFMREEYHLTAKDGNLHSQVMLLNGNILSLDSEGNIPTFEPMELDA  518

Query  344  SEPITVAPFSIVFAHIPYVFLPACR  270
            S PITV PFSIVF HIP+   PACR
Sbjct  519  SLPITVTPFSIVFVHIPHFDAPACR  543



>gb|KDO61807.1| hypothetical protein CISIN_1g037212mg [Citrus sinensis]
Length=551

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 135/210 (64%), Gaps = 17/210 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNP YYSALLWHRLMG   LSTS S 
Sbjct  349  LDQLGMASIYGTKTYCRQTLIGGNYGLLNTNTFVPNPGYYSALLWHRLMGSTVLSTSLSE  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEA-------NVAYNGSFVhhrkhirhinhh  543
            T KIRAYAHC+KQS G TLLLINLD NTT          N+A NG+ V            
Sbjct  409  TTKIRAYAHCSKQSQGTTLLLINLDGNTTARVRVTISRENLAGNGALV---------VQQ  459

Query  542  hhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMK  363
               +      K S  ++  G M REEYHLTA+ GDLHSQTMLLNG  L+V+SS   P ++
Sbjct  460  EQQNQRKRFAKISQDTKTNGKM-REEYHLTARDGDLHSQTMLLNGEILAVNSSEDFPPLE  518

Query  362  PRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            P Y++ + PI VAPFSIVFA IP   LPAC
Sbjct  519  PIYVSETAPIIVAPFSIVFAEIPSSVLPAC  548



>ref|XP_009623092.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=537

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 134/203 (66%), Gaps = 15/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTL+GGNYGLLN  TF PNPDYY ALLWHRLMGR+ LST F G
Sbjct  342  LDQLGMSAMFDTKTYCRQTLVGGNYGLLNARTFRPNPDYYGALLWHRLMGRSVLSTQFQG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAYAHC+K S GITLLLIN+D + TV  NV+ + +  +  K    +   +      
Sbjct  402  TKKLRAYAHCSKSSDGITLLLINMDGDATV--NVSLSVTLANANKAPLLLQVING-----  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                       R  + REEYHLTAK G+LHSQT+LLNG ELSVD  G IP ++P  + SS
Sbjct  455  --------QNSRHEIWREEYHLTAKDGELHSQTLLLNGKELSVDHFGRIPHLEPIRVKSS  506

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EP+ +APFSIVF  IP V +PAC
Sbjct  507  EPLAIAPFSIVFVDIPTVQVPAC  529



>ref|NP_001241969.1| uncharacterized protein LOC100792087 precursor [Glycine max]
 gb|ACU20377.1| unknown [Glycine max]
Length=525

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 135/203 (67%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       +TYCRQ+LIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F G
Sbjct  348  LDQLGMSAVYDTRTYCRQSLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYG  407

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR YAHCAKQS GIT+L+++LD++TTVE NVA   + + +                 
Sbjct  408  TKKIRTYAHCAKQSKGITILVLSLDNSTTVEVNVALKFNKLPY-----------------  450

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                     ++ G   R EYHLTA   +LHSQTMLLNG  LSV+S+G IP + P Y+NS 
Sbjct  451  ---------RRVGEPARREYHLTAPDRNLHSQTMLLNGKILSVNSAGEIPPLDPLYVNSR  501

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI V P SIVFAHIP V L AC
Sbjct  502  KPIIVGPLSIVFAHIPNVLLSAC  524



>ref|XP_003542659.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN47116.1| Heparanase-like protein 3 [Glycine soja]
Length=524

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 135/203 (67%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       +TYCRQ+LIGGNYGLLNT+TFVPNPDYYSALLWHRLMG   L T+F G
Sbjct  347  LDQLGMSAVYDTRTYCRQSLIGGNYGLLNTSTFVPNPDYYSALLWHRLMGGRVLLTTFYG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR YAHCAK+S GIT+L++NLD++TTV+ NVA   + + +                 
Sbjct  407  TKKIRTYAHCAKESKGITILVLNLDNSTTVQVNVALKFNKLPY-----------------  449

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                     ++ G   R EYHLTA   +LHSQTMLLNG  LSV+S+G IP ++P Y+NS 
Sbjct  450  ---------RRVGEPARREYHLTAPDRNLHSQTMLLNGKMLSVNSAGEIPPLEPLYVNSR  500

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI V P SIVFAHIP V L AC
Sbjct  501  KPIIVGPLSIVFAHIPNVLLSAC  523



>ref|XP_004249602.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=542

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 134/203 (66%), Gaps = 15/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  +G       KTYCRQTL+GGNYGLLNTTTF PNPDYY ALLWHRLMGRN LST F G
Sbjct  347  LDQMGMSATFDTKTYCRQTLVGGNYGLLNTTTFHPNPDYYGALLWHRLMGRNVLSTQFQG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KK+R+YAHC+K S GI L+LIN+ S+ TV  +++                   + + S 
Sbjct  407  MKKLRSYAHCSKSSEGIALMLINMHSSITVNISLS---------------VTVANTNESP  451

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
               + +     R  + REEYHLTAK GDLHSQT+LLNGNEL+VD  G IP ++P  +N S
Sbjct  452  MLLQVTNDQNARHEIEREEYHLTAKDGDLHSQTVLLNGNELNVDHFGRIPLLEPVRVNPS  511

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI++AP SIVF HIP + +PAC
Sbjct  512  HPISIAPLSIVFVHIPSIQVPAC  534



>ref|XP_009792772.1| PREDICTED: heparanase-like protein 3 isoform X2 [Nicotiana sylvestris]
Length=546

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 132/203 (65%), Gaps = 15/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTL+GGNYGLLNT TF PNPDYY ALLWHRLMGR+ LST F G
Sbjct  351  LDQLGMSATFDTKTYCRQTLVGGNYGLLNTITFHPNPDYYGALLWHRLMGRSVLSTQFKG  410

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAY HC+K S GITLLLIN+D   TV  +V+           +   N +       
Sbjct  411  TKKLRAYTHCSKSSDGITLLLINMDGGATVNVSVS-----------VTLANANKVSLLLR  459

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 +PR +    + REEYHLTAK G+LHSQT+LLN  ELSVD  G IP ++P  + SS
Sbjct  460  DINDQNPRHE----IWREEYHLTAKDGELHSQTVLLNEKELSVDHFGRIPHLEPLRVKSS  515

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EP+ +APFSIVF  IP V +PAC
Sbjct  516  EPLAIAPFSIVFVDIPIVQVPAC  538



>ref|XP_012076507.1| PREDICTED: heparanase-like protein 3 [Jatropha curcas]
Length=530

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 137/203 (67%), Gaps = 7/203 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNT T+VPNPDYYSALLWHRLMGRNALSTSFSG
Sbjct  334  LDQLGMASSYNTKTYCRQSLIGGNYGLLNTDTYVPNPDYYSALLWHRLMGRNALSTSFSG  393

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHC+K + GITLLLINLD N TV+  V+             +     + +   
Sbjct  394  TNKIRAYAHCSKATQGITLLLINLDGNNTVQVRVS-------TETVAANGIMPEYQNGGR  446

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S       S K    TR+EYHLTA+ G+LHSQT+LLNG  L+++ SG+IP ++P   + S
Sbjct  447  SKFSRMSGSTKVDKHTRDEYHLTAEDGNLHSQTVLLNGKILALNLSGAIPPLEPIKASLS  506

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PITVAPFSIVFA I  + +P C
Sbjct  507  SPITVAPFSIVFARIANITVPVC  529



>ref|XP_009792771.1| PREDICTED: heparanase-like protein 3 isoform X1 [Nicotiana sylvestris]
Length=550

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 132/203 (65%), Gaps = 15/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTL+GGNYGLLNT TF PNPDYY ALLWHRLMGR+ LST F G
Sbjct  355  LDQLGMSATFDTKTYCRQTLVGGNYGLLNTITFHPNPDYYGALLWHRLMGRSVLSTQFKG  414

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKK+RAY HC+K S GITLLLIN+D   TV  +V+           +   N +       
Sbjct  415  TKKLRAYTHCSKSSDGITLLLINMDGGATVNVSVS-----------VTLANANKVSLLLR  463

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 +PR +    + REEYHLTAK G+LHSQT+LLN  ELSVD  G IP ++P  + SS
Sbjct  464  DINDQNPRHE----IWREEYHLTAKDGELHSQTVLLNEKELSVDHFGRIPHLEPLRVKSS  519

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            EP+ +APFSIVF  IP V +PAC
Sbjct  520  EPLAIAPFSIVFVDIPIVQVPAC  542



>ref|XP_006338978.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=541

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 133/203 (66%), Gaps = 15/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  +G       K YCRQTL+GGNYGLLNTTTF PNPDYY ALLWHRLMGRN LST F G
Sbjct  346  LDQIGMSATFDTKKYCRQTLVGGNYGLLNTTTFHPNPDYYGALLWHRLMGRNVLSTQFQG  405

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             KK+R+YAHC+K S GITL+LIN+  + TV  N++                   + + S 
Sbjct  406  MKKLRSYAHCSKSSEGITLMLINMHGSKTVNINLS---------------VTLANTNESS  450

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
               + +     R  + REEYHLTAK GDLHSQT+LLNG EL+VD  G IP +KP  +N S
Sbjct  451  MLLQVTNDQNPRHGIEREEYHLTAKDGDLHSQTVLLNGKELNVDHFGRIPLLKPIRVNPS  510

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI++AP SIVF HIP + +PAC
Sbjct  511  DPISIAPLSIVFVHIPTIQVPAC  533



>gb|KDP33563.1| hypothetical protein JCGZ_07134 [Jatropha curcas]
Length=539

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 137/203 (67%), Gaps = 7/203 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQ+LIGGNYGLLNT T+VPNPDYYSALLWHRLMGRNALSTSFSG
Sbjct  343  LDQLGMASSYNTKTYCRQSLIGGNYGLLNTDTYVPNPDYYSALLWHRLMGRNALSTSFSG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHC+K + GITLLLINLD N TV+  V+             +     + +   
Sbjct  403  TNKIRAYAHCSKATQGITLLLINLDGNNTVQVRVS-------TETVAANGIMPEYQNGGR  455

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S       S K    TR+EYHLTA+ G+LHSQT+LLNG  L+++ SG+IP ++P   + S
Sbjct  456  SKFSRMSGSTKVDKHTRDEYHLTAEDGNLHSQTVLLNGKILALNLSGAIPPLEPIKASLS  515

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PITVAPFSIVFA I  + +P C
Sbjct  516  SPITVAPFSIVFARIANITVPVC  538



>ref|XP_004508419.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=527

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 132/203 (65%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       ++YCRQTLIGGNYGLLNTTTF+PNPDYYSALLWHRLMG   LST+F  
Sbjct  350  LDQLGMSATYGTESYCRQTLIGGNYGLLNTTTFMPNPDYYSALLWHRLMGGRVLSTTFYE  409

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR YAHCAK+S GIT+L +NLD++TTV   VA N                       
Sbjct  410  TKKIRTYAHCAKESTGITILFLNLDNSTTVNTQVALN-----------------------  446

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P S   G   R EYHLTAK G++HSQTMLLNGN LSV+S G+IP++ P Y++SS
Sbjct  447  --FAKKPVSH-VGKSLRREYHLTAKDGNIHSQTMLLNGNILSVNSDGAIPQLNPIYVDSS  503

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI V P SIVF HIP   + AC
Sbjct  504  KPIIVGPLSIVFVHIPDAAVLAC  526



>gb|KHN15030.1| Heparanase-like protein 3 [Glycine soja]
Length=525

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 134/203 (66%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       +TYCRQ+LIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F G
Sbjct  348  LDQLGMSAVYDTRTYCRQSLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYG  407

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR YAHCAKQS GIT+L++NLD++TTVE NVA   + + +                 
Sbjct  408  TKKIRTYAHCAKQSKGITILVLNLDNSTTVEVNVALKFNKLPY-----------------  450

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                     ++ G   R EYHLTA   +LHSQTMLLNG  LSV+S+G IP + P Y+NS 
Sbjct  451  ---------RRVGEPARREYHLTAPDRNLHSQTMLLNGKILSVNSAGEIPPLDPLYVNSR  501

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI V   SIVFAHIP V L AC
Sbjct  502  KPIIVGLLSIVFAHIPNVLLSAC  524



>gb|EMS60649.1| Heparanase-like protein 3 [Triticum urartu]
Length=588

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 138/204 (68%), Gaps = 11/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  380  LDQLGMSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNG  439

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAY HC+K S GITLLLINL  N T    V   G+               H H + 
Sbjct  440  TNKIRAYTHCSKDSEGITLLLINLSGNNTNHIYVNSEGA-----------QEFAHPHGAK  488

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             H +  P+  +   +TR+EYHLTAK G+L SQ MLLNGN L+  ++G+IP+++P  +  +
Sbjct  489  EHRRSIPKLGETAGLTRQEYHLTAKDGNLQSQHMLLNGNVLATGANGAIPKLEPVQVEGT  548

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            EPITVAP+SIVFAHIP  + PACR
Sbjct  549  EPITVAPYSIVFAHIPGFYAPACR  572



>ref|XP_007155083.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27077.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=512

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 132/204 (65%), Gaps = 26/204 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG        TYCRQTLIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F G
Sbjct  335  LDQLGMSAVYDTTTYCRQTLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYG  394

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+YAHCAK+S GIT+LL+NLD++T+V+ NV                          
Sbjct  395  TKKIRSYAHCAKESKGITILLLNLDNSTSVQVNV--------------------------  428

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                      +     R EYHLTA   ++HSQ MLLNG  LSV+S+G IP ++P Y++S+
Sbjct  429  DLTFNKLPHHRVDEPARREYHLTAPDRNIHSQIMLLNGKALSVNSAGEIPPLEPVYVDST  488

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITV P SIVFAHIP V L ACR
Sbjct  489  KPITVGPLSIVFAHIPNVLLSACR  512



>ref|XP_007155084.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27078.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=524

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 132/204 (65%), Gaps = 26/204 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG        TYCRQTLIGGNYGLLNT+TF+PNPDYYSALLWHRLMG   LST+F G
Sbjct  347  LDQLGMSAVYDTTTYCRQTLIGGNYGLLNTSTFMPNPDYYSALLWHRLMGGRVLSTTFYG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            TKKIR+YAHCAK+S GIT+LL+NLD++T+V+ NV                          
Sbjct  407  TKKIRSYAHCAKESKGITILLLNLDNSTSVQVNV--------------------------  440

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                      +     R EYHLTA   ++HSQ MLLNG  LSV+S+G IP ++P Y++S+
Sbjct  441  DLTFNKLPHHRVDEPARREYHLTAPDRNIHSQIMLLNGKALSVNSAGEIPPLEPVYVDST  500

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITV P SIVFAHIP V L ACR
Sbjct  501  KPITVGPLSIVFAHIPNVLLSACR  524



>ref|XP_010099859.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB80736.1| Heparanase-like protein 3 [Morus notabilis]
Length=536

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 138/208 (66%), Gaps = 18/208 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TFVPNPDYYSALLWHRLMG N +ST+FSG
Sbjct  341  LDQLGMAASYDTKTYCRQTLIGGNYGLLNTNTFVPNPDYYSALLWHRLMGNNVISTNFSG  400

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T K+RAYAHC+K++ GITLLLINL+ +TTV   V+                       + 
Sbjct  401  TTKMRAYAHCSKKTRGITLLLINLEKDTTVNVRVS-------------TETDASSKTLNT  447

Query  521  shgkGSPRSQKRGTM-----TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
             H + +P +  +G++     TREEYHLTAK G+L SQ + LNG  L+VDSSG IP + P 
Sbjct  448  EHRRTTPSTMSQGSISSENITREEYHLTAKNGNLESQNVHLNGKILNVDSSGVIPPLDPI  507

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPAC  273
              + SEPITVAPFSIVFA I  + +PAC
Sbjct  508  NKSVSEPITVAPFSIVFALILNIDVPAC  535



>gb|AFW77131.1| hypothetical protein ZEAMMB73_462319 [Zea mays]
Length=303

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 131/210 (62%), Gaps = 3/210 (1%)
 Frame = -2

Query  902  LFLAXGILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNA  723
             F   G L  LG   +   K+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   
Sbjct  96   FFQKSGFLDQLGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKV  155

Query  722  LSTSFSGTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhh  543
            L+T+FSGT KIRAYAHCA+ S GITLLLINL  NTT + +V+                  
Sbjct  156  LATTFSGTNKIRAYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGAR  212

Query  542  hhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMK  363
             H           P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++
Sbjct  213  KHVGGRKFRHVHVPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALE  272

Query  362  PRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
               +++++PI VAP+SIVFA I +   PAC
Sbjct  273  AVKMDAAQPIAVAPYSIVFARISHFNAPAC  302



>emb|CBI21126.3| unnamed protein product [Vitis vinifera]
Length=887

 Score =   216 bits (549),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 131/204 (64%), Gaps = 30/204 (15%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF G
Sbjct  712  LDQLGMASSYDTKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFYG  771

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T+KIRAYAHC+KQS GITLLLINLD  T   +N +                         
Sbjct  772  TRKIRAYAHCSKQSPGITLLLINLDDKTQ-RSNFS-------------------------  805

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R  K     REEYHLTAK GDLHSQT+LLNG  L+++SS  +P ++P  ++S 
Sbjct  806  ----RMRRVSKIDASVREEYHLTAKDGDLHSQTLLLNGKVLTINSSRIVPPLEPIRVSSM  861

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +P+ VAPFSIVF   P +  PAC+
Sbjct  862  DPVIVAPFSIVFVRFPNINYPACK  885


 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRN LSTSF+G
Sbjct  333  LDQLGMASSYGNKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNVLSTSFNG  392

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVA  597
            TKKIRAY+HC+KQS GITLLLINLD NTT+   V+
Sbjct  393  TKKIRAYSHCSKQSPGITLLLINLDGNTTLRVQVS  427



>ref|XP_006648064.1| PREDICTED: heparanase-like protein 3-like [Oryza brachyantha]
Length=549

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 134/204 (66%), Gaps = 1/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLWHRLMG N LST+F+ 
Sbjct  347  LDQLGMSSKYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWHRLMGTNVLSTTFNS  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
              KIRAYAHCA++S GITLLLINL  N T    V   G+        R     +      
Sbjct  407  MNKIRAYAHCARESKGITLLLINLSGNNTNHIYVTSEGTGAQPYSTKREGRRPYRTKGGR  466

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
              G   P   +   + REEYHLT K G+L SQ +LLNGN L+ D++G IP+++P  +  +
Sbjct  467  RFGHI-PGLGEEAQLIREEYHLTPKDGNLQSQHVLLNGNVLAPDANGDIPKLEPVKVEGT  525

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAP+SIVFAHIP  + PACR
Sbjct  526  QPITVAPYSIVFAHIPSFYAPACR  549



>ref|XP_003561019.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=538

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 137/204 (67%), Gaps = 16/204 (8%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   KTYCRQT IGGNYG+LNT+TF PNPDYYSALLWHRLMG   L+T FS
Sbjct  350  FLDQLGMSAKYDTKTYCRQTFIGGNYGMLNTSTFEPNPDYYSALLWHRLMGTKVLATKFS  409

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT KIRAYAHC K+S GITLLLINL  NTT   +V   G+   H + +RH+         
Sbjct  410  GTNKIRAYAHCTKRSPGITLLLINLGGNTTNHVSVTSEGAATKHGRKVRHVVGF------  463

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                     +Q  G M REEYHLT KGG++ SQ M+LNG EL+ D++G+IP ++P  +++
Sbjct  464  ---------AQGAGAM-REEYHLTPKGGNIQSQVMVLNGKELATDAAGNIPRLEPVKVDA  513

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++ I VAP SIVFAHIP+   PAC
Sbjct  514  AQHIAVAPHSIVFAHIPHFHAPAC  537



>ref|XP_010048938.1| PREDICTED: heparanase-like protein 3 isoform X2 [Eucalyptus grandis]
Length=506

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 135/203 (67%), Gaps = 5/203 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TF+PNPDYYSALLWH+LMG   L TSFSG
Sbjct  308  LDQLGMAATYDTKTYCRQTLIGGNYGLLNTQTFLPNPDYYSALLWHKLMGSEVLLTSFSG  367

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHC+K   GITLLLINLD  TTV+ +V+   +             H   +H  
Sbjct  368  TDKIRAYAHCSKNPPGITLLLINLDGKTTVQVHVSTENA----TSKGTVTLKHESQNHRT  423

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 S  S   G + REEYHLTAK G++ SQ +LLN   L++DSSG+IP + P Y++ S
Sbjct  424  RFASMSRGSSNDGNI-REEYHLTAKEGNIQSQVLLLNRKVLNIDSSGNIPSLDPIYVSHS  482

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITVAPFS+VFA IP + + AC
Sbjct  483  DPITVAPFSVVFARIPSMNVSAC  505



>gb|KJB27355.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=505

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 131/203 (65%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TFVPNPDYY ALLWHRLMG N LSTSFSG
Sbjct  327  LGQLGMASSYDTKTYCRQTLIGGNYGLLDTATFVPNPDYYGALLWHRLMGSNVLSTSFSG  386

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAYAHC+KQS GI+LLLIN ++N +V   V  +G                      
Sbjct  387  TTGVRAYAHCSKQSQGISLLLINFNANISVNVRVVTDGE---------------------  425

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 +PR  K G  +REEYH TAK  +LHSQ ++LNG  L+++SSG IP M+P   + +
Sbjct  426  ----QAPRV-KLGNTSREEYHFTAKDENLHSQKVVLNGKILALNSSGGIPPMEPVNRSMT  480

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI VAPFS VF+HI  + LPAC
Sbjct  481  DPIIVAPFSYVFSHISSIILPAC  503



>ref|XP_011459847.1| PREDICTED: heparanase-like protein 3 [Fragaria vesca subsp. vesca]
Length=412

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 137/205 (67%), Gaps = 18/205 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+  TF PNPDYYSALLW RLMG N LSTSFSG
Sbjct  225  LDQLGMSASYDTKTYCRQTLIGGNYGLLDINTFKPNPDYYSALLWQRLMGNNVLSTSFSG  284

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVA-YNGSFVhhrkhirhinhhhhhhhs  525
            TKK+R YAHC+K++ GIT+LLINL  NTTV+ +V+  NG                    +
Sbjct  285  TKKLRTYAHCSKKTQGITVLLINL-GNTTVQVDVSTKNGG----------------SRST  327

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
             +  +G   S+      REEYH+TAK GDL S+ +LLNG EL+V+S+G IP ++P  +  
Sbjct  328  LNFKEGLKDSKATKNDVREEYHITAKDGDLLSRVILLNGKELTVNSAGQIPSLEPMIVEI  387

Query  344  SEPITVAPFSIVFAHIPYVFLPACR  270
            S+P +VAPFSIVF HIP + +PAC+
Sbjct  388  SDPTSVAPFSIVFVHIPNITVPACK  412



>ref|XP_004954253.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=538

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 130/203 (64%), Gaps = 12/203 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K+YCRQTL+GGNYGLLN TTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  347  LDQLGMSSKYDTKSYCRQTLVGGNYGLLNKTTFEPNPDYYSALLWHRLMGTKVLSTTFNG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIR YAHCA+ S GITLLLINL  N T    VA  G+                    +
Sbjct  407  TNKIRTYAHCARNSEGITLLLINLSGNNTNHIYVASEGA------------RTQSARKEN  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P   +   +TREEYHLT K G+L SQ +LLNGN L+ D++G IP+++P  +  +
Sbjct  455  RRFGHIPGLGEAAELTREEYHLTPKDGNLQSQQVLLNGNVLATDANGDIPKLEPVQVEGT  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITV P+SIVFAHIP  + PAC
Sbjct  515  QPITVGPYSIVFAHIPSFYAPAC  537



>gb|KJB27356.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=532

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 131/203 (65%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T TFVPNPDYY ALLWHRLMG N LSTSFSG
Sbjct  354  LGQLGMASSYDTKTYCRQTLIGGNYGLLDTATFVPNPDYYGALLWHRLMGSNVLSTSFSG  413

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAYAHC+KQS GI+LLLIN ++N +V   V  +G                      
Sbjct  414  TTGVRAYAHCSKQSQGISLLLINFNANISVNVRVVTDGE---------------------  452

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 +PR  K G  +REEYH TAK  +LHSQ ++LNG  L+++SSG IP M+P   + +
Sbjct  453  ----QAPRV-KLGNTSREEYHFTAKDENLHSQKVVLNGKILALNSSGGIPPMEPVNRSMT  507

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI VAPFS VF+HI  + LPAC
Sbjct  508  DPIIVAPFSYVFSHISSIILPAC  530



>ref|XP_010048937.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW81360.1| hypothetical protein EUGRSUZ_C02742 [Eucalyptus grandis]
Length=543

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 135/203 (67%), Gaps = 5/203 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT TF+PNPDYYSALLWH+LMG   L TSFSG
Sbjct  345  LDQLGMAATYDTKTYCRQTLIGGNYGLLNTQTFLPNPDYYSALLWHKLMGSEVLLTSFSG  404

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHC+K   GITLLLINLD  TTV+ +V+   +             H   +H  
Sbjct  405  TDKIRAYAHCSKNPPGITLLLINLDGKTTVQVHVSTENA----TSKGTVTLKHESQNHRT  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 S  S   G + REEYHLTAK G++ SQ +LLN   L++DSSG+IP + P Y++ S
Sbjct  461  RFASMSRGSSNDGNI-REEYHLTAKEGNIQSQVLLLNRKVLNIDSSGNIPSLDPIYVSHS  519

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITVAPFS+VFA IP + + AC
Sbjct  520  DPITVAPFSVVFARIPSMNVSAC  542



>dbj|BAJ89245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 136/204 (67%), Gaps = 11/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  357  LDQLGMSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNG  416

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAY HC K S GITLLLINL  N T    V   G+               H H + 
Sbjct  417  TNKIRAYTHCTKDSEGITLLLINLSGNNTNHIYVTSEGA-----------QEGAHPHGAK  465

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             H +  P+  +   +TR+EYHLTAK G+L SQ MLLNGN L+  ++G+IP+++P  ++ +
Sbjct  466  EHTRSIPKLGETAGLTRQEYHLTAKDGNLQSQHMLLNGNVLATGANGAIPKLEPVQVDGT  525

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PIT+ P+SIVFAHIP    PACR
Sbjct  526  QPITLGPYSIVFAHIPDFNAPACR  549



>gb|AFW73900.1| hypothetical protein ZEAMMB73_176333 [Zea mays]
Length=540

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 129/203 (64%), Gaps = 15/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K+YCRQTL+GGNYGLLNT+TF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  352  LDQLGMSSKYDTKSYCRQTLVGGNYGLLNTSTFEPNPDYYSALLWHRLMGTKVLSTAFNG  411

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIR YAHCAK S GITLLLINLD ++T    V   G+     +               
Sbjct  412  TNKIRGYAHCAKNSEGITLLLINLDGSSTNRIYVTSQGAHAQSGRKKGSEGL--------  463

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                          +TR+EYHLT K G+L SQ +LLNGN L+ D+ G IPE++P  +  +
Sbjct  464  -------GEAAAAALTRQEYHLTPKDGNLQSQQVLLNGNALATDADGEIPELEPVQVEGT  516

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITV P+SIVFAH+P  + PAC
Sbjct  517  QPITVGPYSIVFAHVPSFYAPAC  539



>ref|NP_001048420.1| Os02g0802200 [Oryza sativa Japonica Group]
 dbj|BAD36026.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD36734.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10334.1| Os02g0802200 [Oryza sativa Japonica Group]
 gb|EAZ24974.1| hypothetical protein OsJ_08752 [Oryza sativa Japonica Group]
 dbj|BAG98079.1| unnamed protein product [Oryza sativa Japonica Group]
Length=541

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 130/204 (64%), Gaps = 11/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLW+RLMG   LS +F+G
Sbjct  349  LDQLGMSSKYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWNRLMGTKVLSATFNG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCA+ S GITLLLINL  N T    V   G           +  +       
Sbjct  409  TNKIRAYAHCARDSRGITLLLINLSGNNTNHIYVTSEG-----------VQPYSTKKEGR  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P   +   + REEYHLT K G L SQ +LLNGN L+ D++G IP+++P  +  +
Sbjct  458  RRFGRIPGLGEEAQLIREEYHLTPKDGSLQSQHVLLNGNVLAPDANGEIPKLEPVQVEGT  517

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAP+SIVFAHIP  + PACR
Sbjct  518  QPITVAPYSIVFAHIPRFYAPACR  541



>ref|XP_008647415.1| PREDICTED: uncharacterized protein LOC100193781 isoform X2 [Zea 
mays]
Length=401

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 131/210 (62%), Gaps = 3/210 (1%)
 Frame = -2

Query  902  LFLAXGILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNA  723
             F   G L  LG   +   K+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   
Sbjct  194  FFQKSGFLDQLGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKV  253

Query  722  LSTSFSGTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhh  543
            L+T+FSGT KIRAYAHCA+ S GITLLLINL  NTT + +V+                  
Sbjct  254  LATTFSGTNKIRAYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGAR  310

Query  542  hhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMK  363
             H           P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++
Sbjct  311  KHVGGRKFRHVHVPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALE  370

Query  362  PRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
               +++++PI VAP+SIVFA I +   PAC
Sbjct  371  AVKMDAAQPIAVAPYSIVFARISHFNAPAC  400



>ref|XP_003570329.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=541

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 131/203 (65%), Gaps = 12/203 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K+YCRQTL+GGNYGLLNTTTF PNPDYYSALLWHRLMG   LST+F+G
Sbjct  350  LDQLGMSAKYDTKSYCRQTLVGGNYGLLNTTTFEPNPDYYSALLWHRLMGTKVLSTTFNG  409

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAY HCA+ + GITLLLINL  N T    V   G+ ++  K       H       
Sbjct  410  TNKIRAYTHCARDTEGITLLLINLSGNDTNHIYVTSEGAHLYSAKKENRRFAHV------  463

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P   +     R+EYHLT K G+L SQ MLLNGN L+ D++G IP+++P  +  S
Sbjct  464  ------PGLGEVAEFKRQEYHLTPKDGNLQSQHMLLNGNLLATDANGDIPKLEPVQVEGS  517

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PITV P+SIVFAHIP  + PAC
Sbjct  518  QPITVGPYSIVFAHIPSFYAPAC  540



>ref|XP_010048935.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
Length=551

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 135/204 (66%), Gaps = 5/204 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT  F+PNPDYYSALLWH+LMG   L TSF G
Sbjct  353  LDQLGMAATYNTKTYCRQTLIGGNYGLLNTQNFLPNPDYYSALLWHKLMGSKVLLTSFLG  412

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHC+K S G+TLLLINLD NTTV+ +V+   +      +          +H  
Sbjct  413  TDKIRAYAHCSKNSPGVTLLLINLDGNTTVQVHVSTENA----TSNGTLTLKQESQNHRT  468

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
               + S  S   G + REEYHLTAK G++ SQ +LLNG  L+ DSSG+IP   P  ++ S
Sbjct  469  KFARMSRGSSNDGNI-REEYHLTAKEGNIQSQVLLLNGKVLNTDSSGNIPSFDPINVSHS  527

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAPFS+VFA IP + + AC+
Sbjct  528  DPITVAPFSVVFAQIPNMNVTACK  551



>ref|XP_004964694.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=572

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 134/227 (59%), Gaps = 22/227 (10%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+F+
Sbjct  345  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFT  404

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT KIRAYAHCA+ S GITLLLINL  NT  + +V    +      +      +     S
Sbjct  405  GTNKIRAYAHCARDSPGITLLLINLSGNTKTQVSVTQTAAVAGGAHNHGARRSNTTTQVS  464

Query  524  hshgkGSPRSQKRG----------------------TMTREEYHLTAKGGDLHSQTMLLN  411
             +    +    K G                        TR+EYHLT KGGDL SQ MLLN
Sbjct  465  VTTQAAAAGEHKHGWRRHGRKFGHSHAPGLAAAAAAGATRDEYHLTPKGGDLRSQVMLLN  524

Query  410  GNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPACR  270
            G  L+  + GSIP ++P  + ++EPI VAP+SIVFA IP+   PACR
Sbjct  525  GRALATGADGSIPRLEPVKVGAAEPIAVAPYSIVFARIPHFNAPACR  571



>ref|XP_006655848.1| PREDICTED: heparanase-like protein 3-like [Oryza brachyantha]
Length=409

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 129/204 (63%), Gaps = 12/204 (6%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LST+FS
Sbjct  217  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSTTFS  276

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT  IRAYAHCA+ S GITLLLINL  N+T +  V   G   +  K       H   +  
Sbjct  277  GTNMIRAYAHCARDSPGITLLLINLSGNSTNQVTVTSEGVHANAVKKHSRKTKHLPGYV-  335

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                      Q  G+M REEYHLT K G L SQ MLLNG  L  D++G IP ++P  +++
Sbjct  336  ----------QAAGSM-REEYHLTPKDGSLQSQVMLLNGRALVTDANGGIPRLEPVKVDA  384

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PI VAP+SIVFAHIP    PAC
Sbjct  385  AQPIAVAPYSIVFAHIPNFSAPAC  408



>gb|EAY87898.1| hypothetical protein OsI_09318 [Oryza sativa Indica Group]
 gb|ACR10239.1| heparanase [Oryza sativa Indica Group]
Length=541

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 130/204 (64%), Gaps = 11/204 (5%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   KTYCRQTLIGGNYGLLNTTTF PNPDYYSALLW+RLMG   LS +F+G
Sbjct  349  LDQLGMSSKYDTKTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWNRLMGTKVLSATFNG  408

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHCA+ S GITLLLINL  N T    +   G           +  +       
Sbjct  409  TNKIRAYAHCARDSRGITLLLINLSGNNTNHIYMTSEG-----------VQPYSTKKEGR  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P   +   + REEYHLT K G L SQ +LLNGN L+ D++G IP+++P  +  +
Sbjct  458  RRFGRIPGLGEEAQLIREEYHLTPKDGSLQSQHVLLNGNVLAPDANGEIPKLEPVQVEGT  517

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAP+SIVFAHIP  + PACR
Sbjct  518  QPITVAPYSIVFAHIPRFYAPACR  541



>ref|XP_008647414.1| PREDICTED: uncharacterized protein LOC100193781 isoform X1 [Zea 
mays]
Length=494

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FS
Sbjct  293  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFS  352

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT KIRAYAHCA+ S GITLLLINL  NTT + +V+                   H    
Sbjct  353  GTNKIRAYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGR  409

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                   P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++
Sbjct  410  KFRHVHVPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDA  469

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PI VAP+SIVFA I +   PAC
Sbjct  470  AQPIAVAPYSIVFARISHFNAPAC  493



>gb|EYU34948.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=540

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 138/206 (67%), Gaps = 12/206 (6%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNTTT         ALLWHRLMG++ LSTSF+G
Sbjct  343  LDQLGASSTYDTKTYCRQTLIGGNYGLLNTTT---------ALLWHRLMGKSVLSTSFTG  393

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            ++KIRAYAHCAK+S GITLLLIN+D NTTV A V  +G  V  + H     HHH   H H
Sbjct  394  SRKIRAYAHCAKKSQGITLLLINIDGNTTVNAKVDIHGRVVRMQNHSNIHPHHHMPRHHH  453

Query  521  shgkGSP---RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYL  351
               KG+P     Q      REEYHLT  GGD+HSQT+LLNG +L+VDSSG IP + P  +
Sbjct  454  RRSKGTPLHHNKQVSANNVREEYHLTPLGGDIHSQTVLLNGKKLTVDSSGVIPALDPVTV  513

Query  350  NSSEPITVAPFSIVFAHIPYVFLPAC  273
            +S EP+ VAP+SIVF H+P   + AC
Sbjct  514  DSLEPLIVAPYSIVFVHMPNFDVSAC  539



>ref|NP_001132339.1| uncharacterized protein LOC100193781 precursor [Zea mays]
 gb|ACG29680.1| heparanase-like protein 3 precursor [Zea mays]
Length=543

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FS
Sbjct  342  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFS  401

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT KIRAYAHCA+ S GITLLLINL  NTT + +V+                   H    
Sbjct  402  GTNKIRAYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGR  458

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                   P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++
Sbjct  459  KFRHVHVPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDA  518

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PI VAP+SIVFA I +   PAC
Sbjct  519  AQPIAVAPYSIVFARISHFNAPAC  542



>gb|ACF81144.1| unknown [Zea mays]
 gb|AFW77132.1| heparanase-like protein 3 [Zea mays]
Length=543

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+FS
Sbjct  342  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFS  401

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT KIRAYAHCA+ S GITLLLINL  NTT + +V+                   H    
Sbjct  402  GTNKIRAYAHCARDSPGITLLLINLSGNTTTQVSVSVT---TQGAVAAHKHGARKHVGGR  458

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                   P   +     R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++   +++
Sbjct  459  KFRHVHVPSFDEAAGGVRDEYHLTPKDGNLRSQIMLLNGRALATDTAGNIPALEAVKMDA  518

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PI VAP+SIVFA I +   PAC
Sbjct  519  AQPIAVAPYSIVFARISHFNAPAC  542



>ref|XP_010048934.1| PREDICTED: heparanase-like protein 3 isoform X2 [Eucalyptus grandis]
Length=444

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 127/197 (64%), Gaps = 15/197 (8%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQTLIGG YGLLN++TF PNPDYYSALLWHRLMG N L T+F+GT K+RAY+HC+K
Sbjct  258  KTYCRQTLIGGGYGLLNSSTFQPNPDYYSALLWHRLMGNNVLFTNFTGTNKLRAYSHCSK  317

Query  665  QSGGITLLLINLDSNTTVEANV-----AYNGSFVhhrkhirhinhhhhhhhshshgkGSP  501
             S G+TLLLINLD NTT + +V     A NG+ +   +     +                
Sbjct  318  NSTGVTLLLINLDGNTTAQVHVSAEDGAGNGTLILQPQIRSRKSKFSRIS----------  367

Query  500  RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAP  321
            +        REEYHLTAK  DLHSQ  LLNG  LSVDSSG+IP + P  +  S+PI VA 
Sbjct  368  KGLIFDANIREEYHLTAKDRDLHSQVTLLNGKILSVDSSGNIPALNPIQVRMSDPILVAS  427

Query  320  FSIVFAHIPYVFLPACR  270
            FS+ FA  P + + ACR
Sbjct  428  FSVAFARFPSMNVTACR  444



>gb|EAY99897.1| hypothetical protein OsI_21892 [Oryza sativa Indica Group]
 gb|ACR10238.1| heparanase [Oryza sativa Indica Group]
Length=525

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 126/204 (62%), Gaps = 17/204 (8%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LS +F+
Sbjct  338  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSATFN  397

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT  IR YAHCAK S GITLLLINL  NTT + +V   G+  +  K              
Sbjct  398  GTNMIRTYAHCAKDSPGITLLLINLSGNTTSQVSVTSEGAHANTVKKHSRKT--------  449

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                    R    G+M REEYHLTAK G L SQ MLLNG  L  D +G IP ++P  +++
Sbjct  450  --------RHLAAGSM-REEYHLTAKDGSLQSQVMLLNGRALVADENGEIPRLEPVKVDA  500

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PI VAP+SIVFAHI     PAC
Sbjct  501  AQPIAVAPYSIVFAHIHNFPAPAC  524



>gb|EAZ36024.1| hypothetical protein OsJ_20330 [Oryza sativa Japonica Group]
Length=525

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 126/204 (62%), Gaps = 17/204 (8%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LS +F+
Sbjct  338  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSATFN  397

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT  IR YAHCAK S GITLLLINL  NTT + +V   G+  +  K              
Sbjct  398  GTNMIRTYAHCAKDSPGITLLLINLSGNTTSQVSVTSEGAHANTVKKHSRKT--------  449

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                    R    G+M REEYHLTAK G L SQ MLLNG  L  D +G IP ++P  +++
Sbjct  450  --------RHLAAGSM-REEYHLTAKDGSLQSQVMLLNGRALVADENGEIPRLEPVKVDA  500

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PI VAP+SIVFAHI     PAC
Sbjct  501  AQPIAVAPYSIVFAHIHNFPAPAC  524



>ref|NP_001056967.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAD72300.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18881.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAG89440.1| unnamed protein product [Oryza sativa Japonica Group]
Length=526

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 126/204 (62%), Gaps = 17/204 (8%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLN  TF PNPDYYSALLWHRLMG   LS +F+
Sbjct  339  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSATFN  398

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT  IR YAHCAK S GITLLLINL  NTT + +V   G+  +  K              
Sbjct  399  GTNMIRTYAHCAKDSPGITLLLINLSGNTTSQVSVTSEGAHANTVKKHSRKT--------  450

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                    R    G+M REEYHLTAK G L SQ MLLNG  L  D +G IP ++P  +++
Sbjct  451  --------RHLAAGSM-REEYHLTAKDGSLQSQVMLLNGRALVADENGEIPRLEPVKVDA  501

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            ++PI VAP+SIVFAHI     PAC
Sbjct  502  AQPIAVAPYSIVFAHIHNFPAPAC  525



>gb|EPS67583.1| hypothetical protein M569_07189, partial [Genlisea aurea]
Length=534

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 7/203 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQTLIGGNYGLLNTTTF PNPD+YSALLWHRLMG   LS +F+ 
Sbjct  339  LDQLGLASYYDHKVYCRQTLIGGNYGLLNTTTFAPNPDFYSALLWHRLMGPRVLSATFNV  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T K+RAYAHCAK+S GI+LLL+N+D N + +  V ++             N   H     
Sbjct  399  TNKVRAYAHCAKRSLGISLLLVNIDGNNSYDLRVEHD-------LTTPRRNSRKHIRLHR  451

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +      + Q+ G + REEYHLT   G++ S+ +LLNG EL VDSS  IP ++P  +NSS
Sbjct  452  APKWSHVKQQQLGEVPREEYHLTPLDGNIQSRVVLLNGKELIVDSSNQIPVLEPVQVNSS  511

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI V P+SIVF H P + LPAC
Sbjct  512  DPIKVDPYSIVFVHFPSMDLPAC  534



>ref|XP_010665516.1| PREDICTED: heparanase-like protein 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 132/212 (62%), Gaps = 27/212 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T++FVPNPDYYSALLW+RLMG+  LSTS SG
Sbjct  351  LDQLGMAATYGTKTYCRQTLIGGNYGLLDTSSFVPNPDYYSALLWNRLMGKQVLSTSISG  410

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAY HC+KQS GITLLLINLD+  T++ N++     +                   
Sbjct  411  TNNLRAYTHCSKQSQGITLLLINLDALMTLQVNISTETDSI-------------------  451

Query  521  shgkGSP--RSQKRGTM------TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEM  366
                 SP  R  K   M      TREEYHLTA   DL S+ +LLNG  L+VDSSG IP M
Sbjct  452  LAADKSPFARKSKFEQMPIISQNTREEYHLTAPNRDLISKKVLLNGRILTVDSSGGIPPM  511

Query  365  KPRYLNSSEPITVAPFSIVFAHIPYVFLPACR  270
            KP  ++ S+PI+VAP SIVF HIP +    C+
Sbjct  512  KPAVVHLSDPISVAPLSIVFVHIPSIVSYTCK  543



>ref|XP_010665510.1| PREDICTED: heparanase-like protein 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 132/212 (62%), Gaps = 27/212 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLL+T++FVPNPDYYSALLW+RLMG+  LSTS SG
Sbjct  412  LDQLGMAATYGTKTYCRQTLIGGNYGLLDTSSFVPNPDYYSALLWNRLMGKQVLSTSISG  471

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAY HC+KQS GITLLLINLD+  T++ N++     +                   
Sbjct  472  TNNLRAYTHCSKQSQGITLLLINLDALMTLQVNISTETDSI-------------------  512

Query  521  shgkGSP--RSQKRGTM------TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEM  366
                 SP  R  K   M      TREEYHLTA   DL S+ +LLNG  L+VDSSG IP M
Sbjct  513  LAADKSPFARKSKFEQMPIISQNTREEYHLTAPNRDLISKKVLLNGRILTVDSSGGIPPM  572

Query  365  KPRYLNSSEPITVAPFSIVFAHIPYVFLPACR  270
            KP  ++ S+PI+VAP SIVF HIP +    C+
Sbjct  573  KPAVVHLSDPISVAPLSIVFVHIPSIVSYTCK  604



>dbj|BAJ90636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 123/204 (60%), Gaps = 17/204 (8%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+ IGGNYGLLNTTTF PNPDYYSALLWHRLMG   L   F+
Sbjct  337  FLDQLGMSAKFDTKSYCRQSFIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLEARFT  396

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT  +RAYAHCAK + GITLLLINL  N T    VA +G                   H 
Sbjct  397  GTNMVRAYAHCAKHAPGITLLLINLHRNATNHVTVASSGG-----------------AHG  439

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
             +  +  PR  +     REEYHLT +GGD+ SQ M+LNG  L   + GSIP M+P  +++
Sbjct  440  GAARRHGPRFGQAAGAAREEYHLTPEGGDIQSQVMMLNGRALVTGADGSIPRMEPVKVDA  499

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            +  + VAP SIVF H+P+   PAC
Sbjct  500  ARHVAVAPRSIVFVHMPHFHAPAC  523



>ref|XP_010048933.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
Length=544

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 127/197 (64%), Gaps = 15/197 (8%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQTLIGG YGLLN++TF PNPDYYSALLWHRLMG N L T+F+GT K+RAY+HC+K
Sbjct  358  KTYCRQTLIGGGYGLLNSSTFQPNPDYYSALLWHRLMGNNVLFTNFTGTNKLRAYSHCSK  417

Query  665  QSGGITLLLINLDSNTTVEANV-----AYNGSFVhhrkhirhinhhhhhhhshshgkGSP  501
             S G+TLLLINLD NTT + +V     A NG+ +   +     +                
Sbjct  418  NSTGVTLLLINLDGNTTAQVHVSAEDGAGNGTLILQPQIRSRKSKFSRIS----------  467

Query  500  RSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAP  321
            +        REEYHLTAK  DLHSQ  LLNG  LSVDSSG+IP + P  +  S+PI VA 
Sbjct  468  KGLIFDANIREEYHLTAKDRDLHSQVTLLNGKILSVDSSGNIPALNPIQVRMSDPILVAS  527

Query  320  FSIVFAHIPYVFLPACR  270
            FS+ FA  P + + ACR
Sbjct  528  FSVAFARFPSMNVTACR  544



>ref|XP_010050122.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
 gb|KCW83012.1| hypothetical protein EUGRSUZ_C04395 [Eucalyptus grandis]
Length=542

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 124/191 (65%), Gaps = 11/191 (6%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQ  IGGNYGLL+ T+F+PNPDYYSALLWHRLMGR  L  S S + KIRAYAHCAK
Sbjct  362  KTYCRQAFIGGNYGLLDATSFIPNPDYYSALLWHRLMGRKVLGASLSRSDKIRAYAHCAK  421

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQKR  486
             S G+ LL INLD N+T E  V  NG+ + + +H                    P+    
Sbjct  422  ASKGVMLLFINLDGNSTAEVTVVNNGTPIRNHRHYNFGKGFIQF----------PQDSND  471

Query  485  GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVF  306
              + REEYHLT K GD  S+T++LNGN L+V +SG IP + P+ +NSS  I VAP SIVF
Sbjct  472  ENV-REEYHLTPKDGDPLSRTVMLNGNILAVSTSGEIPALNPKNVNSSSSIVVAPQSIVF  530

Query  305  AHIPYVFLPAC  273
            AH+PY  +P C
Sbjct  531  AHMPYYAIPDC  541



>ref|XP_008658727.1| PREDICTED: heparanase-like protein 3 isoform X1 [Zea mays]
Length=555

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 129/208 (62%), Gaps = 3/208 (1%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   R   K+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L+ +FS
Sbjct  345  FLDQLGMAARFDTKSYCRQSLVGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLAVTFS  404

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhh---hh  534
            GT KIRAYAHCA+ S GITLLLINL  N T   +V   G+   H    RH    H     
Sbjct  405  GTNKIRAYAHCARDSPGITLLLINLSGNATARVSVTAQGAAAAHAHRHRHDARKHGGGRK  464

Query  533  hhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  354
                     +   +      R EYHLT K GDL SQ ++LNG  L+ D++G+IP ++   
Sbjct  465  FRHVHVPGFAGGGEAAAGAVRHEYHLTPKDGDLTSQVVMLNGRALATDAAGNIPALEAVE  524

Query  353  LNSSEPITVAPFSIVFAHIPYVFLPACR  270
            ++++ PI V P+SIVFA +P+   PACR
Sbjct  525  VDAARPIAVTPYSIVFARVPHFSAPACR  552



>ref|NP_001152083.1| heparanase-like protein 3 precursor [Zea mays]
 gb|ACG45701.1| heparanase-like protein 3 precursor [Zea mays]
Length=552

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 129/206 (63%), Gaps = 1/206 (0%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   R   K+YCRQ+L+GGNYGLLNTTTF PNPDYYSALLWHRLMG   L+ +FS
Sbjct  344  FLDQLGMAARFDTKSYCRQSLVGGNYGLLNTTTFQPNPDYYSALLWHRLMGTEVLAVTFS  403

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANV-AYNGSFVhhrkhirhinhhhhhhh  528
            GT KIRAYAHCA+ S GITLLLINL  N T   +V A   +  H  +H    +       
Sbjct  404  GTNKIRAYAHCARDSPGITLLLINLSGNATARVSVTAQGAAAAHAHRHGARKHGGGRKFR  463

Query  527  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                   +   +      R EYHLT K GDL SQ ++LNG  L+ D++G+IP ++   ++
Sbjct  464  HVHVPGFAGAGEAAAGAVRHEYHLTPKDGDLTSQVVMLNGRALATDAAGNIPALEAVEVD  523

Query  347  SSEPITVAPFSIVFAHIPYVFLPACR  270
            ++ PI V P+SIVFA +P+   PACR
Sbjct  524  AARPIAVTPYSIVFARVPHFSAPACR  549



>ref|XP_002437942.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
 gb|EER89309.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
Length=554

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 130/208 (63%), Gaps = 5/208 (2%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG   +   K+YCRQ+LIGGNYGLLNTTTF PNPDYYSALLWHRLMG   L+T+F+
Sbjct  347  FLDQLGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFN  406

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            GT KIRAYAHCA+ S GITLLLINL  NTT + +V    +               H    
Sbjct  407  GTNKIRAYAHCARDSPGITLLLINLSGNTTTQVSVTVT-TQGQGAVAAHKHGARKHVGGR  465

Query  524  hshgkGSPR----SQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
                   PR     +      R+EYHLT K G+L SQ MLLNG  L+ D++G+IP ++  
Sbjct  466  KFGHVHGPRFTGVDEAAAGAVRDEYHLTPKDGNLRSQVMLLNGKALATDAAGNIPALEAV  525

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             +++++PI VAP+SIVFA I +   PAC
Sbjct  526  KVDAAQPIAVAPYSIVFARISHFNAPAC  553



>gb|EYU38304.1| hypothetical protein MIMGU_mgv1a011158mg [Erythranthe guttata]
Length=290

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 119/204 (58%), Gaps = 28/204 (14%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQTL+GG Y LL+TTTFVPNPDYY ALLWHRLMG++ L T F G
Sbjct  108  LDILGMAAAYDTKLFCRQTLVGGYYSLLDTTTFVPNPDYYGALLWHRLMGKHVLLTRFEG  167

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            + KIRAYAHCAK S G+ +LLINLD NTT EA ++                         
Sbjct  168  SSKIRAYAHCAKNSPGVVVLLINLDGNTTAEAKLS-------------------------  202

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                      +R    R+EYHLT   G++ S+T+LLNG  L VDSSG+IP M+P  +  S
Sbjct  203  ---LFENDDGERLFDFRQEYHLTPLEGNIQSKTVLLNGKPLIVDSSGAIPIMEPVEVIGS  259

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PITV P SIVF HI      ACR
Sbjct  260  RPITVNPHSIVFVHISNFAFKACR  283



>gb|ABR16706.1| unknown [Picea sitchensis]
Length=381

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 124/203 (61%), Gaps = 30/203 (15%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K++CRQ+LIGGNYGLLNTTTF+PNPDYYSALLWHRLMG   L+T+ +G
Sbjct  208  LDQLGMASAFSTKSFCRQSLIGGNYGLLNTTTFLPNPDYYSALLWHRLMGTRVLATNSTG  267

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T+ +RAYAHC K S G+TLLLINL  +T +   V+                         
Sbjct  268  TEYLRAYAHCTKSSRGVTLLLINLSRDTGISVQVS-------------------------  302

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                GS  S  R   +R EYHLTAK GDLHSQT+LLNGN L++   G IP +    + ++
Sbjct  303  ---TGSGTSTDRN--SRLEYHLTAKDGDLHSQTVLLNGNILNITPDGEIPSLSAVTVPAN  357

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI VAP SI F ++PYV  PAC
Sbjct  358  RPILVAPLSIAFVNLPYVQFPAC  380



>ref|XP_011070961.1| PREDICTED: heparanase-like protein 1 isoform X2 [Sesamum indicum]
Length=489

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 121/203 (60%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K +CRQ+LIGGNYGLLNTTTFVPNPDYY ALLWHRLMG N LS S +G
Sbjct  312  LDQLGMTSRFNHKVFCRQSLIGGNYGLLNTTTFVPNPDYYGALLWHRLMGTNVLSASHNG  371

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R Y+HC+K++ GI+LLLIN+ ++TT E +VA +                       
Sbjct  372  SPYLRVYSHCSKKTAGISLLLINMSNSTTFEVSVADD-----------------------  408

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 S   Q R T  REEYHLT + G++ S  +LLNG  L +  S  IP M P+ +++ 
Sbjct  409  ---TNSYHQQYRDTNKREEYHLTPEDGNILSDVLLLNGTPLKLTESSDIPAMNPQLVDAR  465

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI V P SIVFA +P    PAC
Sbjct  466  LPIKVTPDSIVFATLPGFKAPAC  488



>ref|XP_011070960.1| PREDICTED: heparanase-like protein 2 isoform X1 [Sesamum indicum]
Length=514

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 121/203 (60%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K +CRQ+LIGGNYGLLNTTTFVPNPDYY ALLWHRLMG N LS S +G
Sbjct  337  LDQLGMTSRFNHKVFCRQSLIGGNYGLLNTTTFVPNPDYYGALLWHRLMGTNVLSASHNG  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R Y+HC+K++ GI+LLLIN+ ++TT E +VA +                       
Sbjct  397  SPYLRVYSHCSKKTAGISLLLINMSNSTTFEVSVADD-----------------------  433

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 S   Q R T  REEYHLT + G++ S  +LLNG  L +  S  IP M P+ +++ 
Sbjct  434  ---TNSYHQQYRDTNKREEYHLTPEDGNILSDVLLLNGTPLKLTESSDIPAMNPQLVDAR  490

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI V P SIVFA +P    PAC
Sbjct  491  LPIKVTPDSIVFATLPGFKAPAC  513



>gb|KCW81359.1| hypothetical protein EUGRSUZ_C02741 [Eucalyptus grandis]
Length=490

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 121/204 (59%), Gaps = 21/204 (10%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       KTYCRQTLIGGNYGLLNT  F+PNPDYYSALLWH+LMG   L TSF G
Sbjct  308  LDQLGMAATYNTKTYCRQTLIGGNYGLLNTQNFLPNPDYYSALLWHKLMGSKVLLTSFLG  367

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T KIRAYAHC+K S      +I++ +      N   NG+    ++   H           
Sbjct  368  TDKIRAYAHCSKNS------VIHVSTE-----NATSNGTLTLKQESQNHRTKFARMS---  413

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R        REEYHLTAK G++ SQ +LLNG  L+ DSSG+IP   P  ++ S
Sbjct  414  -------RGSSNDGNIREEYHLTAKEGNIQSQVLLLNGKVLNTDSSGNIPSFDPINVSHS  466

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
            +PITVAPFS+VFA IP + + AC+
Sbjct  467  DPITVAPFSVVFAQIPNMNVTACK  490



>ref|XP_010936349.1| PREDICTED: heparanase-like protein 1 isoform X2 [Elaeis guineensis]
Length=576

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 117/203 (58%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T  FVPNPDYYSALLWH+LMGR  LS    G
Sbjct  374  LDQLGMASKYNTKVYCRQTLIGGNYGLLDTEKFVPNPDYYSALLWHQLMGRGVLSVDIDG  433

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHCAKQ  G+++LLINL SNTT       N   V+  +        +  H   
Sbjct  434  SPSLRVYAHCAKQEAGVSVLLINL-SNTTKSIVTVQNDINVNLGEKDGIQKDSYFVHGLK  492

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R    G+  REEYHLTAK G+  SQTMLLNG+ L +   G IP + P Y++ +
Sbjct  493  KTVSWLGRKPLDGSQKREEYHLTAKDGNHQSQTMLLNGSPLELTEDGGIPALNPAYVSVN  552

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI +AP SI F   P     AC
Sbjct  553  SPIKMAPMSIAFVVFPNFEARAC  575



>gb|ACN26863.1| unknown [Zea mays]
 tpg|DAA44038.1| TPA: hypothetical protein ZEAMMB73_735117 [Zea mays]
Length=431

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 115/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   + 
Sbjct  229  LDQLGMASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINA  288

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             ++IRAYAHC KQ  GIT+LLINL SNTT       N   V   K           H   
Sbjct  289  PRQIRAYAHCRKQQQGITILLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLR  347

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEYHLTAK GDL S+TMLLNG  L +  +GSIP M P  +   
Sbjct  348  KAVSWLGRKPASNTRRREEYHLTAKDGDLQSKTMLLNGAPLELGDAGSIPAMDPVLVAVD  407

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  408  LPVQLAPTSIAFVVLPKFEAKAC  430



>ref|XP_010936348.1| PREDICTED: heparanase-like protein 1 isoform X1 [Elaeis guineensis]
Length=601

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 117/203 (58%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T  FVPNPDYYSALLWH+LMGR  LS    G
Sbjct  399  LDQLGMASKYNTKVYCRQTLIGGNYGLLDTEKFVPNPDYYSALLWHQLMGRGVLSVDIDG  458

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHCAKQ  G+++LLINL SNTT       N   V+  +        +  H   
Sbjct  459  SPSLRVYAHCAKQEAGVSVLLINL-SNTTKSIVTVQNDINVNLGEKDGIQKDSYFVHGLK  517

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R    G+  REEYHLTAK G+  SQTMLLNG+ L +   G IP + P Y++ +
Sbjct  518  KTVSWLGRKPLDGSQKREEYHLTAKDGNHQSQTMLLNGSPLELTEDGGIPALNPAYVSVN  577

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI +AP SI F   P     AC
Sbjct  578  SPIKMAPMSIAFVVFPNFEARAC  600



>gb|EAZ26032.1| hypothetical protein OsJ_09885 [Oryza sativa Japonica Group]
Length=497

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 116/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMGR  LS   + 
Sbjct  295  LDQLGMASKYNTKIFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINA  354

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             +K+RAYAHC KQ  GITLLLINL SNTT       N   V   K      H+   H   
Sbjct  355  PRKLRAYAHCRKQQQGITLLLINL-SNTTGYNVTLQNDINVSLDKTASLHKHNSFSHSLR  413

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P  +  +
Sbjct  414  RAVSWLGRKPSSDVARREEYHLTAKDGDLQSKTMLLNGAPLELSDDGGVPAMSPALVAVN  473

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  474  SPVYLAPTSIAFVVLPMFEAKAC  496



>gb|AGV40186.2| heparanase 1-like protein [Nicotiana tabacum]
Length=541

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 116/204 (57%), Gaps = 0/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L  S + 
Sbjct  338  LDQLGMAAKHHTKVYCRQTLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKEVLDVSSNA  397

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC K   G+TLLLINL +      N+  +          ++   +   H   
Sbjct  398  SPYLRSYAHCTKDRAGVTLLLINLSNQIQYGVNIQSSAYTSLQVGEKKNHKKNAFVHGLK  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                         T+ REEYHLT +GGDL S+TMLLNG  L +  +G IP + P   N  
Sbjct  458  ETVSWVGSKSSDVTLYREEYHLTPEGGDLQSRTMLLNGKPLQLTETGDIPSLTPVLKNIE  517

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI+VAP SI F   P    P+CR
Sbjct  518  SPISVAPLSIKFIVFPNFNSPSCR  541



>ref|XP_009631958.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=541

 Score =   176 bits (446),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 116/204 (57%), Gaps = 0/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L  S + 
Sbjct  338  LDQLGMAAKHHTKVYCRQTLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKEVLDVSSNA  397

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC K   G+TLLLINL +      N+  +          ++   +   H   
Sbjct  398  SPYLRSYAHCTKDRAGVTLLLINLSNQIQYGVNIQSSAYTSLQVGEKKNHKKNAFVHGLK  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                         T+ REEYHLT +GGDL S+TMLLNG  L +  +G IP + P   N  
Sbjct  458  ETVSWVGSKSSDVTLYREEYHLTPEGGDLQSRTMLLNGKPLQLTETGDIPSLTPVLKNIE  517

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI+VAP SI F   P    P+CR
Sbjct  518  SPISVAPLSIKFIVFPNFNSPSCR  541



>gb|ACG44916.1| heparanase-like protein 2 precursor [Zea mays]
 gb|ACN28738.1| unknown [Zea mays]
 tpg|DAA44037.1| TPA: heparanase-like protein 2 [Zea mays]
Length=541

 Score =   176 bits (446),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 115/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   + 
Sbjct  339  LDQLGMASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINA  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             ++IRAYAHC KQ  GIT+LLINL SNTT       N   V   K           H   
Sbjct  399  PRQIRAYAHCRKQQQGITILLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLR  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEYHLTAK GDL S+TMLLNG  L +  +GSIP M P  +   
Sbjct  458  KAVSWLGRKPASNTRRREEYHLTAKDGDLQSKTMLLNGAPLELGDAGSIPAMDPVLVAVD  517

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  518  LPVQLAPTSIAFVVLPKFEAKAC  540



>ref|XP_002468296.1| hypothetical protein SORBIDRAFT_01g043180 [Sorghum bicolor]
 gb|EER95294.1| hypothetical protein SORBIDRAFT_01g043180 [Sorghum bicolor]
Length=543

 Score =   176 bits (446),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 115/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   + 
Sbjct  341  LDQLGMASKYNTKVFCRQTLIGGNYGLLDTETFLPNPDYYSALLWHRLMGNGVLSVDINA  400

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             ++IRAYAHC +Q  GITLLLINL SNTT       N   V   K           H   
Sbjct  401  PRQIRAYAHCRRQQQGITLLLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLK  459

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEYHLTAK GDL S+TMLLNG  L +  +GSIP M P  +   
Sbjct  460  KAVSWLGRKPTSDTKRREEYHLTAKDGDLQSKTMLLNGVPLELGDAGSIPAMDPVLVAVD  519

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  520  SPVHLAPTSIAFVVLPKFEAKAC  542



>ref|NP_001049350.1| Os03g0211700 [Oryza sativa Japonica Group]
 gb|ABF94603.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11264.1| Os03g0211700 [Oryza sativa Japonica Group]
Length=541

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 116/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMGR  LS   + 
Sbjct  339  LDQLGMASKYNTKIFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINA  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             +K+RAYAHC KQ  GITLLLINL SNTT       N   V   K      H+   H   
Sbjct  399  PRKLRAYAHCRKQQQGITLLLINL-SNTTGYNVTLQNDINVSLDKTASLHKHNSFSHSLR  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P  +  +
Sbjct  458  RAVSWLGRKPSSDVARREEYHLTAKDGDLQSKTMLLNGAPLELSDDGGVPAMSPALVAVN  517

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  518  SPVYLAPTSIAFVVLPMFEAKAC  540



>ref|XP_008393204.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
Length=546

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 114/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  LS   +G
Sbjct  343  LDQLGMSAKHNTRVYCRQSLVGGNYGLLNKTSFVPNPDYYSALLWHRLMGQGVLSAHNNG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC +   GITLLLINL + T    NV                   +      
Sbjct  403  SADLRTYAHCTRGRAGITLLLINLSNETNFXTNVENILDADLGAHARNISKESYFKRGLK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R      + REEYHLT K GDL S+TM+LNG  L +   G+IPE++P  ++  
Sbjct  463  RTVSWVGRKALDEAICREEYHLTPKDGDLRSKTMVLNGAPLEITKDGNIPELEPARVDMK  522

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+T+AP SI F  +PY    AC
Sbjct  523  APLTIAPLSIKFVVLPYFDAQAC  545



>ref|XP_003520103.1| PREDICTED: heparanase-like protein 2-like [Glycine max]
 ref|XP_003520107.1| PREDICTED: heparanase-like protein 2-like [Glycine max]
Length=175

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 110/193 (57%), Gaps = 26/193 (13%)
 Frame = -2

Query  848  QKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCA  669
             K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G+  +RAY HC+
Sbjct  7    HKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEGSPYLRAYVHCS  66

Query  668  KQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQK  489
            K+  GIT+LLIN+ ++TT E ++     +                          P    
Sbjct  67   KKESGITVLLINMSNSTTFEVSLLNENLY-------------------------HPEVGL  101

Query  488  RGTMT-REEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSI  312
            R   T REEYHLT K G++ S+ +LLNG  L +  S  IPEM P+ ++ S PI V   SI
Sbjct  102  RNRNTPREEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMNPKLVDPSSPIKVKHDSI  161

Query  311  VFAHIPYVFLPAC  273
            VF H      PAC
Sbjct  162  VFVHSKSFNAPAC  174



>ref|XP_011012392.1| PREDICTED: heparanase-like protein 2 [Populus euphratica]
Length=520

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 120/203 (59%), Gaps = 22/203 (11%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ LIGGNYGLLNTT+F+PNPDYY ALLWHRLMG+  L+TS  G
Sbjct  339  LDQLGMTATFNHKVYCRQALIGGNYGLLNTTSFIPNPDYYGALLWHRLMGKTVLATSHFG  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R Y HC+KQ  GIT+L+IN+ ++T+++ +V  + +                     
Sbjct  399  SPYLRTYTHCSKQKPGITMLIINMSNSTSIDVSVTNDEN---------------------  437

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 + R    G+  REEYHLT K G++ S  +LLNG  L + SS  IP + P+ ++SS
Sbjct  438  -KYPHNYRMTVNGSNQREEYHLTPKDGNIQSDVVLLNGTPLQLTSSQDIPSLSPKIVDSS  496

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PITVAP SIV+  I     PAC
Sbjct  497  SPITVAPDSIVYVTIRDFKAPAC  519



>ref|XP_002284470.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663309.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
 ref|XP_010663310.1| PREDICTED: heparanase-like protein 1 [Vitis vinifera]
Length=539

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 116/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+   + 
Sbjct  337  LDQLGMASKYHTKVYCRQTLIGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVDSTA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC+K   GITLLLINL + TT + NV  N   ++       +          
Sbjct  397  SPFLRSYAHCSKGKAGITLLLINLSNQTTFQINVE-NSMNLNLFVKKTTMYRGSAFMRGL  455

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    S+    + REEYHLT K G L SQTM+LNG  L +   G+IP + P  LN +
Sbjct  456  KKSASWIGSKADEQLFREEYHLTPKDGYLRSQTMVLNGMPLELTDDGNIPSLNPVRLNLN  515

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI + P SI F   P    PAC
Sbjct  516  APIFINPLSIAFIAFPNFDAPAC  538



>ref|XP_010259074.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259082.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
 ref|XP_010259088.1| PREDICTED: heparanase-like protein 1 [Nelumbo nucifera]
Length=539

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 115/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMG+  L+     
Sbjct  337  LDQLGMASKYSTKAYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGKGVLAVHSDA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC+K   GITLLLINL + T  +  V  N   ++  +  +        H   
Sbjct  397  SPFLRAYAHCSKGRAGITLLLINLSNQTDFKIMVQ-NDVNINVHEGEKITQGGSFMHGLK  455

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R    G   REEYHLT+  G L SQ MLLNG  L +  +G IP + P  ++  
Sbjct  456  KTVSWVGRKTSDGKALREEYHLTSMDGHLRSQKMLLNGTPLELTENGDIPPLDPVLVDVK  515

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI ++P SI F   P+   PAC
Sbjct  516  SPIYISPLSIAFVAFPHFEAPAC  538



>ref|XP_009338656.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009338663.1| PREDICTED: heparanase-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 114/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  LS   +G
Sbjct  343  LDQLGMSAKHNTRVYCRQSLVGGNYGLLNKTSFVPNPDYYSALLWHRLMGQGVLSAHNNG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC +   GITLLLINL + T    NV                   +      
Sbjct  403  SXXLRTYAHCTRGRAGITLLLINLSNETNFITNVENILDTDLGAHARNISKESYFKRGLK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R      + REEYHLT K GDL S+TM+LNG  L +   G+IPE++P  ++  
Sbjct  463  RTVSWVGRKALDEAICREEYHLTPKDGDLRSKTMILNGAPLEITKDGNIPELEPARVDMK  522

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+T+AP SI F  +PY    AC
Sbjct  523  APLTIAPLSIKFVVLPYFDAQAC  545



>ref|NP_001145968.1| uncharacterized protein LOC100279495 precursor [Zea mays]
 gb|ACL52953.1| unknown [Zea mays]
Length=541

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 114/203 (56%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   + 
Sbjct  339  LDQLGMASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINA  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             ++IRAYAHC KQ  GIT+LLINL SNTT       N   V   K           H   
Sbjct  399  PRQIRAYAHCRKQQQGITILLINL-SNTTGYNVTLQNDINVSLGKRPDLEKRSSFTHRLR  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEYHLT K GDL S+TMLLNG  L +  +GSIP M P  +   
Sbjct  458  KAVSWLGRKPASNTRRREEYHLTTKDGDLQSKTMLLNGAPLELGDAGSIPAMDPVLVAVD  517

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  518  LPVQLAPTSIAFVVLPKFEAKAC  540



>ref|XP_004239465.2| PREDICTED: heparanase-like protein 2, partial [Solanum lycopersicum]
Length=513

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 124/204 (61%), Gaps = 16/204 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ+LIGGNYGLLNTT+F+PNPDYY ALLWH+LMG+N LS +  G
Sbjct  324  LDQLGMTSTFNHKVYCRQSLIGGNYGLLNTTSFIPNPDYYGALLWHKLMGKNVLSITHEG  383

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  IR YAHC+K S GIT+LLIN+D +TT + +V  +               + +     
Sbjct  384  SPYIRTYAHCSKTS-GITVLLINMDKSTTFDVSVVDD--------------LNMYAEGVA  428

Query  521  shgkGSPRSQKRGTM-TREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
            S    +P      +M  REEYHLT K G++ S  +LLNG  L + SS  IP MKP+ ++ 
Sbjct  429  SVEYINPNPDSVDSMHPREEYHLTPKDGNIQSDVLLLNGTPLKLTSSLDIPVMKPKLVDP  488

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            + PI+VAP SIVFA +     PAC
Sbjct  489  TLPISVAPQSIVFATLRGFQAPAC  512



>dbj|BAJ97884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 111/203 (55%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F G
Sbjct  336  LDQLGQSAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAYAHC KQ GGI LLLINL  N      V  N   V   +           H   
Sbjct  396  TSYLRAYAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGITRDSSFVHGLK  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S
Sbjct  455  RTVSWVGSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSAS  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI VAP SI F   P     AC
Sbjct  515  SPIYVAPLSIAFVVFPDFEADAC  537



>dbj|BAJ84826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 111/203 (55%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F G
Sbjct  336  LDQLGQSAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAYAHC KQ GGI LLLINL  N      V  N   V   +           H   
Sbjct  396  TSYLRAYAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGITRDSSFVHGLK  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S
Sbjct  455  RTVSWVGSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSAS  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI VAP SI F   P     AC
Sbjct  515  SPIYVAPLSIAFVVFPDFEADAC  537



>dbj|BAJ96463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 111/203 (55%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F G
Sbjct  336  LDQLGQSAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAYAHC KQ GGI LLLINL  N      V  N   V   +           H   
Sbjct  396  TSYLRAYAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGITRDSSFVHGLK  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S
Sbjct  455  RTVSWVGSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSAS  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI VAP SI F   P     AC
Sbjct  515  SPIYVAPLSIAFVVFPDFEADAC  537



>ref|XP_009783167.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=516

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 121/203 (60%), Gaps = 27/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ+LIGGNYGLLNTT+F+PNPDYY ALLWH+LMG+N LST+  G
Sbjct  340  LDQLGMTSTFNHKVYCRQSLIGGNYGLLNTTSFIPNPDYYGALLWHKLMGKNVLSTTHEG  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC+K S G+T+LLIN+D +TT E +V  + +                     
Sbjct  400  SPYLRTYAHCSKSS-GVTVLLINMDKSTTFEVSVVDDLNMYP------------------  440

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    S+      REEYHLT K G++ S  +LLNG  L + +S  IPEM P+ ++ +
Sbjct  441  --------SRIEPIHQREEYHLTPKDGNIQSDVLLLNGTPLKLTASFDIPEMNPQLVDPT  492

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+VAP SIVFA +     PAC
Sbjct  493  LPISVAPRSIVFATLRGFQAPAC  515



>ref|XP_009761177.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
 ref|XP_009761178.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=541

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 114/204 (56%), Gaps = 0/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L  S   
Sbjct  338  LDQLGIAAKHHTKVYCRQTLIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKEVLHISSKA  397

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC K   G+TLLLINL +      N+  +          ++       H   
Sbjct  398  SPYLRSYAHCTKDRAGVTLLLINLSNQIQYGVNIQSSAYTSLQVGKKKNHKKSSFVHGLK  457

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                         T+ REEYHLT +GG+L S+TMLLNG  L +  +G IP + P   N  
Sbjct  458  ETVSWVGSKSSDVTLYREEYHLTPEGGNLQSRTMLLNGKPLQLTETGDIPSLSPVLENIK  517

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI+VAP SI F   P    P+CR
Sbjct  518  SPISVAPLSIKFIVFPNFNSPSCR  541



>ref|XP_009612848.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=516

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 121/203 (60%), Gaps = 27/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ+LIGGNYGLLNTT+F+PNPDYY ALLWH+LMG+N LST+  G
Sbjct  340  LDQLGMTSTFNHKVYCRQSLIGGNYGLLNTTSFIPNPDYYGALLWHKLMGKNVLSTTHEG  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC+K S G+T+LLIN+D +TT E +V  + +                     
Sbjct  400  SPYLRTYAHCSKTS-GVTVLLINMDKSTTFEVSVVDDLNMYP------------------  440

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    S+      REEYHLT K G++ S  +LLNG  L + +S  IPEM P+ ++ +
Sbjct  441  --------SRIEPIHQREEYHLTPKDGNIQSDVLLLNGTPLKLTASFDIPEMNPQLVDPT  492

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+VAP SIVFA +     PAC
Sbjct  493  LPISVAPRSIVFATLRGFQAPAC  515



>ref|XP_006348811.1| PREDICTED: heparanase-like protein 2-like [Solanum tuberosum]
Length=552

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 126/203 (62%), Gaps = 14/203 (7%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ+LIGGNYGLLNTT+FVPNPDYY ALLWH+LMG+N LS +  G
Sbjct  363  LDQLGMTSTFNHKVYCRQSLIGGNYGLLNTTSFVPNPDYYGALLWHKLMGKNVLSITHEG  422

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  IR YAHC+K S GIT+LLIN+D +TT + +V  +            +N +     S 
Sbjct  423  SPYIRTYAHCSKTS-GITVLLINMDKSTTFDVSVVND------------LNMYAESVASV  469

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             +   +P S +     REEYHLT K G++ S  +LLNG  L + SS  IP MKP+ ++ +
Sbjct  470  EYINPNPDSVES-IHPREEYHLTPKDGNIQSDVLLLNGTPLKLTSSLDIPVMKPKLVDPT  528

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+VAP SIVFA +     PAC
Sbjct  529  LPISVAPQSIVFATLRGFQAPAC  551



>gb|EYU22381.1| hypothetical protein MIMGU_mgv1a008019mg [Erythranthe guttata]
 gb|EYU22382.1| hypothetical protein MIMGU_mgv1a008019mg [Erythranthe guttata]
Length=387

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 116/208 (56%), Gaps = 36/208 (17%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQ L+GGNYGLLNTTTF+PNPDYY ALLWHRLMG+N L TS  G
Sbjct  210  LDQLGMTSAFNHKVFCRQALVGGNYGLLNTTTFIPNPDYYGALLWHRLMGKNVLFTSHKG  269

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVA-----YNGSFVhhrkhirhinhhhh  537
            +  +R Y+HC+K+S GI+LL+IN+ ++TT E +V      YN  + +             
Sbjct  270  SPYLRVYSHCSKKSAGISLLMINMSNSTTFEVSVVDETNLYNQEYTNLN-----------  318

Query  536  hhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
                                 REEYHLT K G++ S  +LLNG  L +  S  IP M P+
Sbjct  319  --------------------QREEYHLTPKDGNILSDVLLLNGTPLKLTESFDIPAMNPQ  358

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             ++S  PI V P SIVFA +     PAC
Sbjct  359  LVDSVSPIKVGPDSIVFATLKGFKAPAC  386



>ref|XP_003558511.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=544

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 122/207 (59%), Gaps = 7/207 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG+  LS   + 
Sbjct  340  LDQLGMASKYNTKVFCRQTLIGGNYGLLDTQTFIPNPDYYSALLWHRLMGKGVLSVDINA  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDS----NTTVEANVAYNGSFVhhrkhirhinhhhhh  534
             +K+RAYAHC+KQ  GITLLLINL +    N T++ ++  N S        RH +  H  
Sbjct  400  PRKVRAYAHCSKQQQGITLLLINLSNSTGYNVTLQNDI--NVSLEKQTNLRRHSSFTHGL  457

Query  533  hhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  354
              + S     P S +     REEYHL AK GD  S+TMLLNG  L +   GSIP + P  
Sbjct  458  RRAVSWLGRKP-SSRDAAAKREEYHLAAKDGDHQSRTMLLNGVPLELADDGSIPALDPVT  516

Query  353  LNSSEPITVAPFSIVFAHIPYVFLPAC  273
               S P+ +AP SI F  +P     AC
Sbjct  517  AAVSSPVYLAPTSIAFVVLPKFEAKAC  543



>emb|CBI15157.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 115/205 (56%), Gaps = 31/205 (15%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+   + 
Sbjct  337  LDQLGMASKYHTKVYCRQTLIGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVDSTA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANV--AYNGSFVhhrkhirhinhhhhhhh  528
            +  +R+YAHC+K   GITLLLINL + TT + NV  + N +F                  
Sbjct  397  SPFLRSYAHCSKGKAGITLLLINLSNQTTFQINVENSMNLNF------------------  438

Query  527  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                       +    + REEYHLT K G L SQTM+LNG  L +   G+IP + P  LN
Sbjct  439  -----------KADEQLFREEYHLTPKDGYLRSQTMVLNGMPLELTDDGNIPSLNPVRLN  487

Query  347  SSEPITVAPFSIVFAHIPYVFLPAC  273
             + PI + P SI F   P    PAC
Sbjct  488  LNAPIFINPLSIAFIAFPNFDAPAC  512



>ref|XP_008374597.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
 ref|XP_008374598.1| PREDICTED: heparanase-like protein 1 [Malus domestica]
Length=546

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 116/203 (57%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  LS + +G
Sbjct  343  LDQLGMSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLSANNNG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC +   GITLLLINL + T    N+A         +        +      
Sbjct  403  SADLRTYAHCTRGRAGITLLLINLSNETNFIVNIANVLDTDLGAQAGNVSKESYFKRGLK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R      + REEYHLT K GD+ S+TM+LNG  L +   G+IPE++P  ++  
Sbjct  463  RTVSWVGRKALDEAIYREEYHLTPKDGDVKSKTMVLNGAPLEITKDGNIPELEPTRVDMK  522

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P+    AC
Sbjct  523  APLRIAPLSIKFVVLPFFDAQAC  545



>ref|XP_002315010.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
 gb|EEF01181.1| hypothetical protein POPTR_0010s16820g [Populus trichocarpa]
Length=518

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 119/203 (59%), Gaps = 22/203 (11%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQTLIGGNYGLLNTT+F+PNPDYY ALLWHRLMG+  L+T+  G
Sbjct  337  LDQLGMTATFNHKVYCRQTLIGGNYGLLNTTSFIPNPDYYGALLWHRLMGKTVLATNHFG  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R Y HC+KQ  GIT+L+IN+ ++T+++ +V  + +                     
Sbjct  397  SPYLRTYTHCSKQKPGITMLIINMSNSTSIDVSVTNDEN---------------------  435

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 + R    G+  REEYHLT K G++ S  +LLNG  L + SS  IP + P  ++SS
Sbjct  436  -KYPHNYRMTVNGSNQREEYHLTPKDGNIQSDVVLLNGTPLQLTSSQDIPSLSPMIVDSS  494

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI VAP SIV+  I     PAC
Sbjct  495  SPIRVAPDSIVYVTIRDFKAPAC  517



>ref|XP_003578591.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=538

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 115/204 (56%), Gaps = 1/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG+  LS    G
Sbjct  336  LDQLGQSAKYDTKVYCRQTLIGGNYGLLDTDTFVPNPDYYSALLWHRLMGKGVLSMDIGG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC KQ GG+TLLLINL  N     +V  N   V   +       +   H   
Sbjct  396  SSYLRAYAHCGKQKGGVTLLLINLSQNMGSMVSVR-NDLNVDLAQGQGITRDNSFVHGLK  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTA+ GD  ++T+LLNG  L + + G IP + P  ++ S
Sbjct  455  RTVSWVGSKASDGLEKREEYHLTAQDGDPLTRTVLLNGVPLELTADGDIPPLYPVQVSVS  514

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI V+P SI F   P     AC+
Sbjct  515  SPIYVSPLSIAFVVFPDFEADACQ  538



>ref|XP_009595357.1| PREDICTED: heparanase-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=539

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 119/204 (58%), Gaps = 1/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   + + K YCRQT +GGNYGLL+T+TF+PNPDYYSALLWHRLMG+  L+ S + 
Sbjct  337  LDQLGMAAKYLTKVYCRQTFVGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVLAVSRNS  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC +   G+TLLLINL + T    ++  + +   H     +      H    
Sbjct  397  SSYLRSYAHCTRDRAGVTLLLINLSNQTQYGVSIESSATTTSHANEKSNHKKSFIHGLKK  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +      +S    T++REEYHLT   G+LHS+ MLLNG  L +   G IP + P  +N  
Sbjct  457  TFSWVGSKSSDV-TLSREEYHLTPLDGNLHSKIMLLNGLPLQLTEDGDIPSLSPVIVNIK  515

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI+VAP SI F   P    P CR
Sbjct  516  SPISVAPLSIKFLVFPNYNSPGCR  539



>gb|KCW81358.1| hypothetical protein EUGRSUZ_C02740 [Eucalyptus grandis]
Length=488

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 112/192 (58%), Gaps = 27/192 (14%)
 Frame = -2

Query  845  KTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAK  666
            KTYCRQTLIGG YGLLN++TF PNPDYYSALLWHRLMG N L T+F+GT K+RAY+HC+K
Sbjct  324  KTYCRQTLIGGGYGLLNSSTFQPNPDYYSALLWHRLMGNNVLFTNFTGTNKLRAYSHCSK  383

Query  665  QSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQKR  486
             S                  N A NG+ +   +     +                +    
Sbjct  384  NS-----------------VNGAGNGTLILQPQIRSRKSKFSRIS----------KGLIF  416

Query  485  GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVF  306
                REEYHLTAK  DLHSQ  LLNG  LSVDSSG+IP + P  +  S+PI VA FS+ F
Sbjct  417  DANIREEYHLTAKDRDLHSQVTLLNGKILSVDSSGNIPALNPIQVRMSDPILVASFSVAF  476

Query  305  AHIPYVFLPACR  270
            A  P + + ACR
Sbjct  477  ARFPSMNVTACR  488



>gb|EYU28837.1| hypothetical protein MIMGU_mgv1a026758mg, partial [Erythranthe 
guttata]
Length=503

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 120/203 (59%), Gaps = 18/203 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQ LIGGNY LLNTTTF+PNPDYY ALLWHRLMG+N LS +  G
Sbjct  318  LDQLGMTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGALLWHRLMGKNVLSATHDG  377

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY+HC+K++ GI++LLIN+ ++TT E +V  + +                     
Sbjct  378  SPYLRAYSHCSKKTAGISVLLINMSNSTTFEVSVVEDMNLY------------------P  419

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +    S       +  REEYHLT K G++ S  +LLNG  L +  S  IP M P+ ++++
Sbjct  420  NEETKSLEDISGDSNQREEYHLTPKDGNILSDVLLLNGTPLKLTESLEIPSMNPQLVDAT  479

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PIT+AP SIVFA +     PAC
Sbjct  480  LPITIAPDSIVFATLRGFKAPAC  502



>ref|XP_009595353.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595354.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595355.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595356.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 119/204 (58%), Gaps = 1/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   + + K YCRQT +GGNYGLL+T+TF+PNPDYYSALLWHRLMG+  L+ S + 
Sbjct  354  LDQLGMAAKYLTKVYCRQTFVGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVLAVSRNS  413

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC +   G+TLLLINL + T    ++  + +   H     +      H    
Sbjct  414  SSYLRSYAHCTRDRAGVTLLLINLSNQTQYGVSIESSATTTSHANEKSNHKKSFIHGLKK  473

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +      +S    T++REEYHLT   G+LHS+ MLLNG  L +   G IP + P  +N  
Sbjct  474  TFSWVGSKSSDV-TLSREEYHLTPLDGNLHSKIMLLNGLPLQLTEDGDIPSLSPVIVNIK  532

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI+VAP SI F   P    P CR
Sbjct  533  SPISVAPLSIKFLVFPNYNSPGCR  556



>ref|XP_012080342.1| PREDICTED: heparanase-like protein 1 [Jatropha curcas]
 gb|KDP31311.1| hypothetical protein JCGZ_11687 [Jatropha curcas]
Length=539

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 118/217 (54%), Gaps = 29/217 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLNTTTFVPNPDYYSALLWH+LMG+  L+     
Sbjct  337  LDQLGMASKYNTKVYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHQLMGKGVLAVGSDA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTT--------------VEANVAYNGSFVhhrkh  564
            +  +RAYAHC+K+  GITLLLINL + T               VE N+    SFV   K 
Sbjct  397  SPYLRAYAHCSKRRAGITLLLINLSNQTDFVISVQNSATMKLHVEKNIQRENSFVRGLKR  456

Query  563  irhinhhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSS  384
                  +                   G + REEYHLT K G L S+TM+LNG  L +   
Sbjct  457  SVSWVGNQAL---------------DGVLKREEYHLTPKDGYLRSRTMVLNGIPLQLTKD  501

Query  383  GSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            G IP M+P + + + PI ++P SI F  +P    P C
Sbjct  502  GDIPAMEPVHTDVNSPIYISPLSISFIVLPNFDAPTC  538



>ref|XP_010936395.1| PREDICTED: heparanase-like protein 2 [Elaeis guineensis]
Length=527

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 121/203 (60%), Gaps = 19/203 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQ LIGGNY LLNTTTF+PNPDYYSALLWHRLMG   L T+ +G
Sbjct  341  LDQLGMVTTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYSALLWHRLMGPGVLHTTHNG  400

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC+KQ  G+TLLLINL ++T+ + +V  + +    +      +         
Sbjct  401  SPYLRAYAHCSKQKNGVTLLLINLSNSTSFDVSVVSDLNLYPPKIGRSLASV--------  452

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                     Q++G   REEYHLT +GG++ S+ MLLNG  L++  SG IPEM P   +++
Sbjct  453  ---------QEKG--QREEYHLTPQGGNIQSRVMLLNGQPLNLTCSGDIPEMYPFIADAA  501

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F        PAC
Sbjct  502  APLHIAPQSIAFVSFQDFKSPAC  524



>ref|XP_004241591.1| PREDICTED: heparanase-like protein 2 [Solanum lycopersicum]
Length=539

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 119/203 (59%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQT IGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L+ S + 
Sbjct  337  LDQLGMAATYHTKVYCRQTFIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKGVLAVSNNA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC +   G+TLLLINL + T    N+  + S   H K   +           
Sbjct  397  SSYLRSYAHCTRHRAGVTLLLINLSNQTHYGVNIESSVSITSHVKEKSNHKSSFVQRLKK  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +      +S    T++REEYHLT   G+L S+TMLLNG  L +  +G+IP + P  +   
Sbjct  457  TISWVGRKSSDV-TLSREEYHLTPLDGNLQSRTMLLNGKPLQLAENGNIPSLSPVLVKLK  515

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+++P SI F   PY+  P C
Sbjct  516  SPISISPLSIKFIVFPYLSSPVC  538



>gb|ACV84153.1| heparanase [Oryza sativa Indica Group]
Length=542

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 116/204 (57%), Gaps = 2/204 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMGR  LS   + 
Sbjct  339  LDQLGMASKYNTKVFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINA  398

Query  701  -TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
              +K+RAYAHC KQ  GITLLLINL+ NTT       N   V   K      H+   H  
Sbjct  399  PPRKLRAYAHCRKQQQGITLLLINLN-NTTGYNVTLQNDINVSLDKTASLHKHNSFSHSL  457

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                    R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P  +  
Sbjct  458  RRAVSWLGRKPSSDVARREEYHLTAKDGDLQSKTMLLNGAPLELSDDGGVPAMSPALVAV  517

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
            + P+ +AP SI F  +P     AC
Sbjct  518  NSPVYLAPTSIAFVVLPMFEAKAC  541



>ref|XP_010688437.1| PREDICTED: heparanase-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 116/205 (57%), Gaps = 27/205 (13%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG       K +CRQ LIGG+YGLLNTTTF+PNPDYY+ALLWHRLMG+  L+T   
Sbjct  281  FLDQLGMAATFNTKAFCRQALIGGHYGLLNTTTFLPNPDYYNALLWHRLMGKQVLATKVI  340

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            G  KIRAY HC+KQS GITLL+INLD+     +    +G                     
Sbjct  341  GNPKIRAYTHCSKQSEGITLLIINLDNKPFKISVETQDGPIT------------------  382

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                     +  + T+T E Y LTA   DL S+T+LLNG  L + S G IP++ P+ ++ 
Sbjct  383  ---------NPSKPTITTEVYQLTAPNADLRSKTVLLNGQALLLTSLGEIPQLIPQKVSY  433

Query  344  SEPITVAPFSIVFAHIPYVFLPACR  270
               I VA +SIVF H P +  PAC+
Sbjct  434  GSTIDVAAYSIVFVHFPEISSPACK  458



>ref|XP_012068345.1| PREDICTED: heparanase-like protein 2 [Jatropha curcas]
Length=522

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 116/203 (57%), Gaps = 21/203 (10%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQ LIGGNY LLNTT+F+PNPDYY ALLWHRLMG+N L+TS  G
Sbjct  340  LDQLGITSTFNHKVFCRQALIGGNYALLNTTSFIPNPDYYGALLWHRLMGKNVLATSHDG  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAY+HC+KQ  G+ LLLIN+ ++TT    V  + +                     
Sbjct  400  TPYLRAYSHCSKQKPGVALLLINMSNHTTFRVTVLNDHN---------------------  438

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
             +   S          REEYHLT K G++ S  +LLNG  L + SS  IP M+P+ + SS
Sbjct  439  PYPGDSKLKYYGEEQQREEYHLTPKDGNIQSDVLLLNGTPLKLTSSLDIPAMEPKLVTSS  498

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PIT+AP SIVF  I  +   AC
Sbjct  499  SPITIAPDSIVFVVIRNLRASAC  521



>emb|CAD42650.1| putative heparanase [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 110/203 (54%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T T+VPNPDYYSALLWHRLMG   LS  F  
Sbjct  336  LDQLGQSAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYSALLWHRLMGNGVLSIDFGS  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            T  +RAYAHC K+ GGI LLLINL  N      V  N   V   +           H   
Sbjct  396  TSYLRAYAHCGKRKGGIALLLINLSQNMGSMVTVR-NDLNVGIAQGQGDHKDSSFVHGLK  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P  +++S
Sbjct  455  RTVSWVGSKASDGLEKREEYHLTAQDGNPLARTMLLNGVPLELTEDGDIPPMYPVQVSAS  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI VAP SI F   P     AC
Sbjct  515  SPIYVAPLSIAFVAFPDFEADAC  537



>ref|XP_002514696.1| Heparanase-2, putative [Ricinus communis]
 gb|EEF47802.1| Heparanase-2, putative [Ricinus communis]
Length=539

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 116/203 (57%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+     
Sbjct  337  LDQLGLASKYNTKAYCRQTLIGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSDA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC++   G+TLLLINL + T    +V  + +   H K               
Sbjct  397  SPYLRAYAHCSRGRAGVTLLLINLSNQTDFIISVQNSMAMKLHVKENIQRESRIVRGLKR  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            S      R+    ++TREEYHLT+K G L SQTM+LNG  L +   G IP + P + N  
Sbjct  457  SVSWVGNRASDE-SLTREEYHLTSKDGYLRSQTMVLNGIPLELTEDGEIPRLDPVHNNVK  515

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI ++P SI F   P    P+C
Sbjct  516  SPIYISPLSIAFIVFPNFDAPSC  538



>ref|XP_006574931.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Glycine 
max]
Length=337

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 113/203 (56%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G
Sbjct  160  LDQLGMTSTFNHKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEG  219

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY HC+K   GI +LLIN+ ++TT E ++  + +                     
Sbjct  220  SPYLRAYVHCSKTESGIAVLLINMSNSTTFEVSLLNDMNLY-------------------  260

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P    + T  REEYHLT K G++ S+ +LLNG  L +  S  IPEMKP+ ++ S
Sbjct  261  ------PEVVFKNTQ-REEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMKPKLVDPS  313

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ V   SIVF H      PAC
Sbjct  314  SPVKVKHDSIVFVHSKSFNAPAC  336



>ref|XP_010046621.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
Length=526

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 121/207 (58%), Gaps = 29/207 (14%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K +CRQ LIGGNY LLNTTTF+PNPD+Y ALLWHRLMG+  LST+ SG
Sbjct  344  LDQLGMTSRFNHKVFCRQALIGGNYALLNTTTFIPNPDFYGALLWHRLMGKEVLSTTHSG  403

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC++ + G+T++LIN+ ++T+ + ++  + ++                    
Sbjct  404  SPYLRAYAHCSRNTPGVTVVLINMSNSTSFDVSIVDDPNW--------------------  443

Query  521  shgkGSPRSQKR----GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  354
                 SP  QK+        REEYHLT K G++ S  +LLNG  L +  S  IPE+ P  
Sbjct  444  -----SPSKQKKIASGSHAQREEYHLTPKDGNIRSDVLLLNGTPLKLTDSSDIPELNPTT  498

Query  353  LNSSEPITVAPFSIVFAHIPYVFLPAC  273
            ++ S+PI V   SIVFA +     PAC
Sbjct  499  VDPSQPIHVVADSIVFARLQGFKAPAC  525



>gb|KCW86528.1| hypothetical protein EUGRSUZ_B03174 [Eucalyptus grandis]
Length=522

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 121/207 (58%), Gaps = 29/207 (14%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K +CRQ LIGGNY LLNTTTF+PNPD+Y ALLWHRLMG+  LST+ SG
Sbjct  340  LDQLGMTSRFNHKVFCRQALIGGNYALLNTTTFIPNPDFYGALLWHRLMGKEVLSTTHSG  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC++ + G+T++LIN+ ++T+ + ++  + ++                    
Sbjct  400  SPYLRAYAHCSRNTPGVTVVLINMSNSTSFDVSIVDDPNW--------------------  439

Query  521  shgkGSPRSQKR----GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRY  354
                 SP  QK+        REEYHLT K G++ S  +LLNG  L +  S  IPE+ P  
Sbjct  440  -----SPSKQKKIASGSHAQREEYHLTPKDGNIRSDVLLLNGTPLKLTDSSDIPELNPTT  494

Query  353  LNSSEPITVAPFSIVFAHIPYVFLPAC  273
            ++ S+PI V   SIVFA +     PAC
Sbjct  495  VDPSQPIHVVADSIVFARLQGFKAPAC  521



>gb|EMT29716.1| Heparanase-like protein 3 [Aegilops tauschii]
Length=501

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 107/182 (59%), Gaps = 18/182 (10%)
 Frame = -2

Query  818  GGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAHCAKQSGGITLLL  639
            GGNYGLLNTTTF PNPDYYSALLWHRLMG   L   F+G+  +RAYAHCAK + GITLLL
Sbjct  337  GGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLEAKFTGSNMVRAYAHCAKHAPGITLLL  396

Query  638  INLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhshshgkGSPRSQKRGTMTREEYH  459
            INL  N T   +VA                            K   R  +     REEYH
Sbjct  397  INLHVNATNHVSVA------------------GRGGAHAGGRKHGGRFAQPPGAAREEYH  438

Query  458  LTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLP  279
            LT +GG++ SQ MLLNG  L+  + G IP M+P  ++++ PI VAP SIVF H+P    P
Sbjct  439  LTPEGGNIQSQMMLLNGRALAAGADGGIPGMEPVKVDAARPIAVAPRSIVFVHMPDYHAP  498

Query  278  AC  273
            AC
Sbjct  499  AC  500



>gb|KDO83095.1| hypothetical protein CISIN_1g041499mg, partial [Citrus sinensis]
Length=512

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 120/204 (59%), Gaps = 21/204 (10%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG       K +CRQ LIGGNY LLNTTTF+PNPDYY +LLWHRLMG+N L+T+ +
Sbjct  329  FLDQLGMTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGSLLWHRLMGKNVLATTQN  388

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
             +  +R Y+HC+K+  GIT+LLINL ++T+ + +V  + +    ++              
Sbjct  389  ASPYLRVYSHCSKEKPGITVLLINLSNSTSFDVSVINDMNLYPSQEQT------------  436

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                        +G   REEYHLT +GG++ S  +LLNG  L + +S  IP M+P+  + 
Sbjct  437  ---------QDSQGEKPREEYHLTPEGGNIQSDVVLLNGTPLKLTNSLDIPSMEPKLADR  487

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
              PITVAP SIVFA +     PAC
Sbjct  488  YSPITVAPHSIVFATLRDFKAPAC  511



>ref|XP_002866422.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH42681.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 116/203 (57%), Gaps = 3/203 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQ L+GG YGLL   TFVPNPDYYSALLWHRLMG+  L    + 
Sbjct  337  LDQLGISSKHNTKVYCRQALVGGFYGLLEKETFVPNPDYYSALLWHRLMGKGVLGVQTTA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            ++ +RAY HC+K+  GIT+LLINL  NTT    V+ NG  V  +              S 
Sbjct  397  SEYLRAYVHCSKRRAGITILLINLSKNTTFTVAVS-NGVNVVLQADTMKRKSFLETLKSK  455

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                G+  S   G + REEYHL+ K GDLHS+ MLLNGN L   ++G IP+++P      
Sbjct  456  VSWVGNKASD--GYLNREEYHLSPKHGDLHSKIMLLNGNPLVPTATGDIPKLEPARHGVK  513

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ + P SI F  +P    PAC
Sbjct  514  SPVYINPLSISFIVLPTFDAPAC  536



>ref|XP_009339108.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009339109.1| PREDICTED: heparanase-like protein 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009339110.1| PREDICTED: heparanase-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 113/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMGR  LS   +G
Sbjct  343  LDQLGMSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGRGVLSADNNG  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC +   GITLLLINL + T    N+          +        +      
Sbjct  403  SADLRTYAHCTRGRAGITLLLINLSNETNFIVNIENVLDTDLGAQARNAGKESNFKRGLK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R      + REEYHLT K GD+ S+TM+ NG  L +   G+IPE++P  ++  
Sbjct  463  RTVSWVGRKALDEAIYREEYHLTPKDGDVKSKTMVHNGAPLEITKDGNIPELEPSRVDRK  522

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ ++P SI F  +P+    AC
Sbjct  523  APLRISPLSIKFVVLPFFDAQAC  545



>gb|KJB50982.1| hypothetical protein B456_008G196400 [Gossypium raimondii]
Length=539

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 116/204 (57%), Gaps = 1/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLN TTFVPNPDYYS LLWHRLMG+  L+     
Sbjct  337  LDQLGMASKYHTKVYCRQTLIGGNYGLLNATTFVPNPDYYSGLLWHRLMGKVVLNVESHA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC+K   G+TLL+INL + T    N A N   +      ++I+     H+  
Sbjct  397  SPFLRSYAHCSKGRAGVTLLVINLSNQTNFIMN-AQNSINLKLAAIEQNISRDSFTHNLK  455

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                          + REEYHLT K G L SQTM+LNG  L +  +G IP + P  +N  
Sbjct  456  KTFSWVGTKASDDALLREEYHLTPKDGYLRSQTMVLNGIPLELTRTGDIPSLNPVRVNVK  515

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PIT++P SI F   P    PACR
Sbjct  516  SPITISPLSIAFIVFPNFEAPACR  539



>ref|XP_002512114.1| Heparanase precursor, putative [Ricinus communis]
 gb|EEF50783.1| Heparanase precursor, putative [Ricinus communis]
Length=596

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 115/202 (57%), Gaps = 20/202 (10%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ  IGGNYGLLNTT+F+PNPDYY ALLWHRLMG+  L+TS + 
Sbjct  348  LDQLGMTSTYNHKVYCRQAFIGGNYGLLNTTSFIPNPDYYGALLWHRLMGKQVLATSHNA  407

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY+HC+K+  GITLLLIN+ + T+   +V  + +F                    
Sbjct  408  SPYLRAYSHCSKKKPGITLLLINMSNQTSYSVSVIDDDNFF-------------------  448

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                 + +    G   REEYHLT K G++ S  +LLNG  L +  S  IP MKP+ ++ S
Sbjct  449  -ASNSANQYSSAGNEQREEYHLTPKDGNIQSDVLLLNGTPLQLTDSLDIPAMKPQLVDPS  507

Query  341  EPITVAPFSIVFAHIPYVFLPA  276
             PITVAP S V+  I     PA
Sbjct  508  SPITVAPDSFVYVTIKDFKAPA  529



>ref|XP_006345162.1| PREDICTED: heparanase-like protein 1-like [Solanum tuberosum]
Length=540

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 112/204 (55%), Gaps = 0/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T TFVPNPDYYSALLW+RLMG+  L    S 
Sbjct  337  LDQLGMAAKHHTKVYCRQTLIGGNYGLLDTDTFVPNPDYYSALLWNRLMGKVVLGVFNSA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
               +R YAHC K   G+TLLLINL +    + N+             +        H   
Sbjct  397  APHLRTYAHCTKDRAGVTLLLINLSTQIQYKVNIHSTAETSLQVGEKKVHKKKSFAHSIK  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                         T++REEYHLT +GG++ S+TMLLNG  L +  +G IP + P + N +
Sbjct  457  ESVSWVGTKSSDVTLSREEYHLTPEGGNIKSRTMLLNGKLLRLTETGDIPSLSPVFTNLN  516

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI++ P SI F   P    P+CR
Sbjct  517  SPISIEPLSIKFIVFPNFNSPSCR  540



>ref|XP_008239880.1| PREDICTED: heparanase-like protein 1 [Prunus mume]
 ref|XP_008239881.1| PREDICTED: heparanase-like protein 1 [Prunus mume]
Length=547

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 116/197 (59%), Gaps = 0/197 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  L+ + + 
Sbjct  343  LDQLGMSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLAVNSNA  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHCA+   GIT++LIN  ++T    NV     F             +      
Sbjct  403  SADLRTYAHCARGRAGITVVLINFSNDTDFIVNVENILDFNLGAHERNISKESYFKRSLK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R      + REEYHLT K G+L S+TM+LNG  L +   G+IPE++P ++ ++
Sbjct  463  KTVSWVGRKALDKPVYREEYHLTPKKGNLRSKTMVLNGAPLEITKDGNIPELEPAHVLAN  522

Query  341  EPITVAPFSIVFAHIPY  291
             P+T++P SI F  +PY
Sbjct  523  SPLTISPLSIKFVVLPY  539



>ref|XP_004298393.1| PREDICTED: heparanase-like protein 2 [Fragaria vesca subsp. vesca]
Length=525

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 118/203 (58%), Gaps = 17/203 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQ LIGGNY LLNTT+F+PNPDYY ALLWHRLMG + LST   G
Sbjct  337  LDQLGMTASYSHKVFCRQALIGGNYALLNTTSFIPNPDYYGALLWHRLMGNSVLSTVHYG  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY+HC+K+  GITLLLIN+ ++TT + +V                     + H  
Sbjct  397  SPFLRAYSHCSKKKPGITLLLINMSNSTTFDVDV-----------------LPEFNLHPW  439

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
               +    ++  G   REEYHLT +GG++ S  +LLNG  L +  S  IPEM+P+ ++ +
Sbjct  440  QRYEEQSDTKSTGASMREEYHLTPEGGNIQSDVLLLNGTPLKLTESFDIPEMQPKLVDPT  499

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
              ++VAP S VF  I     PAC
Sbjct  500  SAVSVAPDSFVFVSIKDFHAPAC  522



>ref|XP_007226518.1| hypothetical protein PRUPE_ppa025624mg, partial [Prunus persica]
 gb|EMJ27717.1| hypothetical protein PRUPE_ppa025624mg, partial [Prunus persica]
Length=501

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 118/206 (57%), Gaps = 25/206 (12%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ LIGGNY LLNTTTF+PNPDYY ALLWHRLMG   LST+  G
Sbjct  317  LDQLGMTSTYSHKVYCRQALIGGNYALLNTTTFIPNPDYYGALLWHRLMGNRVLSTTHLG  376

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY+HC+K   GITL+LIN+ + TT +  V  + +                     
Sbjct  377  SPYLRAYSHCSKNQKGITLVLINMSNTTTFDVAVLPDYNLYLGPI---------------  421

Query  521  shgkGSPRSQKRGTMT---REEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYL  351
                   R +K G +    REEYHLT +GG++ S  +LLNGN L + +S  IP+M+P+ +
Sbjct  422  -------RMRKHGHIVGREREEYHLTPEGGNIQSDVVLLNGNPLKLTNSSDIPKMEPKLV  474

Query  350  NSSEPITVAPFSIVFAHIPYVFLPAC  273
            + +  I+VA  SIVF  I     PAC
Sbjct  475  DPTSAISVAADSIVFVSIKDFHAPAC  500



>gb|EMS53277.1| Heparanase-like protein 1 [Triticum urartu]
Length=456

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 110/208 (53%), Gaps = 6/208 (3%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYS-----ALLWHRLMGRNALS  717
            L  LG   +   K YCRQTLIGGNYGLL+T T+VPNPDYY      ALLWHRLMG   LS
Sbjct  250  LDQLGQSAKYDTKVYCRQTLIGGNYGLLDTDTYVPNPDYYRQVSVLALLWHRLMGNGVLS  309

Query  716  TSFSGTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhh  537
              F GT  +RAYAHC KQ GGI LLLINL  N      V  N   V   +          
Sbjct  310  IDFGGTSYLRAYAHCGKQKGGIALLLINLSQNMGSMVTVR-NDLNVGLAQGQGITRGSSF  368

Query  536  hhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
             H               G   REEYHLTA+ G+  ++TMLLNG  L +   G IP M P 
Sbjct  369  VHGLKRTVSWVGSKASDGLEKREEYHLTAQDGNRFARTMLLNGVPLELTEDGDIPPMYPV  428

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             +++S PI VAP SI F   P     AC
Sbjct  429  QVSASSPIYVAPLSIAFVVFPDFEADAC  456



>ref|XP_008221534.1| PREDICTED: heparanase-like protein 2 [Prunus mume]
Length=526

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 119/208 (57%), Gaps = 29/208 (14%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ LIGGNY LLNTTTF+PNPDYY ALLWHRLMG   LST+  G
Sbjct  342  LDQLGMTSTYNHKVYCRQALIGGNYALLNTTTFIPNPDYYGALLWHRLMGNRVLSTTHLG  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANV--AYNGSFVhhrkhirhinhhhhhhh  528
            +  +RAY+HC+K   GITL+LIN+ + TT +  V   YN                     
Sbjct  402  SPYLRAYSHCSKNQKGITLVLINMSNTTTFDVAVHPDYN---------------------  440

Query  527  shshgkGSPRSQKRGTMT---REEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPR  357
                  G  R +K G +    REEYHLT +GG++ S  +LLNGN L + +S  IP+M+P+
Sbjct  441  ---LYLGPIRVRKHGRIVGREREEYHLTPEGGNIQSDVLLLNGNPLKLTNSSDIPKMEPK  497

Query  356  YLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             ++ +  I+VA  SIVF  I     PAC
Sbjct  498  LVDPTSAISVAADSIVFVSIKDFHAPAC  525



>ref|XP_010678425.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010678426.1| PREDICTED: heparanase-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=544

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 114/206 (55%), Gaps = 4/206 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ LIGGNYGLLN  TFVPNPDYYSALLW+RLMG+  L      
Sbjct  340  LDQLGLAATYNTKVYCRQALIGGNYGLLNKNTFVPNPDYYSALLWNRLMGKKVLPVDNVA  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTT--VEANVAYNGSFVhhrkhirhinhhhhhhh  528
            +  +R+YAHCAK   GITLLLINL  NT+  V+     N         I   +       
Sbjct  400  SPYLRSYAHCAKGRAGITLLLINLSKNTSFIVKLQNTMNKDLHISNDMIFKEDSLTRGLK  459

Query  527  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                  GS  S   G + REEYHLT K G L SQTM+LNG  L +   G IP ++P ++ 
Sbjct  460  KTVSWVGSRASD--GQLHREEYHLTPKEGHLQSQTMVLNGKPLQISEHGDIPVLEPAFVA  517

Query  347  SSEPITVAPFSIVFAHIPYVFLPACR  270
             + P+ ++P SI F   PY   PAC+
Sbjct  518  VNSPLYISPLSISFVVFPYFDAPACK  543



>ref|XP_006374168.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51965.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
Length=362

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 119/217 (55%), Gaps = 29/217 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K YCRQTL+GG+YGLLNTTT VPNPDYYSALLWHRLMG+  L+   + 
Sbjct  160  LDQLGMASRYNTKVYCRQTLVGGHYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSNA  219

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNT--------------TVEANVAYNGSFVhhrkh  564
            +  +R+YAHC+K   GITLLLINL + T              TVE N++   SFV     
Sbjct  220  SPFLRSYAHCSKGRAGITLLLINLSNQTDFIISVQNSMDMRLTVEENISGENSFV-----  274

Query  563  irhinhhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSS  384
                          S      R+     + REEYHLTAK G+L S+TM+LNG  L +   
Sbjct  275  ---------RGLKRSVSWVGSRASDE-PLYREEYHLTAKDGNLQSRTMVLNGIPLELTED  324

Query  383  GSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             +IP + P  L+ + P+ + P SI F   P    PAC
Sbjct  325  ENIPSLDPVRLDVNSPLYINPLSISFIVFPNFDAPAC  361



>ref|XP_006354764.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354765.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354766.1| PREDICTED: heparanase-like protein 2-like isoform X3 [Solanum 
tuberosum]
Length=538

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 117/203 (58%), Gaps = 1/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQT IGGNYGLL+T+TFVPNPDYYSALLWHRLMG+  L+ S + 
Sbjct  336  LDQLGMAAIYHTKVYCRQTFIGGNYGLLDTSTFVPNPDYYSALLWHRLMGKGVLAVSNNA  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC +   G+TLLLINL + T    N+  + S   H K   +           
Sbjct  396  SSYLRSYAHCTRHRAGVTLLLINLSNQTHYGVNIESSVSITSHVKEKSNHKSSFVQRLKK  455

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +      +S    T++REEYHLT   G+L S+TMLLNG  L +  +G IP + P  +N  
Sbjct  456  TISWVGRKSSDV-TLSREEYHLTPLDGNLQSRTMLLNGKPLQLTENGHIPSLSPVLVNLK  514

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+V+P SI F   P    P C
Sbjct  515  SPISVSPLSIKFIVFPNFSSPVC  537



>ref|XP_010030437.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 ref|XP_010030444.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 ref|XP_010030449.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 gb|KCW83688.1| hypothetical protein EUGRSUZ_B00567 [Eucalyptus grandis]
 gb|KCW83689.1| hypothetical protein EUGRSUZ_B00567 [Eucalyptus grandis]
Length=540

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 119/205 (58%), Gaps = 5/205 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQ+L+GGNYGLLNTTT VPNPDYYSALLWHRLMG+ AL+ S   
Sbjct  338  LDQLGMASKYDTKVYCRQSLVGGNYGLLNTTTLVPNPDYYSALLWHRLMGKRALAVSGDA  397

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNT--TVEANVAYNGSFVhhrkhirhinhhhhhhh  528
               +R YAHC K   G+TLLLINL + T   +    +     V  +   +     H    
Sbjct  398  PPSLRCYAHCLKGRAGVTLLLINLRNQTKFIITTQKSVQNLHVEEQSVNKGSILIHGLKK  457

Query  527  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
            + S     P    R  + REEYHLT +GG L SQTMLLNG+ L +   G+IP +KP  ++
Sbjct  458  TVSFVGQGP---SRAPLFREEYHLTPQGGHLQSQTMLLNGSPLELTRDGAIPPLKPNLVH  514

Query  347  SSEPITVAPFSIVFAHIPYVFLPAC  273
            +   I+V+P SI F  +P   + AC
Sbjct  515  ADSLISVSPLSIAFIVLPNFDVQAC  539



>ref|XP_006438800.1| hypothetical protein CICLE_v10033641mg, partial [Citrus clementina]
 gb|ESR52040.1| hypothetical protein CICLE_v10033641mg, partial [Citrus clementina]
Length=498

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 119/204 (58%), Gaps = 21/204 (10%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG       K +CRQ LIGGNY LLNTTTF+PNPDYY +LLWHRLMG+N L+T+ +
Sbjct  315  FLDQLGMTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGSLLWHRLMGKNVLATTQN  374

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
             +  +R Y+HC+K+  GIT+LLINL ++T+ + +V  + +    ++              
Sbjct  375  ASPYLRVYSHCSKEKPGITVLLINLSNSTSFDVSVINDMNLYPSQEQT------------  422

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                        +    REEYHLT +GG++ S  +LLNG  L + +S  IP M+P+  + 
Sbjct  423  ---------QDSQDEKPREEYHLTPEGGNIQSDVVLLNGTPLKLTNSLDIPSMEPKLADR  473

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
              PITVAP SIVFA +     PAC
Sbjct  474  YSPITVAPHSIVFATLRDFKAPAC  497



>ref|XP_004299326.1| PREDICTED: heparanase-like protein 1 [Fragaria vesca subsp. vesca]
Length=540

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 114/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG         YCRQ+L+GG+YGLLN T+FVPNPDYYSALLWHRLMG + L    +G
Sbjct  337  LDQLGMSAMYNSAVYCRQSLVGGHYGLLNRTSFVPNPDYYSALLWHRLMGESVLKVDRNG  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
               +R YAHC+K S GIT+LLINL + T    NV          +           H   
Sbjct  397  APHLRVYAHCSKGSAGITVLLINLSNQTDFIVNVKNVLELDRADRSRSTGKGSKFSHGLK  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        GT+ R+EYHLT K G+L S+ M+LNG  L +   G+IPE++P  +  +
Sbjct  457  RTVSWVGLKASDGTLHRKEYHLTPKDGNLRSKIMVLNGVPLEITKDGNIPELEPVIVPVN  516

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            +PI++  FSI F  +P+   PAC
Sbjct  517  DPISITSFSIKFVVLPHFEAPAC  539



>ref|XP_006649618.1| PREDICTED: heparanase-like protein 2-like [Oryza brachyantha]
Length=542

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 111/203 (55%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGG+YGLL+T TF+PNPDYYSALLWHRLMG   LS   + 
Sbjct  339  LDQLGMASKYNTKVFCRQTLIGGHYGLLDTQTFLPNPDYYSALLWHRLMGSGVLSVDINA  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            ++K+RAYAHC KQ  GITLLLINL + T     +  + +    R       H    H   
Sbjct  399  SRKLRAYAHCRKQQQGITLLLINLSNTTGYNVTLQNDINVSLDRTANLQRRHASFSHGLR  458

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R        REEYHLTAK GDL S+TMLLNG  L +   G +P M P      
Sbjct  459  RAVSWLGRMPSSDVARREEYHLTAKDGDLQSRTMLLNGAPLELLDDGGVPAMNPVRAAVD  518

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P      C
Sbjct  519  SPVYLAPTSIAFVVLPMFEAKTC  541



>gb|KJB38700.1| hypothetical protein B456_006G267500 [Gossypium raimondii]
 gb|KJB38701.1| hypothetical protein B456_006G267500 [Gossypium raimondii]
Length=542

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 116/206 (56%), Gaps = 2/206 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLN TT+VPNPDYYSALLWHRLMG+  L+     
Sbjct  337  LDQLGMASKYHTKVYCRQTLIGGNYGLLNATTYVPNPDYYSALLWHRLMGKVVLAVGSDA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANV--AYNGSFVhhrkhirhinhhhhhhh  528
            +  +R+YAHC+K   G+TLL+INL   T    +V  + N +     +             
Sbjct  397  SPFLRSYAHCSKGRIGVTLLVINLSDQTKFITDVQNSMNNNIRLATEQQNISRKSFSRSL  456

Query  527  shshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
             ++      ++       REEYHLT K G L ++TM+LNG  L + S+G+IP + P  +N
Sbjct  457  KNTASGAEIKASSDEYSYREEYHLTPKNGYLQTRTMVLNGIPLELTSTGNIPRLDPVRVN  516

Query  347  SSEPITVAPFSIVFAHIPYVFLPACR  270
               PI++ P SI F   P    PACR
Sbjct  517  VKSPISITPLSIAFLVFPDFVAPACR  542



>ref|XP_006483691.1| PREDICTED: heparanase-like protein 2-like [Citrus sinensis]
Length=521

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 119/204 (58%), Gaps = 21/204 (10%)
 Frame = -2

Query  884  ILTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFS  705
             L  LG       K +CRQ LIGGNY LLNTTTF+PNPDYY +LLWHRLMG+N L+T+ +
Sbjct  338  FLDQLGMTSTFNHKVFCRQALIGGNYALLNTTTFIPNPDYYGSLLWHRLMGKNVLATTQN  397

Query  704  GTKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
             +  +R Y+HC+K+  GIT+LLINL ++T+ + +V  + +    ++              
Sbjct  398  ASPYLRVYSHCSKEKPGITVLLINLSNSTSFDVSVINDMNLYPSQEQT------------  445

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNS  345
                        +    REEYHLT +GG++ S  +LLNG  L + +S  IP M+P+  + 
Sbjct  446  ---------QDSQDEKPREEYHLTPEGGNIQSDVVLLNGTPLKLTNSLDIPSMEPKLADR  496

Query  344  SEPITVAPFSIVFAHIPYVFLPAC  273
              PITVAP SIVFA +     PAC
Sbjct  497  YSPITVAPHSIVFATLRDFKAPAC  520



>ref|XP_011075654.1| PREDICTED: heparanase-like protein 2 [Sesamum indicum]
Length=522

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 118/203 (58%), Gaps = 19/203 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQ LIGGNY LLNTT+F+PNPDYY ALLWHRLMG+  LS + +G
Sbjct  338  LDQLGMTSTFNHKVFCRQALIGGNYALLNTTSFIPNPDYYGALLWHRLMGKQVLSATHNG  397

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY+HC+K++ GI++LLIN+ ++TT E +V  + +       +             
Sbjct  398  SPYLRAYSHCSKKTSGISVLLINMSNSTTFEVSVMDDLNLYPEDYSLSS-----------  446

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                       +    REEYHLT K G++ S  +LLNG  L +  S  IP M P+ ++++
Sbjct  447  --------GYSKYVWQREEYHLTPKDGNIQSDVVLLNGTPLKLTESSDIPAMNPQVVDAA  498

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PITV P SIVFA +     PAC
Sbjct  499  SPITVQPDSIVFATLRGFAAPAC  521



>ref|XP_006837042.1| PREDICTED: heparanase-like protein 2 [Amborella trichopoda]
 gb|ERM99895.1| hypothetical protein AMTR_s00110p00045590 [Amborella trichopoda]
Length=524

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 113/203 (56%), Gaps = 16/203 (8%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ+L+GGNYGLL+TTTFVPNPD+YSALLWHRLMG+  L      
Sbjct  337  LDQLGMTSSYNHKAYCRQSLVGGNYGLLDTTTFVPNPDFYSALLWHRLMGKRVLGVEVDN  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
               +RAYAHCAK   G+ LL INL ++TT   ++  + +        +            
Sbjct  397  APYLRAYAHCAKNKAGVMLLFINLSNSTTFNVSMENDMNIFTTSSSDKVAKDVV------  450

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                      + G+  REEYHLT K G++ S+ MLLNG+ L +  +G IP + P  ++S 
Sbjct  451  ---------SQTGS-KREEYHLTPKNGNIFSRVMLLNGSPLELTKAGEIPAISPLSIDSD  500

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI +AP SI F  +P    PAC
Sbjct  501  SPILIAPRSIAFVRLPDFKAPAC  523



>ref|XP_009394623.1| PREDICTED: heparanase-like protein 2 [Musa acuminata subsp. malaccensis]
Length=527

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 114/206 (55%), Gaps = 20/206 (10%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K +CRQTLIGGNYGLL+  TFVPNPDYYSALLWHRLMG   L  S  G
Sbjct  340  LDQLGMVSRHHHKVFCRQTLIGGNYGLLDHDTFVPNPDYYSALLWHRLMGTGVLEASHDG  399

Query  701  TKKIRAYAHCAKQS-GGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
               +R+YAHC+K + GG+TLLLINL  + T E  +  NG                     
Sbjct  400  HAHLRSYAHCSKNTPGGVTLLLINLSDSITFEIEI--NGG----------------TKSY  441

Query  524  hshgkGSPRSQ-KRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                +  P ++  +    RE +HLT K GD+ S  MLLNG EL +D   SIP + P  + 
Sbjct  442  EREIRSRPLAKDDKDQSNREAFHLTPKDGDIQSTVMLLNGKELMLDGKNSIPALDPMVVE  501

Query  347  SSEPITVAPFSIVFAHIPYVFLPACR  270
            +S+P+ +AP SI F  +      ACR
Sbjct  502  ASDPLRIAPRSIAFVKLKDFNAAACR  527



>ref|XP_006664141.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Oryza brachyantha]
 ref|XP_006664142.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Oryza brachyantha]
Length=539

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 115/204 (56%), Gaps = 1/204 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLL+T TFVPNPDYYSALLWHRLMG   +S   SG
Sbjct  336  LDQLGQSAKYDTKVYCRQTLIGGNYGLLDTQTFVPNPDYYSALLWHRLMGNGVISLDTSG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC KQ GG+ LL++NL+ N     +V  N   ++ R+           H   
Sbjct  396  SSYLRAYAHCGKQKGGVALLMLNLNKNMGFMVSVR-NDLNINAREMAGIRRESSFVHGLK  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                        G   REEYHLT +GG+ +++T+LLNG  L +  +G IP + P  ++ +
Sbjct  455  RTVSWVGSKASDGLEKREEYHLTPQGGNPYARTVLLNGGPLQLTENGDIPSLPPVLVSVN  514

Query  341  EPITVAPFSIVFAHIPYVFLPACR  270
             PI VAP SI F   P      C 
Sbjct  515  SPIYVAPLSITFVVFPDFEAEGCE  538



>gb|KHN02019.1| Heparanase-like protein 2 [Glycine soja]
Length=513

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 114/203 (56%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G
Sbjct  336  LDQLGMTSTFNHKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY HC+K+  GI +LLIN+ ++TT E ++  + +                     
Sbjct  396  SPYLRAYVHCSKKESGIAVLLINMSNSTTFEVSLLNDMNLY-------------------  436

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P    + T  REEYHLT K G++ S+ +LLNG  L +  S  IPEMKP+ ++ S
Sbjct  437  ------PEVVFKNTQ-REEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMKPKLVDPS  489

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ V   SIVF H      PAC
Sbjct  490  SPVKVKHDSIVFVHSKSFNAPAC  512



>ref|XP_009801842.1| PREDICTED: heparanase-like protein 1 isoform X2 [Nicotiana sylvestris]
Length=506

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 119/206 (58%), Gaps = 5/206 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQT IGGNYGLL+T+TF+PNPDYYSALLWHRLMG+   + S + 
Sbjct  304  LDQLGMAAKYHTKVYCRQTFIGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVFAVSSNS  363

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC +   G+TLLLINL + T    ++    S VH   H    ++H       
Sbjct  364  SSYLRSYAHCTRNRAGVTLLLINLSNQTQYRVSIE---SSVHTSSHANEKSNHKKSFIHG  420

Query  521  shgkGSPRSQKRG--TMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                 S    K    T++REEYHLT   G+LHS+TMLLNG  L +   G IP + P  +N
Sbjct  421  LKKTFSWVGSKSSDVTLSREEYHLTPLNGNLHSKTMLLNGLPLQLTEIGDIPSLSPVLVN  480

Query  347  SSEPITVAPFSIVFAHIPYVFLPACR  270
               PI+VAP SI F   P    P CR
Sbjct  481  IVSPISVAPLSIKFIVFPNYNSPGCR  506



>gb|KDO54577.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=551

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 113/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G
Sbjct  347  LDQLGMSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDG  406

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC+K+  GITLLLINL + T    +V  + +     K               
Sbjct  407  SSSLRSYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIK  466

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ +
Sbjct  467  RAVSWVGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVN  526

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI +   SI F   P     AC
Sbjct  527  SPIYITHLSIAFIVFPNFSARAC  549



>ref|XP_007209868.1| hypothetical protein PRUPE_ppa003813mg [Prunus persica]
 gb|EMJ11067.1| hypothetical protein PRUPE_ppa003813mg [Prunus persica]
Length=547

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 115/197 (58%), Gaps = 0/197 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  L+ + + 
Sbjct  343  LDQLGMSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLAVNSNA  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHCA+   GIT++LINL ++T    NV     F             +      
Sbjct  403  SADLRIYAHCARGRAGITVVLINLSNDTDFIVNVENILDFNLGAHERNISKESYFKRSLK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R      + REEYHLT K  +L S+TM+LNG  L +   G+IPE++P  + ++
Sbjct  463  KTVSWVGRKALDKPVYREEYHLTPKNRNLRSKTMVLNGAPLEITKDGNIPELEPARVFAN  522

Query  341  EPITVAPFSIVFAHIPY  291
             P+T++P SI F  +PY
Sbjct  523  SPLTISPLSIKFVVLPY  539



>ref|XP_006477619.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477620.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Citrus 
sinensis]
 gb|KDO54578.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54579.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54580.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
 gb|KDO54581.1| hypothetical protein CISIN_1g008834mg [Citrus sinensis]
Length=543

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 113/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G
Sbjct  339  LDQLGMSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDG  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC+K+  GITLLLINL + T    +V  + +     K               
Sbjct  399  SSSLRSYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIK  458

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ +
Sbjct  459  RAVSWVGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVN  518

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI +   SI F   P     AC
Sbjct  519  SPIYITHLSIAFIVFPNFSARAC  541



>ref|XP_009395254.1| PREDICTED: heparanase-like protein 1, partial [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 115/205 (56%), Gaps = 26/205 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ+LIGGNY LL+TTTFVPNPD+Y ALLWH+LMG   L T+  G
Sbjct  326  LDQLGMASTYNHKVYCRQSLIGGNYCLLDTTTFVPNPDFYGALLWHQLMGPGVLHTTNDG  385

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC+K+  G+TLLLINL ++T  +  V  +                       
Sbjct  386  SPYLRAYAHCSKKKSGVTLLLINLSNSTAFDVVVTSD-----------------------  422

Query  521  shgkGSPRS--QKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                  PRS  ++     REEYHLTA+GGDL S  MLLNG  L +  S  IP M+P  ++
Sbjct  423  -LNLYQPRSGNEQGQHGEREEYHLTAQGGDLRSSEMLLNGKLLKLTPSFEIPHMEPSIVS  481

Query  347  SSEPITVAPFSIVFAHIPYVFLPAC  273
            +  P+T+AP SI F        PAC
Sbjct  482  AGAPLTIAPLSIAFVRFKDFQAPAC  506



>ref|XP_006440691.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53931.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=543

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 113/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G
Sbjct  339  LDQLGMSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDG  398

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC+K+  GITLLLINL + T    +V  + +     K               
Sbjct  399  SSSLRSYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIK  458

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ +
Sbjct  459  RAVSWVGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVN  518

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI +   SI F   P     AC
Sbjct  519  SPIYITHLSIAFIVFPNFSARAC  541



>ref|XP_010096576.1| Heparanase-like protein 2 [Morus notabilis]
 gb|EXB65076.1| Heparanase-like protein 2 [Morus notabilis]
Length=453

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 119/205 (58%), Gaps = 28/205 (14%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ  IGGNYGLLNTTTFVPNPDYY ALLWHRLMG+  L TS +G
Sbjct  274  LDQLGMASTLNHKVYCRQAFIGGNYGLLNTTTFVPNPDYYGALLWHRLMGKEVLKTSHNG  333

Query  701  TKKIRAYAHCAKQS-GGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhs  525
            +  +RAY+HC++Q   G+TLLLINL ++T  +  +A + +                    
Sbjct  334  SPYLRAYSHCSRQQRPGVTLLLINLSNSTFFDVAIAEDSN--------------------  373

Query  524  hshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSV-DSSGSIPEMKPRYLN  348
                    RSQ      REEYHLTAK GD+ S  +LLNG+ L + +SS  IP+M+P  ++
Sbjct  374  AHRKLFESRSQ------REEYHLTAKDGDIQSDVVLLNGSPLQLTNSSDIIPQMQPVLVD  427

Query  347  SSEPITVAPFSIVFAHIPYVFLPAC  273
            SS  I VAP S VF  +  +   AC
Sbjct  428  SSSAIRVAPHSFVFVVLKDIKARAC  452



>ref|XP_004985229.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004985230.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Setaria 
italica]
Length=540

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 116/203 (57%), Gaps = 3/203 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS     
Sbjct  340  LDQLGMASKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSIDSIA  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             +++RAYAHC +Q  GITLLLINL SNTT       N   +  R  +   +   H     
Sbjct  400  PRRLRAYAHCRRQQQGITLLLINL-SNTTGYNVTLQNDINIGKRPDLEKRSSFSHRLRKA  458

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                GS  S    T  REEYHLT K GD+ S+TMLLNG +L +   GS+P M P      
Sbjct  459  VSWLGSKASSD--TKKREEYHLTPKDGDVQSKTMLLNGVQLELGDDGSVPAMNPVLAAVD  516

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  517  SPVYLAPTSIAFIVLPEFEAKAC  539



>ref|XP_008805083.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
 ref|XP_008805084.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
 ref|XP_008805085.1| PREDICTED: heparanase-like protein 2 [Phoenix dactylifera]
Length=528

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 116/203 (57%), Gaps = 19/203 (9%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K +CRQ LIGGNY LLNTTTF+PNPD+YSALLWHRLMG   L  +   
Sbjct  342  LDQLGMVSTFKHKVFCRQALIGGNYALLNTTTFIPNPDFYSALLWHRLMGPGVLHATHQS  401

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAYAHC+KQ  G+TLLLINL ++T+ +  V+ + +           +         
Sbjct  402  SPFLRAYAHCSKQKPGVTLLLINLSNSTSFDVTVSSDLNLYPPLLTESLASVT-------  454

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                      ++G   REEYHLT +GG++ S+ +LLNG  L   S G IPEM P   +++
Sbjct  455  ----------EKG--QREEYHLTPQGGNIQSRVLLLNGQPLKPTSDGQIPEMSPFIADAA  502

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ VAP+SIVF        PAC
Sbjct  503  APLHVAPYSIVFVRFKDFKAPAC  525



>ref|XP_009801838.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801839.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801840.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801841.1| PREDICTED: heparanase-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=539

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 119/206 (58%), Gaps = 5/206 (2%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQT IGGNYGLL+T+TF+PNPDYYSALLWHRLMG+   + S + 
Sbjct  337  LDQLGMAAKYHTKVYCRQTFIGGNYGLLDTSTFIPNPDYYSALLWHRLMGKGVFAVSSNS  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC +   G+TLLLINL + T    ++    S VH   H    ++H       
Sbjct  397  SSYLRSYAHCTRNRAGVTLLLINLSNQTQYRVSIE---SSVHTSSHANEKSNHKKSFIHG  453

Query  521  shgkGSPRSQKRG--TMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                 S    K    T++REEYHLT   G+LHS+TMLLNG  L +   G IP + P  +N
Sbjct  454  LKKTFSWVGSKSSDVTLSREEYHLTPLNGNLHSKTMLLNGLPLQLTEIGDIPSLSPVLVN  513

Query  347  SSEPITVAPFSIVFAHIPYVFLPACR  270
               PI+VAP SI F   P    P CR
Sbjct  514  IVSPISVAPLSIKFIVFPNYNSPGCR  539



>gb|KJB74275.1| hypothetical protein B456_011G2845002, partial [Gossypium raimondii]
Length=246

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 112/203 (55%), Gaps = 22/203 (11%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ L GGNY LL TTTFVPNPDYY ALLWHR+MG   LS +  G
Sbjct  65   LDQLGMTSVYNHKVYCRQALTGGNYALLKTTTFVPNPDYYGALLWHRVMGSKVLSVTHKG  124

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R Y+HCAK+  G++ + INL  NT+ E N+ ++ +                     
Sbjct  125  SPYLRVYSHCAKKEPGVSFVFINLSKNTSFEINLYHDQNL--------------------  164

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                GSP  + +G   REEYHLT K G++ S  +LLNG  L +  S  IPE+KP+ ++  
Sbjct  165  --NGGSPNFEFKGHKKREEYHLTPKDGNILSSIVLLNGTPLELSDSLEIPELKPKLVDGL  222

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
            + I++A  SI F  I     PAC
Sbjct  223  KTISIATHSIAFVTIIDFNAPAC  245



>ref|XP_006374166.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51963.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
Length=476

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 119/217 (55%), Gaps = 29/217 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K YCRQTL+GG+YGLLNTTT VPNPDYYSALLWHRLMG+  L+   + 
Sbjct  274  LDQLGMASRYNTKVYCRQTLVGGHYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSNA  333

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNT--------------TVEANVAYNGSFVhhrkh  564
            +  +R+YAHC+K   GITLLLINL + T              TVE N++   SFV     
Sbjct  334  SPFLRSYAHCSKGRAGITLLLINLSNQTDFIISVQNSMDMRLTVEENISGENSFV-----  388

Query  563  irhinhhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSS  384
                          S      R+     + REEYHLTAK G+L S+TM+LNG  L +   
Sbjct  389  ---------RGLKRSVSWVGSRASDE-PLYREEYHLTAKDGNLQSRTMVLNGIPLELTED  438

Query  383  GSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             +IP + P  L+ + P+ + P SI F   P    PAC
Sbjct  439  ENIPSLDPVRLDVNSPLYINPLSISFIVFPNFDAPAC  475



>ref|XP_008785953.1| PREDICTED: heparanase-like protein 2 isoform X2 [Phoenix dactylifera]
Length=539

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 119/217 (55%), Gaps = 29/217 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQTLIGGNYGLL+T TF+PNPDYYSALLW+RLMG   LS   SG
Sbjct  337  LDQLGMASKYNTRVYCRQTLIGGNYGLLDTKTFIPNPDYYSALLWNRLMGNGVLSIDLSG  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNT----TVEANVAYN----------GSFVhhrkh  564
            +  +RAYAHC K+  G++LLLINL  +T    TV  ++  N          GSFVH  K 
Sbjct  397  SSYLRAYAHCRKRKSGVSLLLINLSKSTEFIVTVRNDINVNLAEGGGIQRDGSFVHGLKR  456

Query  563  irhinhhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSS  384
                                 R     + TREEYHLTAK G+  SQT+LLNG  L +   
Sbjct  457  TVSWVG---------------RRASDQSETREEYHLTAKDGNHLSQTVLLNGTPLELTED  501

Query  383  GSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
            G IP + P    ++ PI++AP SI F   P     AC
Sbjct  502  GDIPPLNPVLTAANSPISIAPLSIAFVVFPKFEAQAC  538



>ref|XP_010258149.1| PREDICTED: heparanase-like protein 1 isoform X4 [Nelumbo nucifera]
Length=537

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 111/203 (55%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     
Sbjct  334  LDQLGMASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDA  393

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC+K   GITLLLINL + T     V  + +    R            H   
Sbjct  394  SPFLRVYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLK  453

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++  
Sbjct  454  RTVSWVGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVE  513

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+VAP SI F  +P+    AC
Sbjct  514  SPISVAPLSIAFVALPHFEAAAC  536



>ref|XP_010258146.1| PREDICTED: heparanase-like protein 1 isoform X1 [Nelumbo nucifera]
Length=544

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 111/203 (55%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     
Sbjct  341  LDQLGMASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDA  400

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC+K   GITLLLINL + T     V  + +    R            H   
Sbjct  401  SPFLRVYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLK  460

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++  
Sbjct  461  RTVSWVGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVE  520

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+VAP SI F  +P+    AC
Sbjct  521  SPISVAPLSIAFVALPHFEAAAC  543



>ref|XP_010258148.1| PREDICTED: heparanase-like protein 1 isoform X3 [Nelumbo nucifera]
Length=540

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 111/203 (55%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     
Sbjct  337  LDQLGMASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC+K   GITLLLINL + T     V  + +    R            H   
Sbjct  397  SPFLRVYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLK  456

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++  
Sbjct  457  RTVSWVGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVE  516

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+VAP SI F  +P+    AC
Sbjct  517  SPISVAPLSIAFVALPHFEAAAC  539



>ref|XP_010258147.1| PREDICTED: heparanase-like protein 1 isoform X2 [Nelumbo nucifera]
Length=543

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 111/203 (55%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQTLIGGNYGLLN TTFVPNPD+YSALLWHRLMG++ L+     
Sbjct  340  LDQLGMASKYNTRAYCRQTLIGGNYGLLNLTTFVPNPDFYSALLWHRLMGKSVLTVDSDA  399

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC+K   GITLLLINL + T     V  + +    R            H   
Sbjct  400  SPFLRVYAHCSKGRAGITLLLINLSNQTDFRITVQNDININVRRGEQTIQRKGSFIHGLK  459

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R     T  REEY LT   G + SQTM+LNG  L +  +G IP + P  ++  
Sbjct  460  RTVSWVGRRASDITTMREEYRLTPMDGQIRSQTMVLNGTPLELTENGDIPALDPVLVDVE  519

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI+VAP SI F  +P+    AC
Sbjct  520  SPISVAPLSIAFVALPHFEAAAC  542



>ref|XP_011013080.1| PREDICTED: heparanase-like protein 1 isoform X2 [Populus euphratica]
Length=417

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 118/217 (54%), Gaps = 29/217 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K YCRQTL+GGNYGLLNTTT VPNPDYYSALLWHRLMG+  L+   + 
Sbjct  215  LDQLGMASRYNTKVYCRQTLVGGNYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSNA  274

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNT--------------TVEANVAYNGSFVhhrkh  564
            +  +R+YAHC+K   GITLLLINL + T              TVE N++   SF+   K 
Sbjct  275  SPFLRSYAHCSKGRAGITLLLINLSNQTDFIISVQNSMDMRLTVEENISGENSFMRGLKR  334

Query  563  irhinhhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSS  384
                  +              R+     M REEYHLTAK G L S TM+LNG  L +   
Sbjct  335  SVSWVGN--------------RASDE-PMYREEYHLTAKDGYLQSPTMVLNGIPLELTED  379

Query  383  GSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             +IP + P  L+ + P+ + P SI F   P    PAC
Sbjct  380  ENIPNLDPVRLDLNSPLYINPLSISFIVFPNFDAPAC  416



>ref|XP_006440690.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
 gb|ESR53930.1| hypothetical protein CICLE_v10019304mg [Citrus clementina]
Length=628

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 113/203 (56%), Gaps = 0/203 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTL+GGNYGLLN TTF+PNPDYYSALLWHRLMG+  LS +  G
Sbjct  424  LDQLGMSSKYNTKVYCRQTLVGGNYGLLNATTFIPNPDYYSALLWHRLMGKGVLSVATDG  483

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R+YAHC+K+  GITLLLINL + T    +V  + +     K               
Sbjct  484  SSSLRSYAHCSKEREGITLLLINLSNQTDYVISVHNSMNMKLTVKGKDINGESSLSRDIK  543

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                    +   G +TREEYHLT K G L SQTM+LNG  L +     IP++ P  ++ +
Sbjct  544  RAVSWVGSTASDGHLTREEYHLTPKDGYLQSQTMVLNGIPLQLAEDEGIPKLDPVRVDVN  603

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI +   SI F   P     AC
Sbjct  604  SPIYITHLSIAFIVFPNFSARAC  626



>ref|XP_006574930.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Glycine 
max]
Length=513

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 113/203 (56%), Gaps = 26/203 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG       K YCRQ L+GGNYGLL+TTTF+PNPDYY ALLWHRLMG   LS S  G
Sbjct  336  LDQLGMTSTFNHKVYCRQALVGGNYGLLDTTTFIPNPDYYGALLWHRLMGSKVLSVSHEG  395

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY HC+K   GI +LLIN+ ++TT E ++  + +                     
Sbjct  396  SPYLRAYVHCSKTESGIAVLLINMSNSTTFEVSLLNDMNLY-------------------  436

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                  P    + T  REEYHLT K G++ S+ +LLNG  L +  S  IPEMKP+ ++ S
Sbjct  437  ------PEVVFKNTQ-REEYHLTPKDGNIQSKVVLLNGTPLVLTQSLHIPEMKPKLVDPS  489

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ V   SIVF H      PAC
Sbjct  490  SPVKVKHDSIVFVHSKSFNAPAC  512



>ref|XP_007209866.1| hypothetical protein PRUPE_ppa003804mg [Prunus persica]
 gb|EMJ11065.1| hypothetical protein PRUPE_ppa003804mg [Prunus persica]
Length=547

 Score =   165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 115/197 (58%), Gaps = 0/197 (0%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   + YCRQ+L+GGNYGLLN T+FVPNPDYYSALLWHRLMG+  L+ + + 
Sbjct  343  LDQLGMSAKYNTRVYCRQSLVGGNYGLLNRTSFVPNPDYYSALLWHRLMGQGVLAVNSNA  402

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHCA+   G+T++LINL ++T    NV     F             +      
Sbjct  403  SADLRTYAHCARGRAGVTVVLINLSNDTDFIVNVENILDFNLGAHERNISKESYFKRSLK  462

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
                   R      + REEYHLT K  +L S+TM+LNG  L +   G+IPE++P  + ++
Sbjct  463  KTVSWVGRKALDKPVYREEYHLTPKNRNLRSKTMVLNGAPLEITKDGNIPELEPARVLAN  522

Query  341  EPITVAPFSIVFAHIPY  291
             P+T++P SI F  +PY
Sbjct  523  SPLTISPLSIKFVVLPY  539



>ref|XP_006374165.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 ref|XP_002321464.2| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 ref|XP_006374167.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51962.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|EEF05591.2| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
 gb|ERP51964.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa]
Length=539

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 119/217 (55%), Gaps = 29/217 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   R   K YCRQTL+GG+YGLLNTTT VPNPDYYSALLWHRLMG+  L+   + 
Sbjct  337  LDQLGMASRYNTKVYCRQTLVGGHYGLLNTTTLVPNPDYYSALLWHRLMGKGVLAVGSNA  396

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNT--------------TVEANVAYNGSFVhhrkh  564
            +  +R+YAHC+K   GITLLLINL + T              TVE N++   SFV     
Sbjct  397  SPFLRSYAHCSKGRAGITLLLINLSNQTDFIISVQNSMDMRLTVEENISGENSFV-----  451

Query  563  irhinhhhhhhhshshgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSS  384
                          S      R+     + REEYHLTAK G+L S+TM+LNG  L +   
Sbjct  452  ---------RGLKRSVSWVGSRASDE-PLYREEYHLTAKDGNLQSRTMVLNGIPLELTED  501

Query  383  GSIPEMKPRYLNSSEPITVAPFSIVFAHIPYVFLPAC  273
             +IP + P  L+ + P+ + P SI F   P    PAC
Sbjct  502  ENIPSLDPVRLDVNSPLYINPLSISFIVFPNFDAPAC  538



>ref|XP_010068782.1| PREDICTED: heparanase-like protein 1 [Eucalyptus grandis]
 gb|KCW64898.1| hypothetical protein EUGRSUZ_G02460 [Eucalyptus grandis]
Length=521

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 117/205 (57%), Gaps = 27/205 (13%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQ LIGGNYGLLNTT+FVPNPDYY ALLWHRLMG++ L+T   G
Sbjct  341  LDQLGMTSQFNHKVFCRQALIGGNYGLLNTTSFVPNPDYYGALLWHRLMGKHVLATMHDG  400

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +RAY+HC+K   G++L+LIN+ ++T+   +V  + +                     
Sbjct  401  SAHLRAYSHCSKDKPGVSLILINMSNSTSFNVSVVNDLNIY-------------------  441

Query  521  shgkGSPRSQKR--GTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLN  348
                  P  ++   G   REEYHLT K G++ S  +LLNG  L +     IPEMKP  ++
Sbjct  442  ------PAVEQACGGRQPREEYHLTPKDGNIQSDVLLLNGTPLELTELSDIPEMKPELVD  495

Query  347  SSEPITVAPFSIVFAHIPYVFLPAC  273
             S PI VA  SIV+A +     PAC
Sbjct  496  PSLPIAVAADSIVYATLRDFRAPAC  520



>ref|XP_007037489.1| Glucuronidase 2 isoform 3 [Theobroma cacao]
 gb|EOY21990.1| Glucuronidase 2 isoform 3 [Theobroma cacao]
Length=423

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 114/203 (56%), Gaps = 2/203 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K YCRQTLIGGNYGLLN TT+VPNPDYYSALLWHRLMG+  L+     
Sbjct  222  LDQLGMASKYHTKVYCRQTLIGGNYGLLNATTYVPNPDYYSALLWHRLMGKVVLAVDSDA  281

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
            +  +R YAHC+K   G+TLLLINL   T    +V  + +     K          H    
Sbjct  282  SSFLRTYAHCSKGRAGVTLLLINLSKQTKFIMDVQNSINIKLAVKEENISPDSFTHSLKK  341

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +      ++     + REEYHLT K G L S+TM+LNG  L  D +G+IP + P  +N  
Sbjct  342  TFSWVGVKASDE-PLLREEYHLTPKNGYLQSRTMVLNGVPLLTD-AGNIPRLDPIRVNVM  399

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             PI++AP SI F   P    PAC
Sbjct  400  SPISLAPLSIAFIVFPNFDAPAC  422



>dbj|BAJ97219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 113/203 (56%), Gaps = 3/203 (1%)
 Frame = -2

Query  881  LTSLGCQPRTIQKTYCRQTLIGGNYGLLNTTTFVPNPDYYSALLWHRLMGRNALSTSFSG  702
            L  LG   +   K +CRQTLIGGNYGLL+T TF+PNPDYYSALLWHRLMG   LS   + 
Sbjct  341  LDQLGMSSKYNTKVFCRQTLIGGNYGLLDTQTFLPNPDYYSALLWHRLMGNGVLSVDINA  400

Query  701  TKKIRAYAHCAKQSGGITLLLINLDSNTTVEANVAYNGSFVhhrkhirhinhhhhhhhsh  522
             +K+RAYAHC+K+  GITLLLINL ++T    NV          +       H       
Sbjct  401  PRKLRAYAHCSKRHKGITLLLINLSNSTGY--NVTLQNDLNVSVERGSGHRRHRGGGLRR  458

Query  521  shgkGSPRSQKRGTMTREEYHLTAKGGDLHSQTMLLNGNELSVDSSGSIPEMKPRYLNSS  342
            +      ++    T  R+EYHLTAK GD  S+TMLLNG  L +   G +P M P      
Sbjct  459  AVSWLGSKTSSEST-KRDEYHLTAKDGDHQSRTMLLNGLPLELGDDGGVPAMNPVPAAVD  517

Query  341  EPITVAPFSIVFAHIPYVFLPAC  273
             P+ +AP SI F  +P     AC
Sbjct  518  SPVHLAPTSIAFVVLPRFEAKAC  540



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2200264392382