BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12400

Length=900
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABV44808.1|  phenylalanine ammonia lyase 1                           386   2e-130   Eriobotrya japonica [loquat]
gb|ACV30588.1|  phenylalanine ammonia-lyase                             384   3e-130   Carica papaya [mamon]
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             382   3e-130   Pyrus pyrifolia [sha li]
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 392   9e-129   Coffea canephora [robusta coffee]
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           391   2e-128   Glycine soja [wild soybean]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      394   3e-128   
ref|XP_007027354.1|  PHE ammonia lyase 1                                394   3e-128   Theobroma cacao [chocolate]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     393   6e-128   Nicotiana tomentosiformis
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    392   2e-127   Glycine max [soybeans]
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              392   2e-127   Ricinus communis
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        391   2e-127   Nicotiana sylvestris
gb|AFP49806.1|  phenylalanine ammonialyase 1                            391   2e-127   Coffea arabica [arabica coffee]
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             389   3e-127   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           391   3e-127   Coffea arabica [arabica coffee]
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 391   3e-127   Coffea canephora [robusta coffee]
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 391   3e-127   Pyrus x bretschneideri [bai li]
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       380   5e-127   Vitis vinifera
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           387   7e-127   Glycine soja [wild soybean]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             390   8e-127   Gossypium arboreum [tree cotton]
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             389   9e-127   
dbj|BAD94354.1|  phenylalanine ammonia lyase                            378   1e-126   Arabidopsis thaliana [mouse-ear cress]
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       372   2e-126   Malus domestica [apple tree]
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             375   2e-126   Vitis vinifera
gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           388   3e-126   Ipomoea purpurea
gb|AEJ88223.1|  phenylalanine ammonia lyase                             388   4e-126   Prunus persica
gb|ACF94717.1|  phenylalanine ammonia lyase                             374   4e-126   Robinia pseudoacacia [black locust]
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 375   5e-126   Manihot esculenta [manioc]
gb|AAR31107.1|  phenylalanine ammonia-lyase                             388   5e-126   Quercus suber [cork oak]
gb|AEW43005.1|  phenylalanine ammonia lyase                             376   6e-126   Leucaena leucocephala [cassie]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   388   7e-126   Citrus sinensis [apfelsine]
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     387   8e-126   Nicotiana sylvestris
gb|AIB06732.1|  phenylalanine ammonia lyase                             387   9e-126   Mangifera indica
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             387   9e-126   Citrus clementina [clementine]
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           387   9e-126   Prunus mume [ume]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           387   1e-125   Manihot esculenta [manioc]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             387   1e-125   Hibiscus cannabinus [bimli-jute]
gb|ACC63889.1|  phenylalanine ammonia-lyase                             387   2e-125   Populus trichocarpa [western balsam poplar]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    387   2e-125   Gossypium raimondii
gb|AJR20994.1|  phenylalanine ammonia-lyase                             386   2e-125   Populus szechuanica
gb|AGH13333.1|  phenylalanine ammonia-lyase                             386   3e-125   Rhus chinensis
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           386   3e-125   Malus domestica [apple tree]
gb|AET41698.1|  phenylalanine ammonia-lyase                             372   4e-125   Prunus salicina [Japanese plum]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    385   5e-125   Gossypium raimondii
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      385   6e-125   Glycine max [soybeans]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       385   7e-125   Citrus limon [lemon]
dbj|BAH20339.1|  AT3G53260                                              380   9e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         385   9e-125   Populus trichocarpa [western balsam poplar]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             384   9e-125   Populus tomentosa [Chinese white poplar]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    384   1e-124   Gossypium raimondii
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             384   1e-124   Nicotiana tomentosiformis
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      384   1e-124   Arabidopsis lyrata subsp. lyrata
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      384   2e-124   Camelina sativa [gold-of-pleasure]
emb|CDY18464.1|  BnaA04g21230D                                          375   2e-124   Brassica napus [oilseed rape]
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             384   2e-124   Capsella rubella
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             384   2e-124   Gossypium arboreum [tree cotton]
gb|AAQ74878.1|  phenylalanine ammonia lyase                             384   2e-124   Populus trichocarpa x Populus deltoides
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           384   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      384   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             383   3e-124   Vitis vinifera
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          383   4e-124   Populus euphratica
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          383   5e-124   Vitis vinifera
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      383   5e-124   Cicer arietinum [garbanzo]
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             383   6e-124   Eutrema salsugineum [saltwater cress]
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     382   8e-124   Nicotiana tomentosiformis
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             382   8e-124   Vitis vinifera
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         382   9e-124   Arabidopsis thaliana [mouse-ear cress]
gb|AAC18871.1|  phenylalanine ammonia lyase                             382   1e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAM12956.1|  phenylalanine ammonia-lyase                             382   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             382   1e-123   Capsella rubella
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       382   1e-123   Ipomoea batatas [batate]
gb|ACF94715.1|  phenylalanine ammonia lyase                             369   1e-123   Robinia pseudoacacia [black locust]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             382   1e-123   Epimedium sagittatum
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       366   1e-123   Cucumis sativus [cucumbers]
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            366   2e-123   Glehnia littoralis
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             382   2e-123   Nelumbo nucifera [Indian lotus]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        381   2e-123   Populus euphratica
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        375   2e-123   
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      381   2e-123   Brassica rapa
gb|ABM67591.1|  phenylalanin ammonia-lyase                              381   2e-123   Vitis vinifera
gb|ABF50788.1|  phenylalanine ammonia-lyase                             381   3e-123   Isatis tinctoria [woad]
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             380   3e-123   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             379   3e-123   Vigna unguiculata
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             381   3e-123   Gossypium arboreum [tree cotton]
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           381   3e-123   Brassica rapa
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        380   3e-123   Vitis vinifera
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             381   3e-123   
gb|AAC33966.1|  phenylalanine ammonia-lyase                             375   3e-123   Capsicum chinense [bonnet pepper]
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            364   4e-123   Phaseolus vulgaris [French bean]
gb|AAC18870.1|  phenylalanine ammonia lyase                             381   4e-123   Arabidopsis thaliana [mouse-ear cress]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       380   4e-123   Ipomoea batatas [batate]
gb|ABC69916.1|  phenylalanine ammonia-lyase                             380   4e-123   Brassica napus [oilseed rape]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           380   4e-123   Nicotiana attenuata
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           380   4e-123   Brassica rapa
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             380   5e-123   Nicotiana tomentosiformis
gb|ACM62741.1|  phenylalanine ammonia-lyase                             380   5e-123   Garcinia mangostana [mangosteen]
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         380   5e-123   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    380   6e-123   Arabis alpina [alpine rockcress]
gb|AAX22053.1|  phenylalanine ammonia-lyase                             380   7e-123   Brassica napus [oilseed rape]
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            380   7e-123   Brassica oleracea var. botrytis [cauliflower]
gb|ACZ36441.1|  phenylalanine ammonialyase                              380   7e-123   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             380   7e-123   Populus tomentosa [Chinese white poplar]
gb|ACT22906.1|  phenylalanine ammonia-lyase                             375   8e-123   Salvia miltiorrhiza [Chinese salvia]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             379   8e-123   Vitis vinifera
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   379   8e-123   Ipomoea nil [qian niu]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           380   9e-123   
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         379   9e-123   Populus trichocarpa [western balsam poplar]
gb|ADY02660.1|  phenylalanine ammonia lyase                             379   9e-123   Parrya nudicaulis
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    379   9e-123   
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        379   9e-123   Vitis vinifera
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        379   1e-122   Vitis vinifera
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             379   1e-122   Vitis vinifera
gb|ADA81868.1|  phenylalanine ammonia-lyase                             380   1e-122   Brassica rapa subsp. chinensis [bok-choy]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       379   1e-122   Camellia sinensis [black tea]
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           380   1e-122   Camelina sativa [gold-of-pleasure]
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            364   1e-122   Glehnia littoralis
gb|AFG30054.1|  phenylalanine ammonialyase                              379   1e-122   Malus hybrid cultivar
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             379   1e-122   Nicotiana sylvestris
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     379   1e-122   Prunus avium [gean]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              379   2e-122   Ricinus communis
gb|AFC37247.1|  phenylalanine ammonia-lyase                             365   2e-122   Camellia chekiangoleosa
gb|AAU08174.1|  phenylalanine ammonia-lyase                             379   2e-122   Camellia sinensis [black tea]
gb|AIB08913.1|  phenylalanine ammonia-lyase                             362   2e-122   Angelica sinensis [Chinese angelica]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           378   2e-122   Nicotiana attenuata
gb|ADY02661.1|  phenylalanine ammonia lyase                             377   2e-122   Parrya nudicaulis
gb|AGF50184.1|  phenylalanine ammonia lyase                             364   3e-122   Salvia virgata
gb|ABC69917.1|  phenylalanine ammonia-lyase                             378   3e-122   Brassica napus [oilseed rape]
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             378   3e-122   Vitis vinifera
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    378   3e-122   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             378   3e-122   Pyrus x bretschneideri [bai li]
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        378   3e-122   Vitis vinifera
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 378   3e-122   Pyrus x bretschneideri [bai li]
gb|AGF50183.1|  phenylalanine ammonia lyase                             363   4e-122   Salvia hypoleuca
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     375   4e-122   Glycine soja [wild soybean]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             378   4e-122   Morus alba
gb|AAX22055.1|  phenylalanine ammonia-lyase                             378   4e-122   Brassica napus [oilseed rape]
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    378   4e-122   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      369   4e-122   
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           375   4e-122   Glycine soja [wild soybean]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           378   5e-122   Prunus mume [ume]
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       375   5e-122   Persea americana
emb|CAN61378.1|  hypothetical protein VITISV_032212                     377   5e-122   Vitis vinifera
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             377   5e-122   Vitis vinifera
gb|AEY94464.1|  phenylalanine ammonia-lyase                             365   5e-122   Prunella vulgaris
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   377   5e-122   Populus tremuloides
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    377   6e-122   Pyrus x bretschneideri [bai li]
ref|XP_012082374.1|  PREDICTED: phenylalanine ammonia-lyase             377   6e-122   Jatropha curcas
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           377   6e-122   
gb|AAY82485.1|  phenylalanine ammonia-lyase                             371   6e-122   Ulmus americana
gb|AID16077.1|  phenylalanine ammonium lyase                            377   7e-122   Morus alba
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      377   8e-122   
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             363   8e-122   
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       377   9e-122   Nicotiana tabacum [American tobacco]
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    377   9e-122   Arabis alpina [alpine rockcress]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       377   1e-121   Nicotiana tabacum [American tobacco]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             377   1e-121   Nicotiana sylvestris
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             377   1e-121   Vitis vinifera
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             377   1e-121   Solanum lycopersicum
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             377   1e-121   Eutrema salsugineum [saltwater cress]
gb|AGL50914.1|  phenylalanine ammonia lyase                             377   1e-121   Pyrus communis
gb|AGL81344.1|  phenylalanine ammonia lyase                             377   1e-121   Pyrus communis
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             377   1e-121   Gossypium arboreum [tree cotton]
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    377   1e-121   
gb|ACM44926.1|  phenylalanine ammonia-lyase                             377   1e-121   Euphorbia pulcherrima
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             377   1e-121   Gossypium arboreum [tree cotton]
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    377   1e-121   Brassica rapa
gb|ACS71953.1|  phenylalanine ammonia-lyase                             377   1e-121   Euphorbia pulcherrima
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      377   1e-121   Camelina sativa [gold-of-pleasure]
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            363   1e-121   Lotus japonicus
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 376   2e-121   Manihot esculenta [manioc]
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    376   2e-121   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      376   2e-121   
gb|AEX32790.1|  phenylalanine ammonia-lyase                             376   2e-121   Vitis vinifera
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         376   2e-121   Populus trichocarpa [western balsam poplar]
emb|CDX91331.1|  BnaC04g08190D                                          365   2e-121   
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   366   2e-121   Citrus sinensis [apfelsine]
ref|XP_011658466.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      371   2e-121   Cucumis sativus [cucumbers]
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       371   2e-121   Cucumis sativus [cucumbers]
gb|KJB16792.1|  hypothetical protein B456_002G248000                    376   2e-121   Gossypium raimondii
gb|ACE95170.1|  phenylalanine ammonia-lyase                             376   2e-121   Populus tomentosa [Chinese white poplar]
gb|KJB46526.1|  hypothetical protein B456_007G373700                    375   2e-121   Gossypium raimondii
gb|ABB70117.2|  phenylalanine ammonia lyase                             376   2e-121   Pyrus communis
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    376   2e-121   Capsicum annuum
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             376   2e-121   Phaseolus vulgaris [French bean]
gb|AFP24940.1|  phenylalanine ammonia lyase                             376   2e-121   Prunus salicina [Japanese plum]
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            361   2e-121   Glehnia littoralis
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   376   3e-121   Populus tremuloides
gb|KJB46525.1|  hypothetical protein B456_007G373600                    376   3e-121   Gossypium raimondii
emb|CAN77065.1|  hypothetical protein VITISV_009233                     375   3e-121   Vitis vinifera
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           376   3e-121   Tarenaya hassleriana [spider flower]
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      376   3e-121   Camelina sativa [gold-of-pleasure]
gb|ADY02662.1|  phenylalanine ammonia lyase                             375   3e-121   Parrya nudicaulis
ref|XP_012082376.1|  PREDICTED: phenylalanine ammonia-lyase-like        375   3e-121   Jatropha curcas
gb|AEE81750.1|  phenylalanine ammonia lyase                             376   3e-121   Morus alba var. multicaulis
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         375   3e-121   Jatropha curcas
gb|AGY49231.1|  phenylalanine ammonia lyase                             375   3e-121   Ricinus communis
gb|AER12109.1|  PAL                                                     375   3e-121   Gossypium hirsutum [American cotton]
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    375   3e-121   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             376   3e-121   Brassica rapa subsp. chinensis [bok-choy]
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          363   4e-121   Cynara cardunculus var. scolymus [artichoke]
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        375   4e-121   Medicago truncatula
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 376   4e-121   Rubus idaeus [European raspberry]
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    371   5e-121   Populus sieboldii x Populus grandidentata
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   370   5e-121   Citrus sinensis [apfelsine]
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    365   5e-121
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    375   6e-121   Populus euphratica
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        375   6e-121   
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    371   6e-121
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             375   7e-121   Prunus persica
emb|CDX74991.1|  BnaA05g07370D                                          364   7e-121   
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         374   8e-121   Populus euphratica
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       374   8e-121   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      369   1e-120   
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    373   1e-120   Populus sieboldii x Populus grandidentata
gb|ADR78835.1|  phenylalanine ammonia lyase                             369   1e-120   Ziziphus jujuba [Chinese jujube]
gb|ACR15762.1|  phenylalanine ammonia-lyase                             374   1e-120   Litchi chinensis [litchi]
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             374   2e-120   Phaseolus vulgaris [French bean]
gb|ABV71917.1|  PAL                                                     357   2e-120   Plectranthus scutellarioides
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    374   2e-120   Phaseolus vulgaris [French bean]
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           373   2e-120   Glycine soja [wild soybean]
gb|AAY82486.1|  phenylalanine ammonia-lyase                             371   2e-120   Ulmus pumila [dwarf elm]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       374   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      374   2e-120   Tarenaya hassleriana [spider flower]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           374   2e-120   Fragaria vesca subsp. vesca
gb|AGE10589.1|  phenylalanine amononia-lyase                            373   2e-120   Lonicera japonica [Japanese honeysuckle]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      373   2e-120   
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         373   3e-120   Populus trichocarpa [western balsam poplar]
gb|ACF94716.1|  phenylalanine ammonia lyase                             373   3e-120   Robinia pseudoacacia [black locust]
gb|AAM28276.1|  phenylalanine ammonia-lyase                             359   3e-120   Ananas comosus
gb|AGF50182.1|  phenylalanine ammonia lyase                             358   3e-120   Salvia officinalis
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    373   3e-120   Solanum lycopersicum
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    374   4e-120   Populus euphratica
gb|AIA66448.1|  PAL1                                                    373   4e-120   Capsicum annuum
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             372   5e-120   Cucumis melo [Oriental melon]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             373   5e-120   Solanum tuberosum [potatoes]
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      373   5e-120   Tarenaya hassleriana [spider flower]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        372   5e-120   Medicago truncatula
dbj|BAA95629.1|  phenylalanine ammonia lyase                            372   5e-120   Catharanthus roseus [chatas]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     372   5e-120   Glycine max [soybeans]
gb|ACT32033.1|  phenylalanine ammonia-lyase                             372   6e-120   Glycine soja [wild soybean]
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             372   6e-120   Populus tomentosa [Chinese white poplar]
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        372   9e-120   Cucumis melo [Oriental melon]
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   372   1e-119   Citrus sinensis [apfelsine]
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             372   1e-119   Citrus clementina [clementine]
gb|AFI71896.1|  phenylalanine ammonia-lyase                             371   1e-119   Paeonia lactiflora [common garden peony]
gb|AFG26322.1|  phenylalanine ammonia-lyase                             371   1e-119   Cinnamomum osmophloeum
gb|AJO53273.1|  phenylalanine ammonia-lyase                             371   1e-119   Pogostemon cablin
emb|CAB42793.1|  phenylalanine-ammonia lyase                            371   1e-119   Citrus clementina x Citrus reticulata
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   2e-119   Cicer arietinum [garbanzo]
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   2e-119   Citrus sinensis [apfelsine]
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   2e-119   Solanum tuberosum [potatoes]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             371   2e-119   Perilla frutescens [beefsteak-mint]
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    371   2e-119   Rubus idaeus [European raspberry]
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      371   2e-119   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             370   2e-119   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             371   2e-119   Eucalyptus grandis [rose gum]
dbj|BAM28965.1|  phenylalanine ammonia lyase                            357   2e-119   Lilium hybrid division I
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             370   3e-119   Olea europaea
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             370   3e-119   Nelumbo nucifera [Indian lotus]
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        362   4e-119   
gb|AJO53272.1|  phenylalanine ammonia-lyase                             370   4e-119   Pogostemon cablin
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        370   4e-119   Morus notabilis
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       360   5e-119   Cucumis sativus [cucumbers]
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            370   5e-119   Gynura bicolor
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        370   6e-119   Solanum tuberosum [potatoes]
gb|AAV98199.1|  phenylalanine ammonialyase 1                            370   6e-119   Petunia x hybrida [garden petunia]
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             371   7e-119   
gb|AEC11891.1|  PAL1                                                    370   7e-119   Petunia exserta
gb|AHY94892.1|  phenylalanine ammonia lyase                             369   7e-119   Prunella vulgaris
gb|AJT59582.1|  phenylalanine ammonia lyase                             370   8e-119   Boehmeria nivea [Chinese silk-plant]
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             369   8e-119   
ref|XP_011657651.1|  PREDICTED: phenylalanine ammonia-lyase             369   9e-119   Cucumis sativus [cucumbers]
emb|CAB42794.1|  phenylalanine-ammonia lyase                            369   9e-119   Citrus clementina x Citrus reticulata
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            360   1e-118   Lotus japonicus
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        370   1e-118   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      369   1e-118   Citrus sinensis [apfelsine]
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             369   1e-118   Beta vulgaris subsp. vulgaris [field beet]
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       369   2e-118   Trifolium subterraneum
gb|ACR56688.1|  phenylalanine ammonia-lyase                             368   2e-118   Scutellaria viscidula [zhan mao huang qin]
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           368   2e-118   Platycodon grandiflorus [balloon-flower]
gb|AKA60049.1|  phenylalanine ammonia-lyase                             368   2e-118   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            367   2e-118   
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            368   2e-118   
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             368   3e-118   
prf||2006271A  Phe ammonia lyase                                        368   3e-118
ref|XP_012093279.1|  PREDICTED: phenylalanine ammonia-lyase G2B         368   3e-118   
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             368   3e-118   
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    368   3e-118   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          368   3e-118   
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             368   4e-118   
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        367   4e-118   
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             368   4e-118   
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           367   4e-118   
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             367   5e-118   
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   367   5e-118   
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       367   5e-118   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             367   5e-118   
gb|AJW77399.1|  phenylalanine ammonia-lyase                             367   6e-118   
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     367   8e-118   
gb|AIA24411.1|  phenylalanine ammonia-lyase                             367   9e-118   
gb|AEA72280.1|  phenylalanine ammonia-lyase                             366   9e-118   
gb|AAZ29733.1|  phenylalanine ammonia lyase                             367   9e-118   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             366   9e-118   
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    366   9e-118   
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             366   9e-118   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    366   1e-117   
emb|CDP06747.1|  unnamed protein product                                362   1e-117   
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    367   1e-117   
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     367   1e-117   
gb|AIY26016.1|  PAL                                                     366   1e-117   
gb|AAZ29732.1|  phenylalanine ammonia lyase                             367   1e-117   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             366   1e-117   
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        366   1e-117   
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    360   1e-117   
emb|CDP20698.1|  unnamed protein product                                365   1e-117   
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    366   1e-117   
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    366   1e-117   
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    360   1e-117
gb|AAZ29734.1|  phenylalanine ammonia lyase                             366   2e-117   
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            366   2e-117   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            366   2e-117   
gb|AAA34179.2|  phenylalanine ammonia lyase                             365   2e-117   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       365   2e-117   
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        366   2e-117   
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             366   2e-117   
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      366   2e-117   
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            361   2e-117   
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    365   2e-117   
gb|ABD42947.1|  phenylalanine ammonia lyase                             365   2e-117   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             365   2e-117   
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            365   2e-117   
gb|AEH02821.1|  phenylalanine ammonia lyase                             365   2e-117   
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             365   3e-117   
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            365   3e-117   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         365   3e-117   
gb|AAX84839.1|  phenylalanine ammonia-lyase                             365   3e-117   
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           365   3e-117   
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1           365   3e-117   
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            365   4e-117   
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        365   4e-117   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        365   4e-117   
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          365   4e-117   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             365   4e-117   
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    365   4e-117   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           365   4e-117   
gb|AGA84059.1|  phenylalanine ammonia lyase                             365   5e-117   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           365   5e-117   
gb|AIC66437.1|  phenylalanine ammonia lyase                             365   5e-117   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        365   5e-117   
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           364   6e-117   
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           364   7e-117   
ref|XP_007016787.1|  PHE ammonia lyase 1                                364   7e-117   
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        364   8e-117   
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            363   9e-117   
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                364   9e-117   
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                366   1e-116   
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           351   1e-116   
emb|CAA34715.1|  unnamed protein product                                360   1e-116   
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   363   1e-116   
ref|XP_011658467.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      360   1e-116   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       364   1e-116   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             363   2e-116   
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                363   2e-116   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             363   2e-116   
gb|ADO64252.1|  PAL                                                     363   3e-116   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             363   3e-116   
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   363   3e-116   
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        359   3e-116   
ref|XP_002862326.1|  predicted protein                                  346   3e-116   
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        363   3e-116   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             362   3e-116   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            362   3e-116   
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     362   3e-116   
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            361   4e-116   
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           362   5e-116   
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            361   5e-116   
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           362   5e-116   
gb|ABN79671.2|  phenylalanine ammonia-lyase                             362   5e-116   
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        362   6e-116   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             362   6e-116   
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          361   6e-116   
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             362   7e-116   
gb|ABE03772.1|  phenylalanine ammonia-lyase                             361   1e-115   
gb|AGV54597.1|  phenylalanine ammonia-lyase                             361   1e-115   
gb|AIZ76768.1|  PAL2                                                    350   1e-115   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             361   1e-115   
gb|AIZ76770.1|  PAL2                                                    350   1e-115   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    360   1e-115   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             361   1e-115   
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            361   1e-115   
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        360   2e-115   
gb|ABD73282.1|  phenylalanine ammonia-lyase                             360   2e-115   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            361   2e-115   
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     361   2e-115   
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    360   2e-115   
gb|ACG56648.1|  phenylalanine ammonia lyase                             360   2e-115   
dbj|BAM05604.1|  phenylalanine ammonia lyase                            350   3e-115   
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        360   3e-115   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            360   3e-115   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        360   4e-115   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           360   5e-115   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        359   6e-115   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       359   7e-115   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      359   7e-115   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        359   8e-115   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             359   8e-115   
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   359   8e-115   
gb|ACG56647.1|  phenylalanine ammonia lyase                             358   9e-115   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            359   1e-114   
gb|AGU91428.1|  phenylalanine ammonia-lyase                             358   1e-114   
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                359   1e-114   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             358   1e-114   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             358   1e-114   
ref|XP_004143356.2|  PREDICTED: phenylalanine ammonia-lyase-like        358   1e-114   
gb|ADD82537.1|  phenylalanine ammonia-lyase                             354   2e-114   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             358   2e-114   
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     358   3e-114   
gb|ACT21093.1|  phenylalanine ammonia-lyase                             357   4e-114   
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           357   4e-114   
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   5e-114   
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       357   5e-114   
gb|AIZ76769.1|  PAL2                                                    350   5e-114   
prf||2001451A  Phe ammonia lyase                                        357   6e-114
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   6e-114   
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           357   6e-114   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             357   8e-114   
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             356   1e-113   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             356   1e-113   
gb|ACG80829.1|  phenylalanine ammonia lyase                             352   1e-113   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        355   1e-113   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             355   2e-113   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             355   2e-113   
gb|ABR14606.1|  phenylalanine ammonia-lyase                             355   2e-113   
gb|AGE10605.1|  phenylalanine amononia-lyase                            341   2e-113   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        355   2e-113   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    355   2e-113   
gb|AIZ76767.1|  PAL2                                                    351   2e-113   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    355   3e-113   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            355   3e-113   
gb|AIL23235.1|  phenylalanine ammonia-lyase                             355   3e-113   
gb|ACG80828.1|  phenylalanine ammonia lyase                             350   4e-113   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              354   6e-113   
gb|AHF20178.1|  phenylalanine ammonia lyase                             351   6e-113   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             353   7e-113   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            353   8e-113   
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            351   8e-113   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           353   9e-113   
gb|AJO53274.1|  phenylalanine ammonia-lyase                             353   9e-113   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        353   2e-112   
gb|AER58180.1|  phenylalanine ammonia lyase                             352   4e-112   
emb|CDY08611.1|  BnaA05g28470D                                          352   4e-112   
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    351   7e-112   
gb|ACX31148.1|  phenylalanine ammonialyase                              349   7e-112   
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    351   9e-112   
gb|AAW78932.1|  phenylalanine-ammonia lyase                             351   1e-111   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        351   1e-111   
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           352   1e-111   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            350   2e-111   
gb|ADD12041.1|  phenylalanine ammonia lyase                             349   3e-111   
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        349   4e-111   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           349   4e-111   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            349   6e-111   
emb|CAA53733.1|  phenylanaline ammonia-lyase                            346   7e-111   
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   338   9e-111   
gb|AHA42443.1|  phenylalanine ammonia lyase                             348   9e-111   
gb|EMS57329.1|  Phenylalanine ammonia-lyase                             339   9e-111   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           348   2e-110   
gb|AIE16710.1|  phenylalanine ammonia-lyase                             332   2e-110   
emb|CDY00922.1|  BnaC05g42780D                                          347   2e-110   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        347   3e-110   
dbj|BAC10907.1|  phenylalanine ammonia-lyase 1                          335   3e-110   
gb|AGE10591.1|  phenylalanine amononia-lyase                            346   4e-110   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        347   5e-110   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            346   6e-110   
gb|AIE16718.1|  phenylalanine ammonia-lyase                             329   1e-109   
gb|EMS57330.1|  Phenylalanine ammonia-lyase                             334   2e-109   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             345   2e-109   
gb|AGZ95690.1|  phenylalanine ammonia-lyase                             344   3e-109   
gb|AAS48415.1|  phenylalanine lyase                                     344   3e-109   
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        344   3e-109   
gb|AFK47120.1|  unknown                                                 327   4e-109   
emb|CAA68064.1|  phenylalanine ammonia-lyase                            332   5e-109   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             344   5e-109   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                343   5e-109   
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            343   7e-109   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase G4          343   1e-108   
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           343   1e-108   
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 342   2e-108   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           342   3e-108   
emb|CAA89005.1|  phenylalanine ammonia-lyase                            334   4e-108   
gb|EMS63272.1|  Phenylalanine ammonia-lyase                             338   1e-107   
gb|AFS28702.1|  putative phenylalanine ammonia-lyase                    335   1e-107   
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           340   1e-107   
gb|ADT63058.1|  phenylalanine ammonia-lyase                             340   1e-107   
gb|AII00960.1|  phenylalanine ammonia lyase                             330   2e-107   
emb|CDO99754.1|  unnamed protein product                                338   2e-107   
gb|EMT29666.1|  Phenylalanine ammonia-lyase                             337   3e-107   
gb|EMT29669.1|  Phenylalanine ammonia-lyase                             336   4e-107   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             338   5e-107   
ref|XP_006846821.1|  PREDICTED: phenylalanine ammonia-lyase             338   6e-107   
gb|EMT29668.1|  Phenylalanine ammonia-lyase                             337   7e-107   



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILK MS+T++VALCQAIDLRHLEENLK+  K  VSQVAK+VLT+G
Sbjct  106  SLGLISSRKTTEAVDILKPMSSTFLVALCQAIDLRHLEENLKSTVKTTVSQVAKRVLTMG  165

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF Y DDPCS  YPLMQKLR VLV+HAL+NG+ ERS+
Sbjct  166  FNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRHVLVEHALSNGDKERST  225

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E  R E ENGK AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  226  STSIFQKIAAFEEELKALLPKEVETTRAEYENGKTAIPNRIKECRSYPLYKFVREELGTD  285

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
            LLTGEKVRSPGEECDKVF+AMC GKLIDPLLDCLKEWNGAPLPI
Sbjct  286  LLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  329



>gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya]
Length=268

 Score =   384 bits (985),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQAIDLRHLEENLK   KN+VSQV +KVL +G
Sbjct  44   SLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKNTVKNSVSQVIRKVLFMG  103

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NGELHPSRF EKDLLKVVDREY+FAYADDPCS  YPLMQKLRQVLVDHAL N + +++S
Sbjct  104  DNGELHPSRFCEKDLLKVVDREYLFAYADDPCSATYPLMQKLRQVLVDHALINADRDKNS  163

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             +SIFHKIGAFEEELK +LPKE+EG R E+E G AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  164  GSSIFHKIGAFEEELKTLLPKEVEGTRLEVEAGNAAIPNRIKECRSYPLYKFVREELGTG  223

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
            LLTGEKVRSPGEE DKVF+AMC GK+IDPLLDCLKEWNGAPLPI
Sbjct  224  LLTGEKVRSPGEEFDKVFSAMCAGKMIDPLLDCLKEWNGAPLPI  267



>gb|AFQ92048.1| phenylalanine ammonia-lyase, partial [Pyrus pyrifolia]
Length=234

 Score =   382 bits (982),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK+  K  VSQVAK+VLTVG
Sbjct  10   SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTVKTTVSQVAKRVLTVG  69

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR VLV+HAL+NGE E S+
Sbjct  70   LNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALSNGEKEIST  129

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KI AFEEELK +LPKE++ A  E ENGK AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  130  GTSIFQKITAFEEELKTLLPKEVDNAWAEYENGKTAIPNRIKECRSYPLYKFVREELGTD  189

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
            LLTG+KVRSPGEECDKVF AMC GKLIDPLLDCLKEWNGAPLPI
Sbjct  190  LLTGDKVRSPGEECDKVFNAMCAGKLIDPLLDCLKEWNGAPLPI  233



>gb|AAN32867.1|AF460204_1 phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=619

 Score =   392 bits (1007),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  KN VS VAKKVLT+G
Sbjct  395  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKNTVSLVAKKVLTMG  454

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLV+H+LANG+ E+ +
Sbjct  455  YNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSGTYPLMQKLRQVLVEHSLANGDKEKDA  514

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFE+ELKA+LPKE+E ARCELENGK  I NRI+DCRS+ LYKFVR ELGT+
Sbjct  515  TTSIFQKIGAFEDELKALLPKEVESARCELENGKPGIANRIKDCRSYSLYKFVRGELGTN  574

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEE DKVFTA+CEGKLIDPLLDCLKEWNGAP PIC
Sbjct  575  FLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC  619



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   391 bits (1005),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+D+LKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+VLTVG
Sbjct  395  SLGLISSRKTAEAIDVLKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTVG  454

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDREYV+AY DDPCS  YPLMQKLR VLVDHAL NG+ E SS
Sbjct  455  INGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASS  514

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEEL A+LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR  LGT+
Sbjct  515  STSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTT  574

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+CEGK IDPLLDCLKEWNGAPLPIC
Sbjct  575  LLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  619



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   394 bits (1011),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  489  SLGLISARKTAEAVDILKLMSSTFLIALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  548

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NGELHPSRF EKDLL+VVDREY++AY DDPCS  YPLMQKLRQVLVDHAL NG+ E++S
Sbjct  549  SNGELHPSRFCEKDLLRVVDREYLYAYVDDPCSATYPLMQKLRQVLVDHALMNGDREKNS  608

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFEEELK +LPKE+EGAR E ENG AAIPNRI++CRS+PLYKFVR  LGTS
Sbjct  609  TTSIFQKIGAFEEELKTLLPKEVEGARIEFENGNAAIPNRIEECRSYPLYKFVREVLGTS  668

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDKVF+AMC GKLIDPLL+CLKEWNGAPLPIC
Sbjct  669  LLTGEKVISPGEECDKVFSAMCAGKLIDPLLECLKEWNGAPLPIC  713



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   394 bits (1012),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQ+AKK+LT G
Sbjct  498  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNTVKNTVSQIAKKILTTG  557

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRFSEKDLLK VD EYVFAY DDPCS  YPLMQKLRQVLV+HALANGE E+++
Sbjct  558  ANGELHPSRFSEKDLLKAVDSEYVFAYIDDPCSATYPLMQKLRQVLVEHALANGENEKNA  617

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF K+ AFEEELKAILPKE+E AR  LENG A IPNRIQ+CRS+PLYKFVR ELGT 
Sbjct  618  STSIFQKVAAFEEELKAILPKEVESARLSLENGNAGIPNRIQECRSYPLYKFVREELGTG  677

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE V+SPGEE DKVFTAMC+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  678  LLTGENVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  722



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   393 bits (1009),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 190/225 (84%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  KNAVS VAKKVLT+G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKNAVSLVAKKVLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LHPSRF EKDLL VVDREYVFAYADDPCS NYPL+QKLRQVLVDHAL NGE E +S
Sbjct  553  QNGGLHPSRFCEKDLLNVVDREYVFAYADDPCSCNYPLIQKLRQVLVDHALLNGEGEMNS  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKAILPKE+E ARC+LEN K  IPNRIQ+CRS+PLYKFVR ELGT+
Sbjct  613  STSIFQKIGAFEEELKAILPKEVESARCDLENSKPTIPNRIQECRSYPLYKFVRKELGTN  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE V+SPGE  DKVFTA+ EGKLIDPLLDCLKEWNGAPLP+C
Sbjct  673  LLTGENVQSPGEVFDKVFTAINEGKLIDPLLDCLKEWNGAPLPLC  717



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+D+LKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+VLTVG
Sbjct  493  SLGLISSRKTAEAIDVLKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTVG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDREYV+AY DDPCS  YPLMQKLR VLVDHAL NG+ E SS
Sbjct  553  INGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEASS  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEEL A+LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR  LGT+
Sbjct  613  STSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTT  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+CEGK IDPLLDCLKEWNGAPLPIC
Sbjct  673  LLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  717



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK+  KN VSQVAK+VLT+G
Sbjct  495  SLGLISARKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTVKNTVSQVAKRVLTMG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY+FAY DDPCS  YPLMQKLRQVLVDHAL NGE E++S
Sbjct  555  FNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSATYPLMQKLRQVLVDHALLNGEKEKNS  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR E +NG  AIPN+I++CRS+PLYKFVR ELGT 
Sbjct  615  STSIFQKIGAFEEELKALLPKEVENARTEYDNGNPAIPNKIKECRSYPLYKFVREELGTG  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK+RSPGEE DKVF+AMC GKLIDP+L+CLKEWNGAPLPIC
Sbjct  675  LLTGEKIRSPGEEFDKVFSAMCAGKLIDPMLECLKEWNGAPLPIC  719



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   391 bits (1005),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/225 (84%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSR TAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  KNAVS VAKKVLT+G
Sbjct  493  SLGLISSRNTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKNAVSLVAKKVLTIG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAYADDPC+ NYPL+QKLRQVLVDHAL NGE E++S
Sbjct  553  QNGELHPSRFCEKDLLKVVDREYVFAYADDPCNCNYPLIQKLRQVLVDHALLNGEGEKNS  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKAILPKE+E ARC+LEN K  IPNRIQ+CRS+PLYKFVR ELGT+
Sbjct  613  STSIFEKISAFEEELKAILPKEVESARCDLENCKPTIPNRIQECRSYPLYKFVRKELGTN  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE V+SPGE  DKVFTA+ EGKLIDPLLDCLKEWNGAPLP+C
Sbjct  673  LLTGENVQSPGEVFDKVFTAINEGKLIDPLLDCLKEWNGAPLPLC  717



>gb|AFP49806.1| phenylalanine ammonialyase 1 [Coffea arabica]
Length=717

 Score =   391 bits (1005),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  KN VS VAKKVLT+G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKNTVSLVAKKVLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLV+H+LANG+ E+ +
Sbjct  553  YNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSGTYPLMQKLRQVLVEHSLANGDKEKDA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFE+ELKA+LPKE+E ARCELENGK  I NRI+DCRS+ LYKFVR ELGT+
Sbjct  613  TTSIFQKIGAFEDELKALLPKEVESARCELENGKPGIANRIKDCRSYSLYKFVRGELGTN  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEE DKVFTA+CEGKLIDPLLDCLKEWNGAP PIC
Sbjct  673  FLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC  717



>ref|XP_007220629.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
 gb|EMJ21828.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
Length=625

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQA+DLRHLEENLK+  K+ VSQVAK+VLTVG
Sbjct  401  SLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTVKSTVSQVAKRVLTVG  460

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR VLV+HAL NGE E+SS
Sbjct  461  FNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALNNGEKEKSS  520

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E AR E +NGK+A PNRI+DCRS+PLYKFVR ELGT+
Sbjct  521  STSIFQKITAFEEELKTLLPKEVESARLEYDNGKSATPNRIKDCRSYPLYKFVREELGTA  580

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG+KVRSPGEE DKVF A+C GK IDPLLDCLKEWNGAPLPI 
Sbjct  581  LLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPIS  625



>gb|AEL21616.1| phenylalanine ammonia lyase 1 [Coffea arabica]
Length=717

 Score =   391 bits (1005),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  KN VS VAKKVLT+G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKNTVSLVAKKVLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLV+H+LANG+ E+ +
Sbjct  553  YNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSGTYPLMQKLRQVLVEHSLANGDKEKDA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFE+ELKA+LPKE+E ARCELENGK  I NRI+DCRS+ LYKFVR ELGT+
Sbjct  613  TTSIFQKIGAFEDELKALLPKEVESARCELENGKPGIANRIKDCRSYSLYKFVRGELGTN  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEE DKVFTA+CEGKLIDPLLDCLKEWNGAP PIC
Sbjct  673  FLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC  717



>gb|AAN32866.1|AF460203_1 phenylalanine ammonia-lyase 1 [Coffea canephora]
 gb|AAZ04477.1| phenylalanine ammonia-lyase [Coffea canephora]
 gb|AEO92027.1| phenylalanine ammonia-lyase 1 [Coffea canephora]
Length=717

 Score =   391 bits (1004),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  KN VS VAKKVLT+G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKNTVSLVAKKVLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLV+H+LANG+ E+ +
Sbjct  553  YNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSGTYPLMQKLRQVLVEHSLANGDKEKDA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFE+ELKA+LPKE+E ARCELENGK  I NRI+DCRS+ LYKFVR ELGT+
Sbjct  613  TTSIFQKIGAFEDELKALLPKEVESARCELENGKPGIANRIKDCRSYSLYKFVRGELGTN  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEE DKVFTA+CEGKLIDPLLDCLKEWNGAP PIC
Sbjct  673  FLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC  717



>gb|ADF59062.1| phenylalanine ammonia-lyase 2 precursor [Pyrus x bretschneideri]
Length=720

 Score =   391 bits (1005),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 184/224 (82%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+T++VALCQAIDLRHLEENLK+  K  VSQVAK+VLTVG
Sbjct  496  SLGLISSRKTTEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTVKTTVSQVAKRVLTVG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR VLV+HAL+NG+ ERS+
Sbjct  556  FNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALSNGDKERST  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI  FEEELK +LPKE+E  R E ENGK AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  616  STSIFQKIATFEEELKTLLPKEVETTRAEYENGKTAIPNRIKECRSYPLYKFVREELGTD  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
            LLTGEKVRSPGEECDKVF+AMC GKLIDPLLDCLKEWNGAPLPI
Sbjct  676  LLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  719



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   380 bits (977),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT+G
Sbjct  192  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTIG  251

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  252  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNG  311

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  312  STSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTG  371

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  372  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  416



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   387 bits (994),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   +N VSQVAK+VLTVG
Sbjct  395  SLGLISSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTVRNTVSQVAKRVLTVG  454

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDREYV+AY DDPCS  YPLMQKLR VLVDHAL NG+ E +S
Sbjct  455  INGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNS  514

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEEL A+LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR  LGT+
Sbjct  515  STSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECRSYPLYKFVRENLGTT  574

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+CEGKLIDPLLDCLKEW GAPLPIC
Sbjct  575  LLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  619



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   390 bits (1001),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+T+MVALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  486  SLGLISARKTAEAIDILKLMSSTFMVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NGELHPSRF EKDLL+VVDREY++AYADDPCS NYPL+QKLRQVLVDHAL NG+ E+ S
Sbjct  546  SNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQVLVDHALMNGDREKDS  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG FEEELK  LPKE+E AR E ENG  AIPN+I++CRS+PLYKFVR  LGT+
Sbjct  606  TTSIFQKIGVFEEELKTHLPKEVESARTEFENGNPAIPNKIEECRSYPLYKFVREVLGTN  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDKVFTAMC GKLIDPLLDCLK+WNGAPLPIC
Sbjct  666  LLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>ref|XP_007220630.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
 gb|EMJ21829.1| hypothetical protein PRUPE_ppa002328mg [Prunus persica]
Length=686

 Score =   389 bits (999),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQA+DLRHLEENLK+  K+ VSQVAK+VLTVG
Sbjct  462  SLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTVKSTVSQVAKRVLTVG  521

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR VLV+HAL NGE E+SS
Sbjct  522  FNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALNNGEKEKSS  581

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E AR E +NGK+A PNRI+DCRS+PLYKFVR ELGT+
Sbjct  582  STSIFQKITAFEEELKTLLPKEVESARLEYDNGKSATPNRIKDCRSYPLYKFVREELGTA  641

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG+KVRSPGEE DKVF A+C GK IDPLLDCLKEWNGAPLPI 
Sbjct  642  LLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPIS  686



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  133  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  192

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  193  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNA  252

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  253  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  312

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  313  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  357



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   372 bits (956),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ+IDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  11   SLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQVAKRTLTTG  70

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR+VL++HAL NGE E+++
Sbjct  71   VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLIEHALTNGESEKNA  130

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  131  STSIFQKIGAFEEELKALLPKEVESARSAIEGGNAAVPNRIAECRSYPLYKFVREELGGE  190

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  191  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  235



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   375 bits (963),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  84   SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  143

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  144  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  203

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  204  STSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  263

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  264  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  308



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   388 bits (997),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+D+LKLMS+T++VALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  483  SLGLISARKTAEAVDVLKLMSSTFLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMG  542

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAYADDPCSENYPLMQKLRQVLVDHAL NGE E++ 
Sbjct  543  VNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALQNGEHEKNV  602

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFE+ELKA+LPKE+EGAR  LENG  AIPNRI +CRS+PLYKF+R ELGT 
Sbjct  603  STSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKFIREELGTE  662

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            +LTGEKV+SPGE CDKVFTA+C+G +IDPLL+CLK WNGAPLPIC
Sbjct  663  MLTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  707



>gb|AEJ88223.1| phenylalanine ammonia lyase [Prunus persica]
Length=719

 Score =   388 bits (997),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQA+DLRHLEENLK+  K+ VSQVAK+VLTVG
Sbjct  495  SLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTVKSTVSQVAKRVLTVG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR VLV+HAL NGE E+SS
Sbjct  555  FNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALNNGEKEKSS  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E AR E +NGK+A PNRI+DCRS+PLYKFVR ELGT+
Sbjct  615  STSIFQKITAFEEELKTLLPKEVESARLEYDNGKSATPNRIKDCRSYPLYKFVREELGTA  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG+KVRSPGEE DKVF A+C GK IDPLLDCLKEWNGAPLPI 
Sbjct  675  LLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPIS  719



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   374 bits (961),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK+  KN VSQVAK+ LT G
Sbjct  87   SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKSSAKNTVSQVAKRTLTTG  146

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLVDHAL NGE E++ 
Sbjct  147  VNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNL  206

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELKA+LPKE+E AR   E+G AAIPN+I +CRS+PLYKFVR ELGT 
Sbjct  207  NTSIFQKIATFEEELKALLPKEVESARAAYESGNAAIPNKINECRSYPLYKFVREELGTG  266

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DK+FTAMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  267  LLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  311



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   375 bits (962),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS T++VALCQAIDLRHLEENLK   KN VSQVAK++LT G
Sbjct  91   SLGLISSRKTEEAVDILKLMSTTFLVALCQAIDLRHLEENLKHAVKNTVSQVAKRILTTG  150

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             +GELHPSRF EKDLLKVVDRE VF+Y DD CS  YPLMQKLRQVLVDHALANGE E+++
Sbjct  151  ASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHALANGESEKNA  210

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR   ENG  AI N+I++CRS+PLYKFVR E+GT 
Sbjct  211  STSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYKFVREEIGTG  270

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC+GK+IDP+LDCLKEWNGAPLPIC
Sbjct  271  LLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  315



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   388 bits (996),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 204/224 (91%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQA+DLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  485  SLGLISSRKTAEAVDILKLMSTTFLVALCQAVDLRHMEENLKNTVKNTVSQVAKRVLTMG  544

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NGELHPSRF EKDLLKVV+REYVFAY DDPCS  YPLMQKLRQVLV+HAL NG+ E + 
Sbjct  545  SNGELHPSRFCEKDLLKVVNREYVFAYIDDPCSATYPLMQKLRQVLVEHALNNGDKETNL  604

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+EGAR E+ENGKAAIPN I++CRS+PLY+FVR ELGTS
Sbjct  605  STSIFQKIGAFEEELKTLLPKEVEGARIEIENGKAAIPNPIKECRSYPLYRFVREELGTS  664

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
            LLTGE++RSPGEE DKVF+AMC GKLIDPLLDCLKEWNGAPLPI
Sbjct  665  LLTGERIRSPGEEFDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  708



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   376 bits (966),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA++ILKLMS+TY++ALCQAIDLRHLEENLK   KNAV+QVAKKVLT+G
Sbjct  141  SLGLISSRKTAEAVEILKLMSSTYLIALCQAIDLRHLEENLKNTVKNAVNQVAKKVLTMG  200

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGEL PSRF EKDLL VVDRE+VF Y DDPCS  YPLMQKLRQVLVDHAL NG  E  +
Sbjct  201  VNGELLPSRFCEKDLLTVVDREHVFDYIDDPCSATYPLMQKLRQVLVDHALQNGNRENDA  260

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFE+ELK +LPKE+E AR E+ENGK+AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  261  NTSIFLKIAAFEKELKTLLPKEVESARIEVENGKSAIPNRIKECRSYPLYRFVREELGTG  320

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGKLIDPLLDCLK WNGAPLP+C
Sbjct  321  LLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAPLPLC  365



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   388 bits (996),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL+KVVDREYVFAY DDPCS +YPLMQKLRQVLVDHAL NG+ E++S
Sbjct  556  VNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNS  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFE+ELK +LPKE+E AR ELE+G AAI NRI++CRS+PLYK VR E+GTS
Sbjct  616  TTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYKIVREEIGTS  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVF AMCEGKLIDP+L+CLKEWNGAPLPIC
Sbjct  676  LLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   387 bits (995),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  K+AVS VAKKVL  G
Sbjct  494  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKSAVSLVAKKVLITG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LH SRFSEKDLL VVDREY FAYADDPCS NYPLMQKLRQV VDHAL+NG+ME++S
Sbjct  554  QNGGLHNSRFSEKDLLTVVDREYCFAYADDPCSANYPLMQKLRQVSVDHALSNGDMEKNS  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIFHKI AFEEELK +LPKEIE ARC LENGK  IPNRIQ+CRS+PLYKFVR EL T+
Sbjct  614  STSIFHKISAFEEELKIVLPKEIESARCNLENGKPTIPNRIQECRSYPLYKFVREELKTN  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV+SPGEE DKVFTAM EGKL+DPLL+CLK+WNGAPLP+C
Sbjct  674  YLTGEKVQSPGEEFDKVFTAMNEGKLVDPLLNCLKKWNGAPLPLC  718



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   387 bits (994),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  483  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  542

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL+KVVDREYVFAY DDPCS  YPLMQKLRQVLV+HA+ANGE E+ S
Sbjct  543  FNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAMANGEREKKS  602

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E  R E+ENG AA+PN+I++CRS+PLYKFVR ELG S
Sbjct  603  STSIFQKIGAFEEELKTLLPKEVESTRIEIENGNAAVPNKIKECRSYPLYKFVREELGAS  662

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV+SPGEE DKVF+A+C GKLIDP+++CLKEWNGAPLP+C
Sbjct  663  FLTGEKVKSPGEEFDKVFSAICAGKLIDPMMECLKEWNGAPLPLC  707



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   387 bits (995),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL+KVVDREYVFAY DDPCS +YPLMQKLRQVLVDHAL NG+ E++S
Sbjct  556  VNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQVLVDHALDNGDREKNS  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFE+ELK +LPKE+E AR ELE+G AAI NRI++CRS+PLYK VR E+GTS
Sbjct  616  TTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECRSYPLYKIVREEIGTS  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVF AMCEGKLIDP+L+CLKEWNGAPLPIC
Sbjct  676  LLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>ref|XP_008233304.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=719

 Score =   387 bits (995),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQA+DLRHLEENLK+  K+ VSQVAK+VLTVG
Sbjct  495  SLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHLEENLKSTVKSTVSQVAKRVLTVG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR VLV+HAL NGE E+SS
Sbjct  555  FNGELHPSRFCEKDLLKVVDREYVFAYVDDPCSATYPLMQKLRHVLVEHALNNGEKEKSS  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E AR + +NGK+A PNRI+DCRS+PLYKFVR ELGT+
Sbjct  615  STSIFQKITAFEEELKTLLPKEVESARLDYDNGKSATPNRIKDCRSYPLYKFVREELGTA  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG+KVRSPGEE DKVF A+C GK IDPLLDCLKEWNGAPLPI 
Sbjct  675  LLTGDKVRSPGEESDKVFNAICAGKFIDPLLDCLKEWNGAPLPIS  719



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   387 bits (994),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  486  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKQTVKNTVSQVAKRVLTMG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYV+AY DDPCS  YPLMQKLRQVLVDHA+ NGE E++S
Sbjct  546  INGELHPSRFCEKDLLKVVDREYVYAYVDDPCSATYPLMQKLRQVLVDHAMMNGEKEKNS  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR E ENG  AI N+I++CRS+PLYKFVR ELG S
Sbjct  606  STSIFQKIGAFEEELKTLLPKEVESARTEYENGNPAISNKIKECRSYPLYKFVREELGCS  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK+RSPGEE DKVF+A+C GKLIDP+L+CLKEWNGAPLPIC
Sbjct  666  LLTGEKIRSPGEEFDKVFSAICAGKLIDPMLECLKEWNGAPLPIC  710



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   387 bits (994),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRH+EENL+   KN VSQ+ KK LT G
Sbjct  491  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHIEENLRNTVKNTVSQIVKKTLTTG  550

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRFSEKDLLKVVD EYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  551  ANGELHPSRFSEKDLLKVVDCEYVFAYVDDPCSATYPLMQKLRQVLVEHALTNGENEKNT  610

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E AR  LENG AAIPNRI+DCRS+PLYKFVR E+GT 
Sbjct  611  STSIFQKIAAFEEELKVVLPKEVESARVSLENGNAAIPNRIKDCRSYPLYKFVREEIGTG  670

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  671  LLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNGAPLPIC  715



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   387 bits (993),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V LCQA+DLRH+EENLK+  KN VSQVAK+VLT+G
Sbjct  487  SLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF+Y DDPCS  YPLMQKLRQVLV+HAL NGE ER+S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGTS
Sbjct  607  TTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTS  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEW+GAPLPIC
Sbjct  667  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   387 bits (993),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+ ALCQAIDLRHLEENL++  KN VSQ+AKKVLT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTYLAALCQAIDLRHLEENLRSTVKNTVSQIAKKVLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK VDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  556  ANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +ENG AAIPN+I++CRSFPLYKFVR ELGT 
Sbjct  616  STSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYKFVREELGTG  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE V SPGEE DKVFTAMC+G++IDP+L+CL+EWNGAPLPIC
Sbjct  676  LLTGENVMSPGEEFDKVFTAMCQGRIIDPMLECLEEWNGAPLPIC  720



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V LCQA+DLRH+EENLK+  KN VSQVAK+VLT+G
Sbjct  487  SLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHVEENLKSTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF+Y DDPCS  YPLMQKLRQVLV+HAL NGE ER+S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGTS
Sbjct  607  TTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTS  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEW+GAPLPIC
Sbjct  667  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   386 bits (991),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  483  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  542

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL+KVVDREYVFAY DDPCS  YPL QKLRQVLV+HA+ANG+ E++S
Sbjct  543  FNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSATYPLTQKLRQVLVEHAMANGDAEKNS  602

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E  R E+ENG AA+PN+I++CRS+PLYKFVR ELGTS
Sbjct  603  STSIFQKIGAFEEELKTLLPKEVESTRIEIENGNAAVPNKIKECRSYPLYKFVREELGTS  662

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK RSPGEE DKVF+AMC GKLIDP+++CLKEWNGAPLP+C
Sbjct  663  FLTGEKARSPGEEFDKVFSAMCAGKLIDPMMECLKEWNGAPLPLC  707



>ref|XP_008366650.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   386 bits (991),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+T++VALCQAIDLRHLEENLK+  K  VSQVAK+VLT+G
Sbjct  496  SLGLISSRKTFEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTVKTTVSQVAKRVLTMG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR VLV+HAL+NG+ E S+
Sbjct  556  FNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRHVLVEHALSNGDKEMST  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E  R E ENGK AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  616  STSIFQKIAAFEEELKTLLPKEVETTRAEYENGKTAIPNRIKECRSYPLYKFVREELGTD  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
            LLTGEKVRSPGEECDKVF+AMC GKLI+PLLDCLKEWNGAPLPI
Sbjct  676  LLTGEKVRSPGEECDKVFSAMCAGKLINPLLDCLKEWNGAPLPI  719



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   372 bits (956),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  93   SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTG  152

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  153  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNA  212

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE++ AR  L++G A +PNRI +CRS+PLYKFVR ELG  
Sbjct  213  STSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAE  272

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF+A+CEGK+IDP+L+CL+ WNGAPLPIC
Sbjct  273  YLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  317



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   385 bits (990),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRH+EENL+   KN VSQ+AKK LT G
Sbjct  497  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHVEENLRNTVKNTVSQIAKKTLTTG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK VDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  557  ANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNT  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI  FEEEL+A+LPKE+E AR  LENG AAIPN I+DCRS+PLYKFVR ELGT 
Sbjct  617  STSIFQKITDFEEELQAVLPKEVESARVTLENGNAAIPNMIKDCRSYPLYKFVREELGTG  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTAMC+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  677  LLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   385 bits (989),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGL+SSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   +N VSQVAK+VLTVG
Sbjct  493  SLGLVSSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTVRNTVSQVAKRVLTVG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDREYV+AY DDPCS  YPLMQKLR VLVDHAL NG+ E +S
Sbjct  553  INGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLVLVDHALQNGDKEVNS  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEEL A+LPKE+E +R E+ENG  AIPNRI++CRS+PLYKFVR  LGT+
Sbjct  613  STSIFQKIGAFEEELNALLPKEVESSRIEVENGNPAIPNRIKECRSYPLYKFVRENLGTT  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+CEGKLIDPLLDCLKEW GAPLPIC
Sbjct  673  LLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  717



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   385 bits (989),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGL SSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  496  SLGLNSSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL+KVVDREYVFAY DDPCS + PLMQKLRQVLVDHAL NG+ E++S
Sbjct  556  VNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASSPLMQKLRQVLVDHALDNGDREKNS  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFE+ELK +LPKE+E AR ELE+G AAIPNRI++CRS+PLYK VR ++GTS
Sbjct  616  TTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIPNRIKECRSYPLYKIVREDIGTS  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGKLIDP+L+CLKEWNGAPLPIC
Sbjct  676  LLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPIC  720



>dbj|BAH20339.1| AT3G53260 [Arabidopsis thaliana]
Length=579

 Score =   380 bits (977),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  355  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  414

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQ+LRQV+VDHAL+NGE E+++
Sbjct  415  INGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQRLRQVIVDHALSNGETEKNA  474

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E AR    NG A IPNRI++CRS+PLY+FVR ELGT 
Sbjct  475  VTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPLYRFVREELGTK  534

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGKLIDPL+DCLKEWNGAP+PIC
Sbjct  535  LLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  579



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   385 bits (988),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V LCQA+DLRH+EENLK+  KN VSQVAK+VLT+G
Sbjct  487  SLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF+Y DDPCS  YPLMQ LRQVLV+HAL NGE ER+S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHALVNGERERNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGTS
Sbjct  607  TTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTS  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEW+GAPLPIC
Sbjct  667  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   384 bits (987),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V LCQA+DLRH+EENLK+  KN VSQVAK+VLT+G
Sbjct  487  SLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF+Y DDPCS  YPLMQ LRQVLV+HAL NGE ER+S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQVLVEHALVNGERERNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGTS
Sbjct  607  TTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTS  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEW+GAPLPIC
Sbjct  667  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   384 bits (986),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  486  SLGLISARKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NGELHPSRF EKDLL+VVDREY++AYADDPCS NYPL+QKLRQVLVDHAL NG+ E+ S
Sbjct  546  SNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQVLVDHALMNGDREKDS  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG FEEELK  LPKE+E AR E ENG  AI N+I++CRS+PLYKFVR  LGT 
Sbjct  606  TTSIFQKIGVFEEELKTQLPKEVESARTEFENGSPAIANKIEECRSYPLYKFVREVLGTH  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDKVFTAMC GKLIDPLLDCLK+WNGAPLPIC
Sbjct  666  LLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   384 bits (987),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  491  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTMG  550

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL++VDREY+FAYADDPCS NYPLMQKLRQVLVDHA+ NGE E++ 
Sbjct  551  ANGELHPARFCEKELLRIVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNV  610

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KIGAFE+ELKA+LPKE+E AR  LE+G  AIPNRI +CRS+PLY+FVR ELGT 
Sbjct  611  NSSIFQKIGAFEDELKAVLPKEVESARAALESGNPAIPNRITECRSYPLYRFVRKELGTE  670

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMC G++IDP+L+CLK WNGAPLPIC
Sbjct  671  LLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  715



>ref|XP_002877909.1| phenylalanine ammonia-lyase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54168.1| phenylalanine ammonia-lyase 2 [Arabidopsis lyrata subsp. lyrata]
Length=717

 Score =   384 bits (987),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  493  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQ+LRQV+VDHAL+NGE E+++
Sbjct  553  INGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQRLRQVIVDHALSNGETEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR    NG A IPNRI++CRS+PLY+FVR ELGT 
Sbjct  613  VTSIFHKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPLYRFVREELGTK  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL+DCLKEWNGAP+PIC
Sbjct  673  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  717



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  494  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  554  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E  R    NG AAIPNRI +CRS+PLYKFVR ELGT 
Sbjct  614  GTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPLYKFVREELGTK  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL+DCLKEWNGAP+PIC
Sbjct  674  LLTGEKVVSPGEEFDKVFTAMCEGKMIDPLMDCLKEWNGAPIPIC  718



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQAIDLRHLEENLK   KN VSQVAKKVLT G
Sbjct  199  SLGLISSRKTSEAVDILKLMSTTFLVGICQAIDLRHLEENLKQTVKNTVSQVAKKVLTTG  258

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  259  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  318

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LP E+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  319  MTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  378

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK  SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  379  LLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  423



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  494  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF YADDPCS  YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  554  VNGELHPSRFCEKDLLKVVDREQVFTYADDPCSATYPLMQKLRQVIVDHALSNGETEKNA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E  R    +G AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  614  GTSIFQKIGAFEEELKAVLPKEVEATRAAYGSGNAAIPNRIKECRSYPLYKFVREELGTK  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL+DCLKEWNGAP+PIC
Sbjct  674  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  718



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VAL QAIDLRHLEENL++  KN VSQ+AKKVLT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTYLVALSQAIDLRHLEENLRSTVKNTVSQIAKKVLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK VDREYVFAY DDPCS  Y +MQKLRQVLV+HAL NGE E+++
Sbjct  556  ANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYSMMQKLRQVLVEHALTNGENEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +ENG AAIPN+I++CRSFPLYKFVR ELGT 
Sbjct  616  STSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECRSFPLYKFVREELGTG  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE V SPGEE DKVFTAMC+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  676  LLTGENVMSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  720



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V LCQA+DLRH+EENLK+  KN VSQVAK+VLT+G
Sbjct  487  SLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF+Y DDPCS  YPLMQKLRQVLV+HAL NGE E +S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERETNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGTS
Sbjct  607  TTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTS  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEW+GAPLPIC
Sbjct  667  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  494  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  554  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E  R    NG AAIPNRI +CRS+PLY+FVR ELGT 
Sbjct  614  GTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECRSYPLYRFVREELGTK  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGKLIDPL+DCLKEWNGAP+PIC
Sbjct  674  LLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>ref|XP_010504083.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  494  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  554  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E  R    NG AAIPNRI +CRS+PLY+FVR ELGT 
Sbjct  614  GTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRIAECRSYPLYRFVREELGTK  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGKLIDPL+DCLKEWNGAP+PIC
Sbjct  674  LLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   383 bits (984),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN +S +AKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKITVKNTISHIAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY+FAY DDPCSE YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  VNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSETYPLMQKVRQVLVEHALNNGENEKNV  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E  R  LE+G   IPNRI+DCRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIVAFEEELKALLPKEVESTRAGLESGNPFIPNRIKDCRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSGWNGAPLPIC  710



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   383 bits (983),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++ILKLMS T++VALCQAIDLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  487  SLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF Y DDPCS  YPLMQKLRQVLVDHAL NGE E +S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR ELENG  AIPNRI +CRS+PLYKFVR ELGT 
Sbjct  607  STSIFQKIGAFEEELKALLPKEVESARHELENGNPAIPNRITECRSYPLYKFVREELGTI  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+C GKLIDP+L+CLKEWNGAPLP+C
Sbjct  667  LLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   383 bits (983),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T+++AL QAIDLRHLEENLK   KN VSQVAK+VLT+G
Sbjct  499  SLGLISSRKTAEAVDILKLMSSTFLIALSQAIDLRHLEENLKNTVKNTVSQVAKRVLTIG  558

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDRE+VFAY DDPCS  YPLMQKLRQVLV+HAL NGE E++S
Sbjct  559  FNGELHPSRFCEKDLLKIVDREHVFAYIDDPCSSTYPLMQKLRQVLVEHALINGEREKNS  618

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFE+ELKA+LPKE+E  R + ENG +AI NRI+DCRS+PLYKFVR ELG S
Sbjct  619  STSIFQKIVAFEDELKALLPKEVESTRIDYENGNSAISNRIKDCRSYPLYKFVREELGAS  678

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEECDKVFTAMC GKLIDPLLDCLKEWNGAPLPIC
Sbjct  679  FLTGEKTTSPGEECDKVFTAMCAGKLIDPLLDCLKEWNGAPLPIC  723



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   383 bits (983),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA++ILKLMS+T++VALCQAIDLRH+EENLK+  KN VSQVAK+VLTVG
Sbjct  494  SLGLISSRKTAEAVEILKLMSSTFLVALCQAIDLRHIEENLKSVVKNTVSQVAKRVLTVG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL VV+REYVFAY DDPCS  YPLMQKLR VLVDHAL NG+ E +S
Sbjct  554  VNGELHPSRFCEKDLLNVVEREYVFAYIDDPCSATYPLMQKLRHVLVDHALENGDREGNS  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFE+ELK +LPKE+E  R ++ENG  A+PNRI +CRS+PLYKFVR  LGTS
Sbjct  614  STSIFQKIGAFEQELKTLLPKEVESVRVDVENGNPAVPNRIIECRSYPLYKFVRENLGTS  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK+RSPGEECDKVF A+C+G+ IDP+LDCLKEWNGAPLPIC
Sbjct  674  LLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGAPLPIC  718



>ref|XP_006403711.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
 dbj|BAJ33750.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45164.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
Length=725

 Score =   383 bits (983),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL NGE E++ 
Sbjct  561  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALCNGETEKNV  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFEEELKA LPKE+E  R    NG AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  621  ATSIFQKIGAFEEELKATLPKEVEATRAAFGNGTAAIPNRIKECRSYPLYKFVREELGTK  680

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL+DCLKEWNGAP+PIC
Sbjct  681  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  725



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   382 bits (982),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLKA  K+AVS VAKKVL  G
Sbjct  495  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKASVKSAVSLVAKKVLITG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LH SRFSEKDLL  VDREY FAYADDPCS NYPLMQKLRQVLVDHAL N   E +S
Sbjct  555  QNGGLHYSRFSEKDLLTAVDREYCFAYADDPCSANYPLMQKLRQVLVDHALLNSNEETNS  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIFHKI AFEEELK +LPKEIE ARC LENGK AIPNRIQ+CRS+PLYKFVR EL T+
Sbjct  615  STSIFHKISAFEEELKIVLPKEIESARCNLENGKPAIPNRIQECRSYPLYKFVREELRTN  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV+SPGEE DKVFTAM EGKL+DPLLDCLK+WNGAPLP+C
Sbjct  675  YLTGEKVQSPGEEFDKVFTAMNEGKLVDPLLDCLKKWNGAPLPLC  719



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   382 bits (981),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT+G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTIG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|NP_190894.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
 sp|P45724.2|PAL2_ARATH RecName: Full=Phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
 gb|AAK32895.1|AF367308_1 AT3g53260/T4D2_190 [Arabidopsis thaliana]
 emb|CAB64229.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
 gb|AAM91425.1| AT3g53260/T4D2_190 [Arabidopsis thaliana]
 gb|AAP59439.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEE79055.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana]
Length=717

 Score =   382 bits (981),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  493  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQ+LRQV+VDHAL+NGE E+++
Sbjct  553  INGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQRLRQVIVDHALSNGETEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E AR    NG A IPNRI++CRS+PLY+FVR ELGT 
Sbjct  613  VTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPLYRFVREELGTK  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGKLIDPL+DCLKEWNGAP+PIC
Sbjct  673  LLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  717



>gb|AAC18871.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=717

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  493  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQ+LRQV+VDHAL+NGE E+++
Sbjct  553  INGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQRLRQVIVDHALSNGETEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E AR    NG A IPNRI++CRS+PLY+FVR ELGT 
Sbjct  613  VTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPLYRFVREELGTK  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGKLIDPL+DCLKEWNGAP+PIC
Sbjct  673  LLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  717



>gb|AAM12956.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
 gb|AAN15354.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=717

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  493  SLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQ+LRQV+VDHAL+NGE E+++
Sbjct  553  INGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQRLRQVIVDHALSNGETEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELKA+LPKE+E AR    NG A IPNRI++CRS+PLY+FVR ELGT 
Sbjct  613  VTSIFQKIGAFEEELKAVLPKEVEAARAAYGNGTAPIPNRIKECRSYPLYRFVREELGTK  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGKLIDPL+DCLKEWNGAP+PIC
Sbjct  673  LLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  717



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   382 bits (982),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  502  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  561

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  562  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNA  621

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  622  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  681

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAPLPIC
Sbjct  682  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPLPIC  726



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+D+LKLMS+TY+VALCQAIDLRHLEENLK   +N V+QVAK+ LT+G
Sbjct  484  SLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRHLEENLKNAVRNTVNQVAKRTLTMG  543

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAYADDPCS NYPL QKLRQVLVDHAL NGE E++ 
Sbjct  544  VNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLFQKLRQVLVDHALQNGEHEKNV  603

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFE+ELKA+LPKE+EGAR  +ENG  AIPNRI +CRS+PLYKFVR ELGT 
Sbjct  604  STSIFQKIAAFEDELKAVLPKEVEGARSAIENGNPAIPNRITECRSYPLYKFVREELGTE  663

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            +LTGEKV+SPGE CDKVFTA+C+G +IDPLL+CLK W+GAPLPIC
Sbjct  664  MLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGAPLPIC  708



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQ+AK+ LT G
Sbjct  108  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTVKNTVSQIAKRTLTTG  167

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DD CS  YPLMQKLRQVLVDHALAN + E++ 
Sbjct  168  VNGELHPSRFCEKDLLKVVDREYVFAYVDDACSATYPLMQKLRQVLVDHALANADGEKNL  227

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK +LPKE+E AR   ENG+ AIPN+I++CRS+PLYKFVR ELGT 
Sbjct  228  NTSIFQKITTFEEELKTLLPKEVESARVAYENGQCAIPNKIEECRSYPLYKFVREELGTG  287

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDK+FTAMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  288  LLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  332



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++V LCQAIDLRHLEENLK+  K+ VSQVAKKVLT+G
Sbjct  492  SLGLISSRKTAEAVDILKLMSSTFLVGLCQAIDLRHLEENLKSAVKSTVSQVAKKVLTMG  551

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYV+AY DDPCS  YPLMQKLRQVLV+HAL+NGE E++S
Sbjct  552  VNGELHPSRFCEKDLLQVVDREYVYAYIDDPCSAVYPLMQKLRQVLVEHALSNGENEKNS  611

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI  FEEELK +LPKE+E AR  +E+  AAIPN+I+DCRS+PLY+F+R ELGT+
Sbjct  612  STSIFQKISLFEEELKVLLPKEVESARSAVESDNAAIPNQIKDCRSYPLYRFIRGELGTA  671

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGKLIDPLL+CLKEWNGAPLPIC
Sbjct  672  LLTGEKVVSPGEEIDKVFTAMCEGKLIDPLLECLKEWNGAPLPIC  716



>gb|KGN52971.1| hypothetical protein Csa_4G008250 [Cucumis sativus]
Length=255

 Score =   366 bits (939),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK+  K+ VSQVAKKVLT  
Sbjct  31   SLGLISSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKSVVKSTVSQVAKKVLTTS  90

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NG LHPSRF EKDLLKVVDREY FAY DDPCS  YPLMQKLRQ+LV+HAL NG+ E + 
Sbjct  91   SNGALHPSRFCEKDLLKVVDREYTFAYIDDPCSATYPLMQKLRQILVEHALKNGDSETNE  150

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFEEELKAILPKE+E  R   ENG + I N+I+DCRS+PLYKFVR ELGT 
Sbjct  151  NTSIFQKIGAFEEELKAILPKEVENVRLAYENGNSEIENQIKDCRSYPLYKFVREELGTR  210

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEEC+KVFTA+ +GK+ID + +CLKEWNGAPLPIC
Sbjct  211  LLTGEKVISPGEECEKVFTALSQGKMIDSIFECLKEWNGAPLPIC  255



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA++ILKLMS T++V LCQAIDLRHLEENLK+  KN VSQVAK+VLT+G
Sbjct  43   SLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSQVAKRVLTMG  102

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREY+FAY DDPCS  YPLMQKLR+ LV+HAL NG+ ER+ 
Sbjct  103  VNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNL  162

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFE+ELKA+LPKE+E AR  LE+G  AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  163  STSIFQKIAAFEDELKALLPKEVESARAALESGNPAIPNRIKECRSYPLYKFVREELGTE  222

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEE DKVFTAM  G++IDPLL+CL+ WNGAPLPIC
Sbjct  223  YLTGEKVRSPGEEFDKVFTAMSRGEIIDPLLECLESWNGAPLPIC  267



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMSATYMVALCQAIDLRHLEE LK+  KN V Q+AK+VLT+G
Sbjct  491  SLGLISSRKTAEAVDILKLMSATYMVALCQAIDLRHLEETLKSTVKNTVGQLAKRVLTMG  550

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQ LRQVLV HAL NGE E++S
Sbjct  551  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQNLRQVLVQHALLNGENEKNS  610

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFEEELKA+LPKE+EGAR   E+G  A+PNRI++CRS+P+YKFVR +L T 
Sbjct  611  NTSIFQKITAFEEELKALLPKEVEGARIAYESGSPAVPNRIKECRSYPIYKFVREQLHTG  670

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVF+AMCEGK+IDPLLDCL++WNGAPLPIC
Sbjct  671  LLTGEKVRSPGEEFDKVFSAMCEGKMIDPLLDCLRDWNGAPLPIC  715



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQAIDLRHLEENLK+  KN VS V+K++LT G
Sbjct  490  SLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAVKNTVSHVSKRILTTG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDRE VFAYADDPCS NYPLM+KLRQVLVDHALANGE E+++
Sbjct  550  ANGELHPSRFCEKELLKVVDREDVFAYADDPCSANYPLMKKLRQVLVDHALANGENEKNA  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KIGAFEEELKA+LPKE+E AR   ++G +AI N+I++CRS+PLYKFVR ELGT 
Sbjct  610  STSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTG  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC+GK+IDP+L+CL EWNGAPLPIC
Sbjct  670  LLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE++DILKLMS T++V LCQAIDLRHLEENLK   KN VSQVAK+VLT G
Sbjct  311  SLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKQTVKNTVSQVAKRVLTTG  370

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYV+AY DDPCS  YPLMQ LRQVLV+HAL NGE E+++
Sbjct  371  VNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNT  430

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK++LPKE+E AR   ENG AAI N+I +CRS+PLYKFVR ELGTS
Sbjct  431  STSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISNKITECRSYPLYKFVREELGTS  490

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKV+TAMC+GKLIDP+L+CL  WNG PLPIC
Sbjct  491  LLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  535



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  494  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQAVKNTVSQVAKKVLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGE+HPSRF E+DLLKVVDRE VF Y DDPCS +YPLMQKLRQV+VDHALANGE E++ 
Sbjct  554  VNGEMHPSRFCERDLLKVVDREQVFTYVDDPCSASYPLMQKLRQVIVDHALANGETEKNV  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELK +LPKE++ AR    NG AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  614  ETSIFQKIGAFEEELKTVLPKEVDAAREAYGNGNAAIPNRIKECRSYPLYKFVRGELGTK  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL+DCLKEWNGAP+P+C
Sbjct  674  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPLC  718



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ABF50788.1| phenylalanine ammonia-lyase [Isatis tinctoria]
Length=725

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+AYADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  561  VNGELHPSRFCEKDLLKVVDREQVYAYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE++ AR   ENG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  621  VTSIFHKIGAFEEELKAVLPKEVDAARAAYENGTSAIPNRIKECRSYPLYRFVREELGTQ  680

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG++V SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  681  LLTGDRVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   380 bits (977),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V LCQA+DLRH+EENLK+  KN VSQVAK+VL +G
Sbjct  483  SLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTVKNTVSQVAKRVLAMG  542

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF+Y DDPCS  YPLMQKLRQVLV+HAL NGE ER+S
Sbjct  543  FNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNS  602

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +T+I  KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGTS
Sbjct  603  TTTILQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECRSYPLYKFVREELGTS  662

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEW+GAPLPIC
Sbjct  663  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  707



>gb|AAD45384.1| phenylalanine ammonia-lyase [Vigna unguiculata]
Length=655

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGL+SSRKTAEA +ILKLMS+T++VALCQAIDLRHLEEN+K   KNAVSQVAK+VLT G
Sbjct  431  SLGLVSSRKTAEAEEILKLMSSTFLVALCQAIDLRHLEENMKNAVKNAVSQVAKRVLTTG  490

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VD EYVFAY DDPCS  YPLMQKLR VLVDHAL NGE E SS
Sbjct  491  INGELHPSRFCEKDLLKIVDHEYVFAYIDDPCSVTYPLMQKLRSVLVDHALQNGEKEASS  550

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIFHKI AFEEEL  +LPKE+E AR E+ENG ++IPNRI++CRS+PLYKFVR  LGTS
Sbjct  551  STSIFHKIRAFEEELITLLPKEVENARVEVENGNSSIPNRIKECRSYPLYKFVRESLGTS  610

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            L  GEKV+SPGEECDKVFTA+CEGK IDP++DCLK+WNG+PLPIC
Sbjct  611  LQYGEKVKSPGEECDKVFTALCEGKFIDPMMDCLKKWNGSPLPIC  655



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   381 bits (978),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRH+E NL+   KN VSQ+AKK LT G
Sbjct  497  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHVEGNLRNTVKNTVSQIAKKTLTTG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK VDREYVF Y DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  557  ANGELHPSRFCEKDLLKAVDREYVFVYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNT  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI  FEEEL A+LPKE+E AR  LENG AAIPN I+DCRS+PLYKFVR ELGT 
Sbjct  617  STSIFQKIADFEEELHAVLPKEVESARVTLENGNAAIPNMIKDCRSYPLYKFVREELGTG  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTAMC+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  677  LLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>ref|XP_009143533.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=719

 Score =   381 bits (978),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  495  SLGLISSRKTAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  555  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LP E+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  615  MTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  675  LLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  719



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   380 bits (977),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   381 bits (978),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  561  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNA  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  621  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  680

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  681  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   375 bits (963),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  308  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTMG  367

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREY+FAYADDPCS  YPLMQKLRQVLVDHAL NGE E++ 
Sbjct  368  ANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNV  427

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  LE+G  +IPNRI +CRS+PLY+ VR ELGT 
Sbjct  428  NSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVRKELGTE  487

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+VRSPGEE DKVFTAMC G++IDPLL+CLK WNGAPLPIC
Sbjct  488  LLTGERVRSPGEEIDKVFTAMCNGQVIDPLLECLKSWNGAPLPIC  532



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   364 bits (935),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKT E+++ILKLMS+T+++ LCQAIDLRHLEENLK+  KN VSQV+K+ LT G
Sbjct  16   SLGLISARKTNESIEILKLMSSTFLMGLCQAIDLRHLEENLKSSVKNTVSQVSKRTLTTG  75

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL N E E+  
Sbjct  76   GNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSGTYPLMQKLRQVLVDHALINAENEKDV  135

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK ILPKE+E  R   E+GKAAIPN+I++CRS+PLYKFVR ELGT 
Sbjct  136  NTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECRSYPLYKFVREELGTG  195

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DK+FTA+C+GK+IDPLL+CL EWNGAPLPIC
Sbjct  196  LLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  240



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   381 bits (978),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  561  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  621  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  680

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  681  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   380 bits (976),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+D+LKLMS+TY+VALCQAIDLR LEENL+   KNAV+QVAK+ LTVG
Sbjct  483  SLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRFLEENLRNAVKNAVTQVAKRTLTVG  542

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EKDLL+VVDREYVFAYADDPCS NYPLMQKLRQ LVDHAL NGE E+++
Sbjct  543  ANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHALQNGENEKNT  602

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF K+ AFE+ELKA+LPKE+E AR  +E+G  AIPNRI++CRS+PLYKFVR  LGT 
Sbjct  603  GTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYKFVREGLGTE  662

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMCEG +IDPLL+CLK W+GAPLPIC
Sbjct  663  LLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  707



>gb|ABC69916.1| phenylalanine ammonia-lyase [Brassica napus]
Length=722

 Score =   380 bits (977),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQAIDLRHLEENLK   KN VSQVAKKVLT G
Sbjct  498  SLGLISSRKTSEAVDILKLMSTTFLVGICQAIDLRHLEENLKQTVKNTVSQVAKKVLTTG  557

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  558  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  617

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG AAIPNRI++CRS+PLY+FVR ELGT 
Sbjct  618  MTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYRFVREELGTE  677

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK  SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  678  LLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   380 bits (977),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  493  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREY+FAYADDPCS NYPLMQKLRQVLVDHA+ NGE E++ 
Sbjct  553  ANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMKNGESEKNV  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KIGAFE+ELKA+LPKE+E AR  LE+G  AI NRI +CRS+PLY+FVR ELGT 
Sbjct  613  NSSIFQKIGAFEDELKAVLPKEVENARAALESGNPAIANRITECRSYPLYRFVRKELGTE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+VRSPGEECDKVFTAMC G++IDP+L+CLK WNGAPLPIC
Sbjct  673  LLTGERVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>ref|XP_009141625.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=722

 Score =   380 bits (977),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQAIDLRHLEENLK   KN VSQVAKKVLT G
Sbjct  498  SLGLISSRKTSEAVDILKLMSTTFLVGICQAIDLRHLEENLKQTVKNTVSQVAKKVLTTG  557

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  558  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  617

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG AAIPNRI++CRS+PLY+FVR ELGT 
Sbjct  618  MTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYRFVREELGTE  677

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK  SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  678  LLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   380 bits (976),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  488  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAYADD CS NYPLMQKLRQVLVDHAL NGE E+++
Sbjct  548  TNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNA  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  LE+G  AI NRI++CRS+PLY+FVR ELG  
Sbjct  608  NSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYRFVRGELGAE  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMC G++ID LL+CLKEWNGAPLPIC
Sbjct  668  LLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   380 bits (976),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+T++VA+CQA+DLRHLEENLK+  KN VSQVAK+VLT G
Sbjct  494  SLGLISSRKTQEAIDILKLMSSTFLVAICQAVDLRHLEENLKSTVKNTVSQVAKRVLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAYADDPCS  YPLMQKLRQVLVDHALANGE ER+ 
Sbjct  554  ANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALANGEGERNP  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TS+F KI AFEEELK +LPKEIEG R   E+G  AIPNRI++CRS+PLYKFVR   GTS
Sbjct  614  NTSVFQKIAAFEEELKDLLPKEIEGVRLAYESGNTAIPNRIKECRSYPLYKFVREVAGTS  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+C+GK+IDP+LDCL+EW+G PLPIC
Sbjct  674  LLTGEKVTSPGEELDKVFTAICQGKIIDPILDCLEEWDGTPLPIC  718



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   380 bits (977),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  561  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNA  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  621  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  680

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  681  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>gb|KFK34576.1| hypothetical protein AALP_AA5G163700 [Arabis alpina]
Length=707

 Score =   380 bits (975),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  483  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  542

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL NGE E+++
Sbjct  543  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALNNGETEKNA  602

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELK +LPKE+E AR    +G AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  603  VTSIFQKIGAFEEELKMVLPKEVEAARAAYGSGTAAIPNRIKECRSYPLYKFVREELGTK  662

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG+KV SPGEE DKVFTAMCEGKLIDP++DCLKEWNGAP+PIC
Sbjct  663  LLTGDKVVSPGEEFDKVFTAMCEGKLIDPMMDCLKEWNGAPIPIC  707



>gb|AAX22053.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22054.1| phenylalanine ammonia-lyase [Brassica napus]
Length=724

 Score =   380 bits (976),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  500  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  559

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  560  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNA  619

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELK +LPKE++  R    NG AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  620  VTSIFQKIGAFEEELKMVLPKEVDATREAYGNGTAAIPNRIKECRSYPLYKFVREELGTK  679

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL+DCLKEWNGAP+PIC
Sbjct  680  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  724



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   380 bits (976),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS+T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  499  SLGLISSRKTSEAVDILKLMSSTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  558

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  559  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNA  618

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELK +LPKE++ AR    NG AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  619  VTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPLYKFVREELGTK  678

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL++CLKEWNGAP+PIC
Sbjct  679  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>gb|ACZ36441.1| phenylalanine ammonialyase [Brassica oleracea var. alboglabra]
Length=714

 Score =   380 bits (975),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V +CQAIDLRHLEENLK   KN VS+VAKKVLT G
Sbjct  490  SLGLISSRKTAEAVDILKLMSTTFLVGICQAIDLRHLEENLKRTVKNTVSRVAKKVLTTG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  550  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG AAIPNRI++CRS+PLY+FVR ELGT 
Sbjct  610  MTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYRFVREELGTK  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK  SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  670  LLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  714



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   380 bits (975),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++ILKLMS T++VALCQAIDLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  487  SLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+ F Y DDPCS  YPLMQKLRQVLVDHAL NGE E +S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR ELENG  AIPNRI +CRS+PLYKFVR ELGT 
Sbjct  607  STSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYKFVREELGTI  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+C GKLIDP+L+CLKEWNGAPLP+C
Sbjct  667  LLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>gb|ACT22906.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=582

 Score =   375 bits (964),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++ILKLMS+T++VALCQA+DLRHLEENLK   KNAVSQVAKKVLT+G
Sbjct  358  SLGLISARKTAEAVEILKLMSSTFLVALCQAMDLRHLEENLKMSVKNAVSQVAKKVLTMG  417

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRFSEK+LLKVV+ E+VF Y DDPCS NYPLMQ+LRQVLVDHALANG+ E+ +
Sbjct  418  QNGELHPSRFSEKELLKVVEGEHVFGYIDDPCSNNYPLMQRLRQVLVDHALANGDAEKEA  477

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR E+E G+AAI +RI+  RS+PLY+FVR E GT 
Sbjct  478  STSIFLKIGAFEEELKAMLPKEVEAARVEVEKGRAAIESRIKGSRSYPLYRFVREEAGTG  537

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK RSPGEE DKVF AMCEGKLIDPL+DCL+EWNGAPLPIC
Sbjct  538  FLTGEKARSPGEEFDKVFRAMCEGKLIDPLMDCLREWNGAPLPIC  582



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   379 bits (974),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   379 bits (974),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+D+LKLMS+TY+VALCQAIDLR LEENL+   KNAV+QVAK+ LT+G
Sbjct  487  SLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRFLEENLRNAVKNAVTQVAKRTLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EKDLL+VVDREYVFAYADDPCS NYPLMQKLRQ LVDHAL NGE E+++
Sbjct  547  ANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQALVDHALQNGESEKNT  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF K+ AFE+ELKA+LPKE+E AR  +E+G  AIPNRI++CRS+PLYKFVR  LGT 
Sbjct  607  GTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECRSYPLYKFVREGLGTE  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMCEG +IDPLL+CLK W+GAPLPIC
Sbjct  667  LLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  711



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   380 bits (975),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ++DLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   379 bits (974),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++ILKLMS T++VALCQAIDLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  487  SLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+ F Y DDPCS  YPLMQKLRQVLVDHAL NGE E +S
Sbjct  547  FNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR ELENG  AIPNRI +CRS+PLYKFVR ELGT 
Sbjct  607  STSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECRSYPLYKFVREELGTI  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+C GKLIDP+L+CLKEWNGAPLP+C
Sbjct  667  LLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>gb|ADY02660.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   379 bits (973),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  469  SLGLISSRKTAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  528

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  529  INGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  588

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E  R   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  589  VTSIFHKIGAFEEELKAVLPKEVEATRAAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  648

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK IDP+++CL EWNGAP+PIC
Sbjct  649  LLTGEKVTSPGEEFDKVFTAICEGKHIDPMMECLNEWNGAPIPIC  693



>ref|XP_011077265.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Sesamum indicum]
Length=714

 Score =   379 bits (974),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+D+LKLM++T++VALCQAIDLRHLEENLKA  KN VSQVA+KVLT+G
Sbjct  490  SLGLISSRKTAEAVDVLKLMASTFLVALCQAIDLRHLEENLKATVKNTVSQVARKVLTIG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            + GELHPSRF E+DLL+ VDRE+VFAY DDPCS NYPLMQKLRQVLVDHAL + E E+S 
Sbjct  550  STGELHPSRFCERDLLRAVDREHVFAYIDDPCSANYPLMQKLRQVLVDHALISNEGEKSL  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIFHKIGAFEEELKA+LPKE+E AR ELE+G+ AI NRI++CRS+PLYKFVR ELGT 
Sbjct  610  STSIFHKIGAFEEELKALLPKEVESARVELESGRPAIANRIKNCRSYPLYKFVREELGTG  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK RSPGEE DKVFTA+CEGKLIDPLL+CLK W+GAPLPI 
Sbjct  670  FLTGEKARSPGEEFDKVFTAICEGKLIDPLLECLKVWDGAPLPIS  714



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   379 bits (974),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLV+HAL+NGE E++ 
Sbjct  546  ANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE VRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGETVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ADA81868.1| phenylalanine ammonia-lyase [Brassica rapa subsp. chinensis]
Length=721

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQAIDLRHLEENLK   KN VSQVAKKVLT G
Sbjct  497  SLGLISSRKTSEAVDILKLMSTTFLVGICQAIDLRHLEENLKQTVKNTVSQVAKKVLTTG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+ +
Sbjct  557  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKDA  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG AAIPNRI++CRS+PLY+FVR ELGT 
Sbjct  617  MTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYRFVREELGTE  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK  SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  677  LLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  721



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQA+DLRH EENL+   K+ VSQVAK+VLT+G
Sbjct  490  SLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHFEENLRNTVKSTVSQVAKRVLTMG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREY+FAY DDPCS  YPLMQKLRQVLV+HAL NGE E++ 
Sbjct  550  VNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNL  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEE+K +LPKE+E  R  +ENG +AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  610  STSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYKFVREELGTE  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTA+C+G++IDPL+DCLKEWNGAPLPIC
Sbjct  670  LLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>ref|XP_010516949.1| PREDICTED: phenylalanine ammonia-lyase 1 [Camelina sativa]
Length=727

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  503  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  562

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  563  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNA  622

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR E+GT 
Sbjct  623  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREEIGTE  682

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  683  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  727



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA++ILKLMS T++V LCQAIDLRHLEENLK+  KN VSQVAK+VLT+G
Sbjct  43   SLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSQVAKRVLTMG  102

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREY+FAY DDPCS  YPLMQKLRQ LV+HAL NG+ ER+ 
Sbjct  103  VNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALTNGDNERNL  162

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI  FE+ELKA+LPKE+E AR  LE+G  AIPNRI++CRS+PLYKFVR EL T 
Sbjct  163  STSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECRSYPLYKFVREELATD  222

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEE DKVFTAM +G++IDPLL CL+ WNGAPLPIC
Sbjct  223  YLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPIC  267



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ++DLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   379 bits (973),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  488  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAYADD CS NYPLMQKLRQVLVDHAL NGE E+++
Sbjct  548  ANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALENGENEKNA  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE ELKA+LPKE+E AR  LENG  AI NRI++CRS+PLY+FVR ELG  
Sbjct  608  NSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYRFVREELGAE  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMC G++ID LL+CLKEWNGAPLPIC
Sbjct  668  LLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   379 bits (973),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  553  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE++ AR  L++G A +PNRI +CRS+PLYKFVR ELG  
Sbjct  613  STSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVFTA+CEGK+IDP+LDCL+ WNGAPLPIC
Sbjct  673  YLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  717



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   379 bits (972),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENL+   KN VSQVAK+VLT G
Sbjct  490  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLRQAVKNTVSQVAKRVLTTG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAYADDPCS  YPLMQKLRQ+LV+HALANGE E+++
Sbjct  550  ANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHALANGENEKNA  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TS+F KI AFEEELK +LPKE+E  R   E+G  A  NRI++CRS+PLYKFVR ELGT 
Sbjct  610  GTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYKFVREELGTG  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG+KV SPGEE DKVFTAMC+GK+IDP++DCLKEWNGAPLPIC
Sbjct  670  LLTGDKVMSPGEEFDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN+VSQVAK+ LT+G
Sbjct  84   SLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRHLEENLRNTVKNSVSQVAKRTLTMG  143

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LL+VVDRE+VF Y DDPCS  YPLMQKLRQVLV+HAL NG+ E++ 
Sbjct  144  VNGELHPSRFCEKELLRVVDREHVFEYIDDPCSATYPLMQKLRQVLVEHALKNGDAEKNV  203

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEEL A+LPKE+E AR  +E+G   IPNRI++CRS+PLYKFVR ELGT 
Sbjct  204  STSIFQKIRAFEEELMALLPKEVESARRAVESGNPGIPNRIKECRSYPLYKFVREELGTG  263

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEE DKVFTAMCEG++IDPLLDCLK WNGAPLPIC
Sbjct  264  FLTGEKALSPGEEFDKVFTAMCEGQVIDPLLDCLKSWNGAPLPIC  308



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   379 bits (972),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQA+DLRH EENL+   K+ VSQVAK+VLT+G
Sbjct  490  SLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHFEENLRNTVKSTVSQVAKRVLTMG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREY+FAY DDPCS  YPLMQKLRQVLV+HAL NGE E++ 
Sbjct  550  VNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNL  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEE+K +LPKE+E  R  +ENG +AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  610  STSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYKFVREELGTE  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTA+C+G++IDPL+DCLKEWNGAPLPIC
Sbjct  670  LLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   362 bits (929),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 196/224 (88%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA++ILKLMS T++V LCQAIDLRHLEENLK+  KN VSQVAK+VLT+G
Sbjct  10   SLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSQVAKRVLTMG  69

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREY+FAY DDPCS  YPLMQKLR+ LV+HAL NG+ ER+ 
Sbjct  70   VNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNL  129

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFE+ELK +LPKE+E AR  LE+G  AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  130  STSIFQKIAAFEDELKTLLPKEVESARAALESGNPAIPNRIKECRSYPLYKFVREELGTE  189

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
             LTGEKVRSPGEE DKVFTAM +G++IDPLL+CL+ WNGAPLPI
Sbjct  190  YLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLECLESWNGAPLPI  233



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   378 bits (971),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  488  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAYADD CS NYPLMQKLRQVLVDHAL NGE E+++
Sbjct  548  ANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNA  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  LE+G  AI NRI++CRS+PLY+FVR ELG  
Sbjct  608  NSSIFQKILAFEDELKAVLPKEVESARIALESGNPAIANRIKECRSYPLYRFVREELGAE  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMC G++ID LL+CLKEWNGAPLPIC
Sbjct  668  LLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|ADY02661.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=673

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  449  SLGLISSRKTAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  508

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  509  INGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  568

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIG FEEELKA+LPKE+E  R   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  569  VTSIFHKIGXFEEELKAVLPKEVEATRAAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  628

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK IDP+++CL EWNGAP+PIC
Sbjct  629  LLTGEKVTSPGEEFDKVFTAICEGKHIDPMMECLNEWNGAPIPIC  673



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   364 bits (934),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EALDILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  58   SLGLISSRKTVEALDILKLMSSTYLVALCQAIDLRHLEENLKHAVKNTVSQVAKRALTMG  117

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL++VVDREYVF+Y DDPC   YPLMQKLRQVLV+HAL NGE E+++
Sbjct  118  ANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNA  177

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI  FEEELKA+LPKE+E AR  LE+G  A+PNRI +CRS+PLYKFVR ELG  
Sbjct  178  STSIFQKIEQFEEELKALLPKEVEAARLALESGSPAVPNRIAECRSYPLYKFVREELGAG  237

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEECDKVFTA+C G ++DPLLDCLK WNG PLPIC
Sbjct  238  FLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>gb|ABC69917.1| phenylalanine ammonia-lyase [Brassica napus]
Length=719

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  495  SLGLISSRKTAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  555  VNGELHPSRFCEKDLLKIVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAF EELKA+LP E+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  615  MTSIFHKIGAFGEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  675  LLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  719



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ABY89691.1| phenylalanine ammonialyase 2 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T+ V +CQAIDLRHLEENLK   KN VSQVAKKVLT G
Sbjct  498  SLGLISSRKTSEAVDILKLMSTTFPVGICQAIDLRHLEENLKQTVKNTVSQVAKKVLTTG  557

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  558  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  617

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG AAIPNRI++CRS+PLY+FVR ELGT 
Sbjct  618  MTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYRFVREELGTE  677

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK  SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  678  LLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  722



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ+IDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  495  SLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQVAKRTLTTG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR+VLV+HAL NGE E+++
Sbjct  555  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNA  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  615  STSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  675  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   378 bits (970),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ+IDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  495  SLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQVAKRTLTTG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR+VLV+HAL NGE E+++
Sbjct  555  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNA  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  615  STSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  675  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   363 bits (933),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EALDILKLM +TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  58   SLGLISSRKTVEALDILKLMFSTYLVALCQAIDLRHLEENLKHAVKNTVSQVAKRTLTMG  117

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL++VVDREYVF+Y DDPC   YPLMQKLRQVLV+HAL NGE E+++
Sbjct  118  ANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQVLVEHALKNGEGEKNA  177

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIFHKI  FEEELKA+LPKE+E AR  LE+G  A+PNRI +CRS+PLYKFVR +LG  
Sbjct  178  STSIFHKIEQFEEELKALLPKEVEAARMALESGSPAVPNRIAECRSYPLYKFVREQLGAG  237

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEECDKVFTA+C G ++DPLLDCLK WNG PLPIC
Sbjct  238  FLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+ LT G
Sbjct  395  SLGLISSRKTHEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTVKNVVSQVAKRTLTTG  454

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY FAY DDPCS  YPLMQKLRQVLVD+ALANGE E+++
Sbjct  455  VNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNT  514

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK +LPKE+EGAR   EN + AIPN+I++CRS+PLYKFVR ELGT+
Sbjct  515  NTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTA  574

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+V SPGEECDKVFTA+C+GK+IDPLL+CL EWNGAPLPIC
Sbjct  575  LLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  619



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   378 bits (971),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE++DILKLMS T++VALCQAIDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  502  SLGLISSRKTAESIDILKLMSTTFLVALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTG  561

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  562  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNA  621

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE++ AR  L++G A +PNRI +CRS+PLYKFVR ELG  
Sbjct  622  STSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAE  681

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVFTA+CEGK+IDP+LDCL+ WNGAPLPIC
Sbjct  682  YLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  726



>gb|AAX22055.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22056.1| phenylalanine ammonia-lyase [Brassica napus]
Length=723

 Score =   378 bits (971),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMSAT++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  499  SLGLISSRKTSEAVDILKLMSATFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  558

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
              GELHPSRF EKDLLKVVDRE VF Y DDPCS  YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  559  VYGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQVIVDHALSNGETEKNA  618

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELK +LPKE++ AR    NG AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  619  VTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPLYKFVREELGTK  678

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL++CLKEWNGAP+PIC
Sbjct  679  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>gb|ABY89690.1| phenylalanine ammonialyase 1 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   378 bits (971),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++V +CQAIDLRHLEENLK   KN VSQVAKKVLT G
Sbjct  498  SLGLISSRKTSEAVDILKLMSTTFLVGICQAIDLRHLEENLKQTVKNTVSQVAKKVLTTG  557

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  558  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  617

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG AAIPNRI++CRS+PLY+FVR ELGT 
Sbjct  618  MTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTAAIPNRIKECRSYPLYRFVREELGTE  677

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK  SPGEE DKVFTA+CEGK+I PL++CL EWNGAP+PIC
Sbjct  678  LLTGEKATSPGEEFDKVFTAICEGKIIGPLMECLDEWNGAPIPIC  722



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK+  KN VSQVAK+ LT+G
Sbjct  217  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSVVKNTVSQVAKRTLTIG  276

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
              GELHP+RF EK+LL+VVDREY+F YADDPCS  YPLMQKLRQVLVDHA+ NGE E++ 
Sbjct  277  AIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNI  336

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KIGAFE+EL A+LPKE+E AR  LE+G  +IPNRI +CRS+PLY+ VR ELGT 
Sbjct  337  NSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECRSYPLYRLVRQELGTE  396

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE +KVFTAMC G++IDPLL+CLK WNGAPLPIC
Sbjct  397  LLTGEKVRSPGEEIEKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  441



>gb|KHN02334.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=619

 Score =   375 bits (962),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQV+K++LT G
Sbjct  395  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSVKNTVSQVSKRILTTG  454

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL N E E+  
Sbjct  455  VNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQVLVDHALVNAENEKDM  514

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK  LPKE+E AR   E+GKAAIPN+IQ+CRS+PLYKFVR ELGT 
Sbjct  515  NTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECRSYPLYKFVREELGTG  574

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DK+FTAMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  575  LLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  619



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   378 bits (970),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  553  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE++ AR  L++G A +PNRI +CRS+PLYKFVR ELG  
Sbjct  613  STSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF+A+CEGK+IDP+LDCL+ WNGAPLPIC
Sbjct  673  YLTGEKVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>sp|P45727.1|PALY_PERAE RecName: Full=Phenylalanine ammonia-lyase [Persea americana]
 gb|AAA51873.1| phenylalanine ammonia lyase [Persea americana]
Length=620

 Score =   375 bits (962),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA++ILKLMS+T++V LCQAIDLRHLEENLK+  KN VSQVAK+VLT+G
Sbjct  396  SLGLISSRKTAEAVEILKLMSSTFLVGLCQAIDLRHLEENLKSTVKNTVSQVAKRVLTIG  455

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL+KVVD E++FAY DDPCS  YPLMQKLRQVLV+HAL NGE E+ S
Sbjct  456  VNGELHPSRFCEKDLIKVVDGEHLFAYIDDPCSCTYPLMQKLRQVLVEHALINGEKEKDS  515

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK  LPKE+E AR ELE G +AIPNRI++CRS+PLYKFVR EL TS
Sbjct  516  STSIFQKIGAFEEELKTHLPKEVESARIELERGNSAIPNRIKECRSYPLYKFVREELKTS  575

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVF+A+C+GK+IDPLL+CL+EWNGAP+PIC
Sbjct  576  LLTGEKVRSPGEEFDKVFSAICQGKVIDPLLECLREWNGAPIPIC  620



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   377 bits (967),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  462  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  521

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQ +RQVLV+HAL NGE E++ 
Sbjct  522  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQNVRQVLVEHALNNGENEKNG  581

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  582  STSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  641

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  642  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  686



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   377 bits (969),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   365 bits (938),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  125  SLGLISSRKTVEAMDILKLMSSTYLVALCQAIDLRHLEENLKLAVKNTVSQVAKRTLTMG  184

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+L++VVDREYVFAYADDPCS  YPLMQKLRQVLVDHAL NG+ E++ 
Sbjct  185  ANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLMQKLRQVLVDHALKNGDGEKNV  244

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIFHKI AFEEELKA+LPKE+E AR  LE+G  A+ NRI +CRS+PLYKF+R  LGT 
Sbjct  245  STSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECRSYPLYKFIREGLGTG  304

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEECDKVFTA+C+G ++DPLL+CL+ WNG PLPIC
Sbjct  305  FLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  349



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   377 bits (969),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++ILKLMS T++VALCQAIDLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  487  SLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTVKNTVSQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSR  EKDLLKVVDRE+VF Y DDPCS  YPLMQKLRQVLVDHAL NGE E +S
Sbjct  547  FNGELHPSRICEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEHNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIG FE+ELKA+LPKE+E AR ELENG  AIPNRI +CRS+PLYKFVR ELGT 
Sbjct  607  STSIFQKIGVFEDELKALLPKEVESARLELENGNPAIPNRITECRSYPLYKFVREELGTI  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+C GKLIDP+L+CLKEWNGAPLP+C
Sbjct  667  LLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ+IDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  495  SLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQVAKRTLTTG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR+VLV+HAL NGE E+++
Sbjct  555  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLVEHALTNGESEKNA  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  615  STSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  675  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>ref|XP_012082374.1| PREDICTED: phenylalanine ammonia-lyase [Jatropha curcas]
 gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+T++VALCQAIDLRHLEENLK   KN V+QVAK+VLT G
Sbjct  489  SLGLISSRKTQEAIDILKLMSSTFLVALCQAIDLRHLEENLKHAVKNTVTQVAKRVLTTG  548

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF  KDLLKVVDRE VFAY DDPCS  YPLMQKLRQVLV+HALANGE E+++
Sbjct  549  ANGELHPSRFCGKDLLKVVDREQVFAYIDDPCSATYPLMQKLRQVLVEHALANGENEKNA  608

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KIGAFEEELK +LPKE+E AR   E+G AAI N+I++CRS+PLYKFVR ELG+ 
Sbjct  609  STSVFQKIGAFEEELKTLLPKEVESAREAYESGSAAIGNKIKECRSYPLYKFVREELGSG  668

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGK+IDP+++CLKEWNGAPLPIC
Sbjct  669  LLTGEKVRSPGEEFDKVFTAMCEGKIIDPMMECLKEWNGAPLPIC  713



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   377 bits (969),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ+IDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECD+VF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AAY82485.1| phenylalanine ammonia-lyase [Ulmus americana]
Length=509

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS T++VALCQAIDLRHLEENLK   KN VSQVAKKVLT G
Sbjct  285  SLGLISSRKTEEAVEILKLMSTTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKKVLTTG  344

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NGELHPSR  EKDLLKVVDREYVF+Y DDPCS  YPLMQ+LRQVLVDHAL NGE E + 
Sbjct  345  SNGELHPSRLCEKDLLKVVDREYVFSYIDDPCSSIYPLMQELRQVLVDHALNNGEKETNP  404

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFEEELK +LPKE+E +R +LENG  AIP++I+ CRSFPLYKFVR ELGT 
Sbjct  405  NTSIFQKIAAFEEELKTLLPKEVESSRVQLENGNPAIPDKIKGCRSFPLYKFVREELGTG  464

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVF AMC GKLIDPLL+CLKEW+GAPLPIC
Sbjct  465  LLTGEKVKSPGEEFDKVFPAMCAGKLIDPLLECLKEWDGAPLPIC  509



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   377 bits (969),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE++DILKLMS T++V LCQAIDLRHLEENLK   KN VSQVAK+VLT G
Sbjct  502  SLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTVKNTVSQVAKRVLTTG  561

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYV+AY DDPCS  YPLMQ LRQVLV+HAL NGE E+++
Sbjct  562  VNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNT  621

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR   ENG AAI N+I +CRS+PLYKFVR +LGTS
Sbjct  622  STSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECRSYPLYKFVREQLGTS  681

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKV+TAMC+GKLIDP+L+CL+ WNG PLPIC
Sbjct  682  LLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLRGWNGEPLPIC  726



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   377 bits (968),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+ LT G
Sbjct  493  SLGLISSRKTHEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTVKNVVSQVAKRTLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY FAY DDPCS  YPLMQKLRQVLVD+ALANGE E+++
Sbjct  553  VNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNT  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI  FEEELK +LPKE+EGAR   EN + AIPN+I++CRS+PLYKFVR ELGT+
Sbjct  613  STSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTA  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+V SPGEECDKVFTA+C+GK+IDPLL+CL EWNGAPLPIC
Sbjct  673  LLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  717



>ref|XP_006439143.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
 gb|ESR52383.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
Length=308

 Score =   363 bits (933),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY++ALCQAIDLRHLEENLK+  KN +SQ AKKVLT+G
Sbjct  84   SLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTVKNTISQAAKKVLTMG  143

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF+YADDPCS  YPLM+KLRQVLVDHAL N E  +++
Sbjct  144  VNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQVLVDHALTNNEDLKNA  203

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            + SIF KIGAFEEELK +LPKE+E AR   E+G   IPNRI++CRS+PLY+FVR ELG  
Sbjct  204  NASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECRSYPLYRFVREELGAR  263

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEECDKVFTA+C+GK+IDPLL+CLKEW+G+PLPIC
Sbjct  264  YLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  308



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   377 bits (967),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SL LIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  488  SLDLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAYADD CS NYPLMQKLRQVLVDHAL NGE E+++
Sbjct  548  TNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQVLVDHALQNGENEKNA  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  LE+G  AI NRI++CRS+PLY+FVR ELG  
Sbjct  608  NSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECRSYPLYRFVRGELGAE  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMC G++ID LL+CLKEWNGAPLPIC
Sbjct  668  LLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|KFK36594.1| hypothetical protein AALP_AA4G144000 [Arabis alpina]
Length=727

 Score =   377 bits (969),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN V+QVAKKVLT G
Sbjct  503  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVAQVAKKVLTTG  562

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQVLVDH L NGE ER++
Sbjct  563  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVLVDHGLNNGESERNA  622

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  623  ATSIFHKIGAFEEELKAVLPKEVEAAREAYDNGTSAIPNRIKECRSYPLYRFVREELGTK  682

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE V SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  683  LLTGENVTSPGEEFDKVFTAICEGKIIDPMMECLDEWNGAPIPIC  727



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  488  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVF YADD CS NYPLMQKLRQVLVDHAL NGE E+++
Sbjct  548  ANGELHPSRFCEKDLLRVVDREYVFRYADDACSANYPLMQKLRQVLVDHALENGENEKNA  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE ELKA+LPKE+E AR  LENG  AI NRI++CRS+PLY+FVR ELG  
Sbjct  608  NSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYRFVREELGAE  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEECDKVFTAMC G++ID LL+CLKEWNGAPLPIC
Sbjct  668  LLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  493  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREY+FAYADDPCS NYPLMQKLRQVLVDHA+ NGE E++ 
Sbjct  553  ANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNV  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KIGAFE+ELKA+LPKE+E AR  LE G  AI NRI +CRS+PLY+FVR ELGT 
Sbjct  613  NSSIFQKIGAFEDELKAVLPKEVESARAALECGNPAIANRITECRSYPLYRFVRKELGTE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+VRSPGEEC+KVFTAMC G++IDP+L+CLK WNGAPLPIC
Sbjct  673  LLTGERVRSPGEECEKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLV+HAL+NGE E++ 
Sbjct  546  ANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVEHALSNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  + PNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIVAFEEELKAVLPKEVESARGAVESGNPSTPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN V QVAK+ LT+G
Sbjct  487  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVCQVAKRTLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL++VDREY+FAYADDPCS NYPLMQKLRQVLV+HAL NGE E+++
Sbjct  547  ANGELHPSRFCEKDLLRIVDREYLFAYADDPCSANYPLMQKLRQVLVEHALQNGENEKNA  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            S+SIF KI AFEEELK++LP+E+E AR  LE+G  AI NRI +CRS+PLYKFVR ELGT 
Sbjct  607  SSSIFQKIVAFEEELKSVLPREVESARVALESGNPAIANRINECRSYPLYKFVREELGTE  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+VRSPGEECDKVFTAMC G++ID LL+CLKEWNGAPLP+C
Sbjct  667  LLTGERVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPVC  711



>ref|XP_006410883.1| hypothetical protein EUTSA_v10016314mg [Eutrema salsugineum]
 gb|ESQ52336.1| hypothetical protein EUTSA_v10016314mg [Eutrema salsugineum]
Length=724

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE++DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  500  SLGLISSRKTAESVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  559

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ Y DDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  560  INGELHPSRFCEKDLLKVVDREQVYTYVDDPCSATYPLIQKLRQVIVDHALINGESEKNA  619

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELK +LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR E+GT 
Sbjct  620  VTSIFHKIGAFEEELKTVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREEIGTE  679

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+PIC
Sbjct  680  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  724



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ++DLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECD+VF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ++DLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECD+VF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAKK LT G
Sbjct  504  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNTVKNTVSQVAKKTLTTG  563

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            NNGELHPSRF EKDLLK VDREYVFAY DDPCS  YPLMQKLRQVLV+HA ANG+ E+ +
Sbjct  564  NNGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAFANGDNEKDT  623

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFE+E KA LPKE+EG R  LENG A IPN+I+ CRS+PLYKFVR ELGT 
Sbjct  624  NTSIFQKITAFEDEFKAALPKEVEGTRVSLENGNATIPNKIKGCRSYPLYKFVREELGTG  683

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LL+GE+ +SPGEE DKVF AMCEGK+IDP+++CLK WNGAPLPIC
Sbjct  684  LLSGEQGKSPGEEFDKVFIAMCEGKIIDPMMECLKGWNGAPLPIC  728



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQVAK+ LT G
Sbjct  492  SLGLISSRKTHEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTVKNVVSQVAKRTLTTG  551

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY FAY DDPCS  YPLMQKLRQVLVD+ALANGE E+++
Sbjct  552  VNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNT  611

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK +LPKE+EGAR   EN + AIPN+I++CRS+PLYKFVR ELGT+
Sbjct  612  NTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTA  671

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+V SPGEECDKVFTAMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  672  LLTGERVVSPGEECDKVFTAMCQGKIIDPLLECLGEWNGAPLPIC  716



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT E++DILKLMS T++VALCQAIDLRH+EENL+   KN VSQVAK+VLT G
Sbjct  497  SLGLISSRKTQESVDILKLMSTTFLVALCQAIDLRHMEENLRQTVKNTVSQVAKRVLTTG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDREYVFAYADDPCS  YPLMQKLRQV+VDHAL NG+ E+++
Sbjct  557  ANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNA  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFE ELK +LPKE+E AR   E+G A IPNRI +CRS+PLYKFVR E GT 
Sbjct  617  NTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYKFVREEQGTG  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            +LTG+KVRSPGEE DKVFTAMC+GK+IDPL+DCLKEWNGAPLPIC
Sbjct  677  ILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAKK LT G
Sbjct  494  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTVKNIVSQVAKKTLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK VD EYVF+Y DDPCS  YPLMQKLRQVLV+HAL+NG  E ++
Sbjct  554  PNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E +R  +ENG AAIPN+I +CRS+PLYKFVR ELGT 
Sbjct  614  STSIFQKIAAFEEELKTLLPKEVENSRVSVENGNAAIPNKIMECRSYPLYKFVREELGTG  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVF A+C+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  674  LLTGEKVKSPGEEFDKVFIAICQGKVIDPMLECLKEWNGAPLPIC  718



>ref|XP_009116020.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 2 
[Brassica rapa]
Length=725

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE VF Y DDPC   YPLMQKLRQV+VDHAL+NGE E+++
Sbjct  561  VNGELHPSRFCEKDLLKVVDREQVFTYVDDPCLATYPLMQKLRQVIVDHALSNGETEKNA  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KIGAFEEELK +LPKE++ AR    NG AAIPNRI++CRS+PLYKFVR ELGT 
Sbjct  621  VTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECRSYPLYKFVREELGTK  680

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTAMCEGK+IDPL++CLKEWNGAP+PIC
Sbjct  681  LLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  725



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT E++DILKLMS T++VALCQAIDLRH+EENL+   KN VSQVAK+VLT G
Sbjct  497  SLGLISSRKTQESVDILKLMSTTFLVALCQAIDLRHMEENLRQTVKNTVSQVAKRVLTTG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDREYVFAYADDPCS  YPLMQKLRQV+VDHAL NG+ E+++
Sbjct  557  ANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQVIVDHALLNGDNEKNA  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFE ELK +LPKE+E AR   E+G A IPNRI +CRS+PLYKFVR E GT 
Sbjct  617  NTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECRSYPLYKFVREEQGTG  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            +LTG+KVRSPGEE DKVFTAMC+GK+IDPL+DCLKEWNGAPLPIC
Sbjct  677  ILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>ref|XP_010505261.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Camelina sativa]
Length=727

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  503  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  562

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  563  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNA  622

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR E+GT 
Sbjct  623  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREEIGTE  682

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+ +C
Sbjct  683  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIAVC  727



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   363 bits (932),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   K+ VSQVAK+ LT G
Sbjct  87   SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKYSVKSTVSQVAKRTLTTG  146

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE +FAY DDPC   YPLMQKLRQVLVDHAL NGE E+ S
Sbjct  147  VNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQVLVDHALVNGEYEKDS  206

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KI  FE+ELK++LPKE+E AR   E+G  A+PN+I +CRS+PLYKFVR ELGT 
Sbjct  207  KTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAMPNKINECRSYPLYKFVRKELGTE  266

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK RSPGEECDK+FTA+C+GK+IDPLL+CL EWNGAPLPIC
Sbjct  267  LLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  311



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS T++VALCQAIDLRHLEENLK   KN VSQVAK++LT G
Sbjct  488  SLGLISSRKTEEAVDILKLMSTTFLVALCQAIDLRHLEENLKHAVKNTVSQVAKRILTTG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             +GELHPSRF EKDLLKVVDRE VF+Y DD CS  YPLMQKLRQVLVDHALANGE E+++
Sbjct  548  ASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQVLVDHALANGESEKNA  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR   ENG  AI N+I++CRS+PLYKFVR E+GT 
Sbjct  608  STSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECRSYPLYKFVREEIGTG  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK+RSPGEE DKVFTAMC+GK+IDP+LDCLKEWNGAPLPIC
Sbjct  668  LLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  712



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ+IDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR+VL +HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ+IDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLR+VL +HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLXEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  486  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSAVKKTVSHVAKKTLTTG  545

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  546  ANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  605

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  606  STSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECRSYPLYKFVREELGTG  665

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTA+CEGK+IDPLLDCL  WNGAPLPIC
Sbjct  666  LLTGEKVRSPGEDFDKVFTAICEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE++DILKLMS T++VALCQAIDLRHLEENL++  KN VS V+K+VLT G
Sbjct  490  SLGLISSRKTAESVDILKLMSTTFLVALCQAIDLRHLEENLRSAVKNTVSHVSKRVLTTG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDRE VFAYADDPCS  YPLMQKLRQVLVDHALANGE E+++
Sbjct  550  ANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNT  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KI AFEEELKA+LPKE+E AR   ++G +AI N+I++CRS+PLYKFVR ELGT 
Sbjct  610  STSVFQKITAFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTG  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC+GK+IDP+L+CL EWNGAPLPIC
Sbjct  670  LLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  872  TAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVGNNGELHPSR  693
            TAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G+NGELHPSR
Sbjct  165  TAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTGDNGELHPSR  224

Query  692  FSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSSSTSIFHKIG  513
            F EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++ TSIFHKIG
Sbjct  225  FCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIG  284

Query  512  AFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTSLLTGEKVRS  333
            AFEEELKA+LP E+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT LLTGEKV S
Sbjct  285  AFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTS  344

Query  332  PGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            PGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  345  PGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>gb|KDO36715.1| hypothetical protein CISIN_1g016039mg [Citrus sinensis]
Length=396

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY++ALCQAIDLRHLEENLK+  KN +SQVAKKVLT+G
Sbjct  172  SLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTVKNTISQVAKKVLTMG  231

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF+YADDPCS  YPLM+KLRQVLVDHAL N E  +++
Sbjct  232  VNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQVLVDHALTNNEDLKNA  291

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            + SIF KIGAFEEELK +LPKE+E AR   E+G   IPNRI++CRS+PLY+FVR ELG  
Sbjct  292  NASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECRSYPLYRFVREELGAR  351

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEECDKVFTA+C+GK+IDPLL+CLKEW+G+PLPIC
Sbjct  352  YLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  396



>ref|XP_011658466.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis sativus]
Length=558

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   K+ VSQVAKKVLT G
Sbjct  334  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNVVKSTVSQVAKKVLTTG  393

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LHPSRF EKDLLKVVDREY FAY DD CS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  394  VNGALHPSRFCEKDLLKVVDREYTFAYVDDACSATYPLMQKLRQVLVEHALENGEDEKNT  453

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFEEELKAILPKE+E AR   ENG + I N+I++CRS+PLYKFVR EL T 
Sbjct  454  NTSIFQKIGAFEEELKAILPKEVENARLSYENGTSTIENQIKECRSYPLYKFVREELRTG  513

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEEC+KVFTA+C+GK+IDP+L+CLKEWNGAP+PIC
Sbjct  514  LLTGEKVISPGEECEKVFTALCQGKMIDPILECLKEWNGAPIPIC  558



>gb|KGN48161.1| hypothetical protein Csa_6G445740 [Cucumis sativus]
Length=544

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   K+ VSQVAKKVLT G
Sbjct  320  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNVVKSTVSQVAKKVLTTG  379

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LHPSRF EKDLLKVVDREY FAY DD CS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  380  VNGALHPSRFCEKDLLKVVDREYTFAYVDDACSATYPLMQKLRQVLVEHALENGEDEKNT  439

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIGAFEEELKAILPKE+E AR   ENG + I N+I++CRS+PLYKFVR EL T 
Sbjct  440  NTSIFQKIGAFEEELKAILPKEVENARLSYENGTSTIENQIKECRSYPLYKFVREELRTG  499

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEEC+KVFTA+C+GK+IDP+L+CLKEWNGAP+PIC
Sbjct  500  LLTGEKVISPGEECEKVFTALCQGKMIDPILECLKEWNGAPIPIC  544



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAKK LT G
Sbjct  497  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNTVKNTVSQVAKKTLTTG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            NNGELHPSRF EKDLLK VDREYVFAY DDPCS  YPLMQKLRQVLV+HA ANG+ E+ +
Sbjct  557  NNGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAFANGDNEKDT  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFE+E KA LPKE+EG R  LENG A IPN+I+ CRS+PLYKFVR ELGT 
Sbjct  617  NTSIFQKITAFEDEFKAALPKEVEGTRVSLENGNATIPNKIKGCRSYPLYKFVREELGTG  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LL+GE+ +SPGEE DKVF AMCEGK+IDP+++CLK WNGAPLPIC
Sbjct  677  LLSGEQGKSPGEEFDKVFIAMCEGKIIDPMMECLKGWNGAPLPIC  721



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQAIDLRHLEENL++  KN VS V+K+VLT G
Sbjct  490  SLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLRSAVKNTVSHVSKRVLTTG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDRE VFAYADDPCS  YPLMQKLRQVLVDHALANGE E+++
Sbjct  550  ANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNA  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KI  FEEELKA+LPKE+E AR   ++G +AI N+I++CRS+PLYKFVR ELGT 
Sbjct  610  STSVFQKIATFEEELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTG  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC+GK+IDP+L+CL EWNGAPLPIC
Sbjct  670  LLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   375 bits (962),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DI+KLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAKK LT G
Sbjct  446  SLGLISSRKTAEAVDIIKLMSSTYLVALCQAIDLRHLEENLKNTVKNIVSQVAKKTLTTG  505

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK VD EYVF+Y DDPCS  YPLMQKLRQVLV+HAL+NG  E ++
Sbjct  506  PNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNA  565

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E +R  +ENG  AIPN+I  CRS+PLYKFVR ELGT 
Sbjct  566  STSIFQKIAAFEEELKTLLPKEVENSRVSIENGNPAIPNKITKCRSYPLYKFVREELGTG  625

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVF AMC+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  626  LLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  670



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQ++DLRHLEENL+   KN VSQVAK+ LT G
Sbjct  496  SLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTVKNTVSQVAKRTLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  556  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGESEKNA  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR  +E+G AA+PNRI +CRS+PLYKFVR ELG  
Sbjct  616  STSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECRSYPLYKFVREELGGE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECD+VF A+C+GK+IDP+L CL+ WNGAPLPIC
Sbjct  676  YLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREY+FAYADDPCS  YPLMQKLRQVLVDHAL NGE E++ 
Sbjct  553  ANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQVLVDHALNNGESEKNV  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  LE+G  +IPNRI +CRS+PLY+ VR ELGT 
Sbjct  613  NSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVRKELGTE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+VRSPGEE DKVFTAMC G++IDPLL+CLK WNGAPLPIC
Sbjct  673  LLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+ LT G
Sbjct  488  SLGLISSRKTNEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTVKNVVSQVAKRTLTTG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVV+REY FAY DDPCS  YPLMQKLRQVLVD+ALANGE E++ 
Sbjct  548  VNGELHPSRFCEKDLLKVVEREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNL  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI +FEEELK +LPKE+EGAR   EN + AIPN+I+DCRS+PLYKFVR ELGTS
Sbjct  608  NTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCRSYPLYKFVREELGTS  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDKVF+AMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  668  LLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  553  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE++ AR  L++G A +PNRI +CRS+PLYKFVR ELG  
Sbjct  613  STSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVF+A+CEGK+IDP+L+CL+ WNGAPLPIC
Sbjct  673  YLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  717



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 195/224 (87%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGL+SSRKTAEA++ILKLMS T++  L QA+DLRHLEENLK+  KN VSQVAKKVLT+G
Sbjct  43   SLGLVSSRKTAEAVEILKLMSTTFLAGLLQAVDLRHLEENLKSTVKNTVSQVAKKVLTMG  102

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREY+FAY DDPCS  YPLMQKLRQVLV+HAL NGE E++ 
Sbjct  103  VNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNL  162

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFE+ELK +LPKE+E AR  LE+G  A+PNRI++CRS+PLYKF+R ELGT 
Sbjct  163  STSIFQKIAAFEDELKTLLPKEVESARAVLESGNPAVPNRIKECRSYPLYKFIREELGTV  222

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
             LTGEKV SPGEE DKVFTAMC+G++IDPL++CL+ WNGAPLPI
Sbjct  223  YLTGEKVTSPGEEFDKVFTAMCKGQIIDPLMECLQSWNGAPLPI  266



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQAIDLRHLEENL++  KN VS V+K+VLT G
Sbjct  490  SLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLRSAVKNTVSHVSKRVLTTG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDRE VFAYADDPCS  YPLMQKLRQVLVDHALANGE E+++
Sbjct  550  ANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVLVDHALANGENEKNA  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KI AFE+ELKA+LPKE+E AR   ++G +AI N+I++CRS+PLYKFVR ELGT 
Sbjct  610  STSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKECRSYPLYKFVREELGTG  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE VRSPGEE DKVFTAMCEGK+IDP+L+CL EWNGAPLPIC
Sbjct  670  LLTGENVRSPGEEFDKVFTAMCEGKIIDPMLECLGEWNGAPLPIC  714



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAKK LT G
Sbjct  494  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTVKNIVSQVAKKTLTTG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK VD EYVF+Y DDPCS  YPLMQKLRQVLV+HAL+NG  E ++
Sbjct  554  PNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQVLVEHALSNGNNENNA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E +R  ++NG  AIPN+I +CRS+PLYKFVR ELGT 
Sbjct  614  STSIFQKIAAFEEELKTLLPKEVENSRVSIQNGNPAIPNKITECRSYPLYKFVREELGTG  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVF AMC+GK+IDP+L+CLKEWNGAPLPIC
Sbjct  674  LLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  718



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENLK+  K  VS VAKK LT G
Sbjct  483  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTTG  542

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK LLKVVDRE+VFAY DDPCS  YPLMQK+RQVLV+HAL NGE E++ 
Sbjct  543  ANGELHPSRFCEKXLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGENEKNG  602

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR  +E+G  +IPNRI++CRS+PLYKFVR ELGT 
Sbjct  603  STSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECRSYPLYKFVREELGTG  662

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGE+ DKVFTAMCEGK+IDPLLDCL  WNGAPLPIC
Sbjct  663  LLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  707



>ref|XP_010528074.1| PREDICTED: phenylalanine ammonia-lyase 1 [Tarenaya hassleriana]
Length=720

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA++ILKLMS TY+VALCQA+DLRHLEENLK   KNAVSQVAKKVLT G
Sbjct  496  SLGLISSRKTAEAIEILKLMSTTYLVALCQAVDLRHLEENLKQTVKNAVSQVAKKVLTTG  555

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF YADDPC+  YPL+QKLRQ+LVD+AL+NGE E++ 
Sbjct  556  INGELHPSRFCEKDLLKVVDREHVFTYADDPCNSTYPLIQKLRQILVDYALSNGENEKNV  615

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            + SIFHKIGAFEEELK +LPKE++  R   E G   IPNRI++CRS+PLY+FVR ELGT 
Sbjct  616  AVSIFHKIGAFEEELKMVLPKEVDAIRAAYEEGTMTIPNRIKECRSYPLYRFVREELGTE  675

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGK+IDP+++CLKEWNGAP+PI 
Sbjct  676  LLTGEKVRSPGEEFDKVFTAMCEGKIIDPMMECLKEWNGAPIPIS  720



>ref|XP_010509401.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Camelina sativa]
Length=726

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT+EA+DILKLMS T++VA+CQA+DLRHLEENL+   KN VSQVAKKVLT G
Sbjct  502  SLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTVKNTVSQVAKKVLTTG  561

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  562  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALINGESEKNA  621

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LPKE+E AR   +NG +AIPNRI++CRS+PLY+FVR E+GT 
Sbjct  622  VTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECRSYPLYRFVREEIGTE  681

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDP+++CL EWNGAP+ IC
Sbjct  682  LLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIAIC  726



>gb|ADY02662.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   375 bits (963),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  469  SLGLISSRKTAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  528

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++
Sbjct  529  INGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNA  588

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIG FEEELKA+LPKE+E  R   +NG +AIPNRI++CRS+PLY+FVR E GT 
Sbjct  589  VTSIFHKIGXFEEELKAVLPKEVEATRAAYDNGTSAIPNRIKECRSYPLYRFVREEXGTE  648

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK IDP+++CL EWNGAP+PIC
Sbjct  649  LLTGEKVTSPGEEFDKVFTAICEGKHIDPMMECLNEWNGAPIPIC  693



>ref|XP_012082376.1| PREDICTED: phenylalanine ammonia-lyase-like [Jatropha curcas]
Length=713

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+T++VALCQAIDLRHLEENLK   KN V+QVAK+VLT G
Sbjct  489  SLGLISSRKTQEAIDILKLMSSTFLVALCQAIDLRHLEENLKHAVKNTVTQVAKRVLTTG  548

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF  KDLLK VDRE VFAY DDPCS  YPLMQKLRQVLV+HALANGE E+++
Sbjct  549  GNGELHPSRFCGKDLLKAVDREQVFAYIDDPCSATYPLMQKLRQVLVEHALANGENEKNA  608

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KIGAFEEELK +LPKE+E AR   E+G AAI N+I++CRS+PLYKFVR ELG+ 
Sbjct  609  STSVFEKIGAFEEELKTLLPKEVESAREAYESGSAAIGNKIKECRSYPLYKFVREELGSG  668

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGK+IDP+++CLKEWNGAPLPIC
Sbjct  669  LLTGEKVRSPGEEFDKVFTAMCEGKIIDPMMECLKEWNGAPLPIC  713



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE++DILKLMS T++V LCQAIDLRHLEENLK   KN VSQVAK+VLT G
Sbjct  502  SLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTVKNTVSQVAKRVLTTG  561

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYV+AY DDPCS  YPLMQ LRQVLV+HAL NGE E+++
Sbjct  562  VNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNT  621

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+E AR   ENG AAI N+I +CRS+PLYKFVR +LGTS
Sbjct  622  STSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECRSYPLYKFVREQLGTS  681

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKV+TAMC+GKLIDP+L CL  WNG PLPIC
Sbjct  682  LLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLACLSGWNGEPLPIC  726



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+T++VALCQAIDLRHLEENLK   KN V+QVAK+VLT G
Sbjct  489  SLGLISSRKTQEAIDILKLMSSTFLVALCQAIDLRHLEENLKHAVKNTVTQVAKRVLTTG  548

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF  KDLLK VDRE VFAY DDPCS  YPLMQKLRQVLV+HALANGE E+++
Sbjct  549  GNGELHPSRFCGKDLLKAVDREQVFAYIDDPCSATYPLMQKLRQVLVEHALANGENEKNA  608

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KIGAFEEELK +LPKE+E AR   E+G AAI N+I++CRS+PLYKFVR ELG+ 
Sbjct  609  STSVFEKIGAFEEELKTLLPKEVESAREAYESGSAAIGNKIKECRSYPLYKFVREELGSG  668

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGK+IDP+++CLKEWNGAPLPIC
Sbjct  669  LLTGEKVRSPGEEFDKVFTAMCEGKIIDPMMECLKEWNGAPLPIC  713



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS TY+VALCQAIDLRHLEENL+   KN VSQVAK+VLT G
Sbjct  490  SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLRQAVKNTVSQVAKRVLTAG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAYADDPCS  YPLMQKLRQ+LV+HALANGE E+++
Sbjct  550  ANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQILVEHALANGENEKNA  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TS+F KI AFEEELK +LPKE+E  R   E+G  A  NRI++CRS+PLYKFVR ELGT 
Sbjct  610  GTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATANRIKECRSYPLYKFVREELGTG  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTG+KV S GEE DKVFTAMC+GK+IDP++DCLKEWNGAPLPIC
Sbjct  670  LLTGDKVMSSGEEFDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAKK LT G
Sbjct  497  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNTVKNTVSQVAKKTLTTG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            NNGELHPSRF EKDLLK VDREYVFAY DDPCS  YPLMQKLRQVLV+HA ANG+ E+ +
Sbjct  557  NNGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQVLVEHAFANGDNEKDT  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIF KI AFE+E KA LPKE+EG R  LENG A IPN+I+ CRS+PLYKFVR ELGT 
Sbjct  617  HTSIFQKITAFEDEFKAALPKEVEGTRVSLENGNATIPNKIKGCRSYPLYKFVREELGTG  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LL+GE+ +SPGEE DKVF AMCEGK+IDP+++CLK WNGAPLPIC
Sbjct  677  LLSGEQGKSPGEEFDKVFIAMCEGKIIDPMMECLKGWNGAPLPIC  721



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQV+K++LT G
Sbjct  488  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSVKNTVSQVSKRILTTG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL N E E+  
Sbjct  548  VNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQVLVDHALVNAENEKDM  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK  LPKE+E AR   E+GKAAIPN+IQ+CRS+PLYKFVR ELGT 
Sbjct  608  NTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECRSYPLYKFVREELGTG  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DK+FTAMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  668  LLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  712



>gb|AFP86474.1| phenylalanine ammonia-lyase, partial [Brassica rapa subsp. chinensis]
Length=746

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  522  SLGLISSRKTAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  581

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE V+ YADDPCS  YPL+Q  RQV+VDHAL NGE E+++
Sbjct  582  VNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQTPRQVIVDHALVNGESEKNA  641

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEELKA+LP E+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT 
Sbjct  642  MTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTE  701

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  702  LLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  746



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQ++DLRHLEEN+K+  KN VSQVAKKVLT+G
Sbjct  115  SLGLISARKTAEAVDILKLMSSTYLVALCQSVDLRHLEENMKSTVKNTVSQVAKKVLTMG  174

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAY DDPCS  YPLMQ+LRQVLVDHAL NGE E+++
Sbjct  175  VNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQRLRQVLVDHALNNGETEKNT  234

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FE+ELKAILPKE+E  R   E    +IPNRI+ CRS+PLY+FVR ELG  
Sbjct  235  NTSIFQKIATFEDELKAILPKEVESVRTAYETDSLSIPNRIKACRSYPLYRFVREELGGG  294

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV SPGEE DKVFTAMC+G+LIDPLL+C++ WNGAPLPIC
Sbjct  295  FLTGEKVTSPGEEFDKVFTAMCKGELIDPLLECVEGWNGAPLPIC  339



>ref|XP_003591877.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES62128.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=722

 Score =   375 bits (964),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++I KLMS+T++VALCQAIDLRH+EEN K+  KN VSQVAK++LTVG
Sbjct  498  SLGLISARKTAEAVEIWKLMSSTFLVALCQAIDLRHIEENFKSVVKNTVSQVAKRILTVG  557

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL VV+ EYVF Y DDPCS  YPLMQKLR VLVDHAL NG+ E +S
Sbjct  558  VNGELHPSRFCEKDLLNVVEGEYVFTYIDDPCSPIYPLMQKLRYVLVDHALQNGDKEANS  617

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E AR E+ENG  A+PN I++CRS+PLYKF+R  LGTS
Sbjct  618  STSIFQKIGAFEEELKALLPKEVENARVEIENGNPAVPNMIKECRSYPLYKFMRETLGTS  677

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK+RSPGE+CDKVFTAMC+G+ IDP+LDCLKEWNG PLPIC
Sbjct  678  LLTGEKIRSPGEDCDKVFTAMCDGRFIDPMLDCLKEWNGVPLPIC  722



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   376 bits (965),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK+  KN VSQ+AK+VLT G
Sbjct  506  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTVKNTVSQLAKRVLTTG  565

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL VV+REY+FAY DDPCS  YPLMQ+LRQVLV+HAL NGE E+++
Sbjct  566  VNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNA  625

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK ILPKE+E AR   E+G AAIPNRI +CRS+PLYKFVR ELG  
Sbjct  626  STSIFQKITAFEEELKTILPKEVESARAAYESGNAAIPNRIVECRSYPLYKFVREELGGE  685

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVFTAMC+G +IDP+LDCL  WNG PLPIC
Sbjct  686  FLTGEKVRSPGEECDKVFTAMCQGNIIDPILDCLSGWNGEPLPIC  730



>sp|Q40910.1|PAL4_POPKI RecName: Full=Phenylalanine ammonia-lyase G4, partial [Populus 
sieboldii x Populus grandidentata]
 dbj|BAA07861.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=571

 Score =   371 bits (952),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++IL +MS T++VALCQAIDLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  347  SLGLISARKTAEAVEILNVMSTTWLVALCQAIDLRHIEENLKNTVKNTVSQVAKRVLTMG  406

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF Y DDPCS  YPLMQKLRQVLVDHAL NGE E++S
Sbjct  407  FNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEQNS  466

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR ELENG  AIPNRI D RS+PLYKFVR ELGT 
Sbjct  467  STSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYKFVREELGTV  526

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+C GKLIDP    LKEWNGAPLP+C
Sbjct  527  LLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  571



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   370 bits (950),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   K+ VSQVA+KVLTVG
Sbjct  331  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKDTVSQVARKVLTVG  390

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK  DRE+VFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  391  ANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNA  450

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFEEELKA+LPKE+E AR  +ENG   IPNRI++CRS+PLY+ VR ELGT+
Sbjct  451  NSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVREELGTN  510

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV SPGEE DKVFTAMC+GK+IDP+L+CL EWNGAPLPIC
Sbjct  511  FLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLWEWNGAPLPIC  555



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   365 bits (938),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T++V L QAIDLRHLE+NLK   KN VSQVAK+ LT G
Sbjct  192  SLGLISSRKTHEAIEILKLMSSTFLVGLWQAIDLRHLEDNLKNTVKNVVSQVAKRTLTTG  251

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY FAY DDPCS  YPLMQKLRQVLVD+ALANGE E+++
Sbjct  252  VNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNT  311

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI +FEEELK +LPKE+EGAR   EN + AIPN+I++CRS+PLYKFVR ELGT+
Sbjct  312  NTSIFQKIASFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECRSYPLYKFVREELGTA  371

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+V SPGEECDKVFTA+C+G +IDPLL+CL EWNGAPLPIC
Sbjct  372  LLTGERVISPGEECDKVFTALCQGNIIDPLLECLGEWNGAPLPIC  416



>ref|XP_011041027.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X2 [Populus 
euphratica]
Length=711

 Score =   375 bits (962),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKL+S T++V LCQA+DLRH+EENLK   KN V+QVAK+VLT+G
Sbjct  487  SLGLISSRKTAEAVDILKLVSTTFLVGLCQAVDLRHVEENLKNTVKNTVNQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             + ELHP RF EKDLLKVVDRE+VF+Y DDPCS  YPLMQKLRQVLV+HAL NGE ER+S
Sbjct  547  FSDELHPLRFYEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  607  TTSIFQKIGSFEEELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVREELGTR  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEWNGAPLPIC
Sbjct  667  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  711



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   375 bits (963),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL++  KN VSQVAK+ LT+G
Sbjct  497  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRSAVKNTVSQVAKRTLTMG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREYVFAYADDPCS  YPLMQKLRQVLVDHA+ NGE E++ 
Sbjct  557  ANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNV  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  +E+G  AIPNRI +CRS+PLY+ VR ELG+ 
Sbjct  617  NSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECRSYPLYRLVRQELGSE  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC G++IDPLL+CLK WNGAPLPIC
Sbjct  677  LLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   371 bits (952),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++IL +MS T++VALCQAIDLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  358  SLGLISARKTAEAVEILNVMSTTWLVALCQAIDLRHIEENLKNTVKNTVSQVAKRVLTMG  417

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF Y DDPCS  YPLMQKLRQVLVDHAL NGE E++S
Sbjct  418  FNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQVLVDHALMNGEKEQNS  477

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELK +LPKE+E AR ELENG  AIPNRI D RS+PLYKFVR ELGT 
Sbjct  478  STSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRRSYPLYKFVREELGTV  537

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEE DKVFTA+C GKLIDP    LKEWNGAPLP+C
Sbjct  538  LLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  582



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   375 bits (962),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPC+  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  553  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCNATYPLMQKLRQVLVEHALTNGENEKNA  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE++ AR  L++G A +PNRI +CRS+PLYKFVR ELG  
Sbjct  613  STSIFQKIVAFEEELKVLLPKEVDSARAALDSGTAGVPNRITECRSYPLYKFVREELGAE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGE+VRSPGEECDKVF+A+CEGK+IDP+LDCL+ WNGAPLPIC
Sbjct  673  YLTGEEVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   364 bits (934),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  872  TAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVGNNGELHPSR  693
            TAEA+DILKLMS T++VA+CQA+DLRHLEENLK   KN VSQVAKKVLT G NGELHPSR
Sbjct  165  TAEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTVKNTVSQVAKKVLTTGVNGELHPSR  224

Query  692  FSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSSSTSIFHKIG  513
            F EKDLLKVVDRE V+ YADDPCS  YPL+QKLRQV+VDHAL NGE E+++ TSIFHKIG
Sbjct  225  FCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQVIVDHALVNGESEKNAMTSIFHKIG  284

Query  512  AFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTSLLTGEKVRS  333
            AFEEELKA+LP E+E AR   +NG +AIPNRI++CRS+PLY+FVR ELGT LLTGEKV S
Sbjct  285  AFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECRSYPLYRFVREELGTELLTGEKVTS  344

Query  332  PGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            PGEE DKVFTA+CEGK+IDPL++CL EWNGAP+PIC
Sbjct  345  PGEEFDKVFTAICEGKIIDPLMECLSEWNGAPIPIC  380



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   374 bits (961),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKL+S T++V LCQA+DLRH+EENLK   KN V+QVAK+VLT+G
Sbjct  487  SLGLISSRKTAEAVDILKLVSTTFLVGLCQAVDLRHVEENLKNTVKNTVNQVAKRVLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             + ELHP RF EKDLLKVVDRE+VF+Y DDPCS  YPLMQKLRQVLV+HAL NGE ER+S
Sbjct  547  FSDELHPLRFYEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNS  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  607  TTSIFQKIGSFEEELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVREELGTR  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEWNGAPLPIC
Sbjct  667  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  711



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   374 bits (961),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKT EA++ILKLMS TY++ALCQAIDLRHLEENLK   KN VSQVAK+ LT G
Sbjct  491  SLGLISARKTNEAVEILKLMSPTYLIALCQAIDLRHLEENLKNTVKNTVSQVAKRTLTTG  550

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDREY FAY DDPCS  YPLMQKLRQVLV+HALAN E E++ 
Sbjct  551  VNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSATYPLMQKLRQVLVEHALANAENEKNV  610

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK +LPKE+EGAR   ENG++AIPN+I++CRS+PLYKFVR ELGT 
Sbjct  611  NTSIFQKITTFEEELKTLLPKEVEGARIAYENGQSAIPNKIKECRSYPLYKFVREELGTE  670

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            +LTGEKVRSPGEECDK+FTAMC+GK+IDPLL+C+ EWNGAPLP+C
Sbjct  671  MLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPLC  715



>ref|XP_010107516.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
 gb|EXC16198.1| Phenylalanine ammonia-lyase 1 [Morus notabilis]
Length=534

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE++DILKLMS T++V LCQAIDLRHLEENLK   KN VSQV K+VLT G
Sbjct  310  SLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTVKNTVSQVVKRVLTTG  369

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGEL+PSRF EKDLLKVVDREYV+ Y DDPCS  YPLMQ LRQVLV+HAL NGE E+++
Sbjct  370  VNGELNPSRFCEKDLLKVVDREYVYTYIDDPCSATYPLMQTLRQVLVEHALTNGESEKNT  429

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK+ LPKE+E AR   ENG AAI N+I +CRS+PLYKFVR ELGTS
Sbjct  430  STSIFQKIAAFEEELKSFLPKEVESARIAYENGNAAISNKITECRSYPLYKFVREELGTS  489

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKV+TAMC+GKLIDP+L+CL  WNG PLPIC
Sbjct  490  LLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  534



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++V LCQA+DLRH+EENLK   KN VSQVAK+VLT+G
Sbjct  458  SLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKNTVKNTVSQVAKRVLTMG  517

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSR  EKDLLK+VD+E+VFAY DDPCS  YPLMQKLRQVLV+HAL NGE E +S
Sbjct  518  FNGELHPSRLCEKDLLKLVDKEHVFAYIDDPCSATYPLMQKLRQVLVEHALVNGERETNS  577

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI +FEEELK +LPKE+E AR E+ENG   +PNRI++CRS+PLYKFVR ELGTS
Sbjct  578  TTSIFQKIRSFEEELKTLLPKEVESARLEVENGNPVVPNRIKECRSYPLYKFVREELGTS  637

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGE+ DKVFTA+C GKL+DPLL+CLKEWNGAPLPIC
Sbjct  638  LLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLPIC  682



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY++ALCQA+DLRHLEE LK   KN V QVAK+VLT+G
Sbjct  335  SLGLISARKTAEAVDILKLMSSTYLIALCQAVDLRHLEEQLKNTVKNTVGQVAKRVLTLG  394

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NGELHPSRF EK+LL+VVDREYVFAY DDPCS  YPLMQKLRQV+V+HAL NGE ER++
Sbjct  395  SNGELHPSRFCEKELLQVVDREYVFAYIDDPCSATYPLMQKLRQVIVEHALKNGENERNA  454

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELK +LPKE+E AR E ENG  AIPN+I++ RS+PLYKFVR ELG  
Sbjct  455  STSIFQKIAAFEEELKTLLPKEVESARAEYENGNPAIPNKIKERRSYPLYKFVREELGAG  514

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEK RSPGEECDKVF+A+  GKLIDP+L+CLKEWNGAPLPI 
Sbjct  515  LLTGEKARSPGEECDKVFSAIYAGKLIDPMLECLKEWNGAPLPIS  559



>gb|ACR15762.1| phenylalanine ammonia-lyase [Litchi chinensis]
Length=723

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 1/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++V LCQAIDLRHLEENLK   KN VSQVAK VLTVG
Sbjct  500  SLGLISSRKTAEAVDILKLMSSTFLVGLCQAIDLRHLEENLKDTVKNTVSQVAK-VLTVG  558

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLV+HAL NGE E++ 
Sbjct  559  ANGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALFNGENEKNV  618

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KIGAFEEELKA+LPKE+E AR   ENG AAIPN+I++CRS+PLYKFVR ELG  
Sbjct  619  TSSIFQKIGAFEEELKAVLPKEVENARQVYENGNAAIPNKIEECRSYPLYKFVREELGAG  678

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEE DKVFTAMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  679  FLTGEKAVSPGEEFDKVFTAMCQGKIIDPLLECLGEWNGAPLPIC  723



>ref|XP_007143727.1| hypothetical protein PHAVU_007G096300g [Phaseolus vulgaris]
 gb|ESW15721.1| hypothetical protein PHAVU_007G096300g [Phaseolus vulgaris]
Length=715

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA++ILKLMS+TY+VALCQAIDLRHLEEN+K   KN V+QVAK+VLT+G
Sbjct  491  SLGLISSRKTAEAIEILKLMSSTYLVALCQAIDLRHLEENMKIVVKNVVNQVAKRVLTIG  550

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLK+VD EYVFAY DDPCS +YPLMQKLR +LVDHAL NG+ E +S
Sbjct  551  INGELHPSRFCEKELLKIVDHEYVFAYIDDPCSVSYPLMQKLRSILVDHALQNGDKEATS  610

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFEEEL  +LPKE+E  R E+ENG   IPNRI++CRS+PLYKFVR  LGT+
Sbjct  611  NTSIFQKISAFEEELITLLPKEVESVRIEVENGNPTIPNRIKECRSYPLYKFVRENLGTA  670

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDKVFTA+CEGK IDP+LDCLK+WNG+PLPIC
Sbjct  671  LLTGEKVMSPGEECDKVFTALCEGKFIDPMLDCLKKWNGSPLPIC  715



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   357 bits (917),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EALDILKLMS+TY++ALCQAIDLRHLEENLK   +N VSQVAK+ LT+G
Sbjct  11   SLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKQAVRNTVSQVAKRTLTMG  70

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL++VVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL NGE E++ 
Sbjct  71   ANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALQNGENEKNV  130

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKI +FEEELKA+LPKE E AR  LE+G  AI NRI +CRS+PLYKF+R ELG S
Sbjct  131  GTSIFHKIESFEEELKALLPKEDESARISLESGNPAIANRIAECRSYPLYKFIRGELGAS  190

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLP  231
             LTGEK  SPGEEC+KVFTA+ +G ++DPLL+CL+ WNGAPLP
Sbjct  191  FLTGEKATSPGEECEKVFTALSKGLIVDPLLECLQGWNGAPLP  233



>sp|P19142.1|PAL2_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 2; AltName: Full=Phenylalanine 
ammonia-lyase class II [Phaseolus vulgaris]
 prf||1807329A Phe ammonia lyase
Length=712

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EAL+ILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAK+ LT G
Sbjct  488  SLGLISSRKTNEALEILKLMSSTFLVALCQAIDLRHLEENLKNTVKNVVSQVAKRTLTTG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK LLKVV+REY FAY DDPCS  YPLMQKLRQVLVD+ALANGE E++ 
Sbjct  548  VNGELHPSRFCEKALLKVVEREYTFAYIDDPCSGTYPLMQKLRQVLVDYALANGENEKNL  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI +FEEELK +LPKE+EGAR   EN + AIPN+I+DCRS+PLYKFVR ELGTS
Sbjct  608  NTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCRSYPLYKFVREELGTS  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDKVF+AMC+GK+IDPLL+CL EWNGAPLPIC
Sbjct  668  LLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>gb|KHN09507.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=701

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQV+K++LT G
Sbjct  477  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSVKNTVSQVSKRILTTG  536

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY+F+Y DDPCS  YPLMQKLRQVLVDHAL N E E+  
Sbjct  537  VNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQVLVDHALVNAESEKDV  596

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI  FEEELK +LPKE+EGAR   E+GKAAIPN+IQ+CRS+PLYKFVR ELGT 
Sbjct  597  NSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECRSYPLYKFVREELGTG  656

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DK+FTAMC+GK+IDPL++CL EWNGAPLPI 
Sbjct  657  LLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPIS  701



>gb|AAY82486.1| phenylalanine ammonia-lyase [Ulmus pumila]
Length=622

 Score =   371 bits (952),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS T++VALCQAIDLRHLEENLK+  KN VSQVAKKVLT G
Sbjct  398  SLGLISSRKTEEAVEILKLMSTTFLVALCQAIDLRHLEENLKSTVKNTVSQVAKKVLTTG  457

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL NGE E + 
Sbjct  458  ANGELHPSRFCEKDLLKVVDREYVFSYIDDPCSSIYPLMQKLRQVLVDHALNNGEKETNP  517

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFEEELK +LPKE+E +R ELENG  AIP++I+ CRSFPLYKFVR EL T 
Sbjct  518  NTSIFQKIVAFEEELKTLLPKEVESSRVELENGNPAIPDKIKGCRSFPLYKFVREELRTG  577

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVF A+C GKLIDPLL+CLKEW+GAPLPIC
Sbjct  578  LLTGEKVKSPGEEFDKVFPAICAGKLIDPLLECLKEWDGAPLPIC  622



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQAIDLRHLEENLK+  KN VSQV+K+VLT G
Sbjct  491  SLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAVKNTVSQVSKRVLTTG  550

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDREYVFAY DDPCS  YPLMQKLRQV VDHAL NGE E++ 
Sbjct  551  ANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHALENGENEKNF  610

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KI AFEEELKA+LPKE+E AR   ++G +AI N+I++CRS+PLYKFVR ELGT 
Sbjct  611  STSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTV  670

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTAMC+GK+IDP+L+CL EWNG+PLPIC
Sbjct  671  LLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>ref|XP_010553331.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Tarenaya hassleriana]
Length=725

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAE+++ILKLMS T++VALCQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTAESVEILKLMSTTFLVALCQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VF YADDPCS  YPL+QKLRQ LVDHAL+NGE E++ 
Sbjct  561  INGELHPSRFCEKDLLKVVDREHVFTYADDPCSATYPLIQKLRQTLVDHALSNGENEKNV  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
             TSIFHKIGAFEEE+K +LPKE++  R   E G   IPNRI++CRS+PLY+FVR ELGT 
Sbjct  621  LTSIFHKIGAFEEEIKMVLPKEVDAVRAAYEKGTMTIPNRIKECRSYPLYRFVREELGTE  680

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC+GK+IDP+L+CL +WNGAP+PIC
Sbjct  681  LLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLNQWNGAPIPIC  725



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK+  KN VSQ+AK++LT G
Sbjct  500  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTVKNTVSQLAKRLLTTG  559

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL VV+REY+FAY DDPCS  YPLMQ+LRQVLV+HAL NGE E+++
Sbjct  560  VNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQVLVEHALTNGENEKNA  619

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFEEELK ILPKE+E AR   E+G AAIPNRI +CRS+PLYKFVR ELG  
Sbjct  620  NTSIFQKISAFEEELKTILPKEVESARAACESGNAAIPNRIIECRSYPLYKFVREELGGE  679

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEECDKVFTAMC+GK+IDP+LDCL  WNG PLPIC
Sbjct  680  FLTGEKVRSPGEECDKVFTAMCQGKIIDPILDCLSGWNGEPLPIC  724



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+V LCQAIDLRHLEENL+   KN VS VAK+VLT+G
Sbjct  490  SLGLISSRKTAEAVDILKLMSSTYLVGLCQAIDLRHLEENLRTTVKNTVSLVAKRVLTMG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAY DDPCS  YPLM+KLRQVLV+HAL N   E++ 
Sbjct  550  ANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMEKLRQVLVEHALKNEVSEKNV  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KIGAFEEELKA+LPKE+E  R  +E+G   I NRI+DCRS+PLYKFVR ELGT 
Sbjct  610  STSIFQKIGAFEEELKALLPKEVESTRALIESGNGGIANRIKDCRSYPLYKFVREELGTE  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMCEGK+IDPLLDCL  WNG+PLPIC
Sbjct  670  LLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLTSWNGSPLPIC  714



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQV+K++LT G
Sbjct  489  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSVKNTVSQVSKRILTTG  548

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY+F+Y DDPCS  YPLMQKLRQVLVDHAL N E E+  
Sbjct  549  VNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQVLVDHALVNAESEKDV  608

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI  FEEELK +LPKE+EGAR   E+GKAAIPN+IQ+CRS+PLYKFVR ELGT 
Sbjct  609  NSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECRSYPLYKFVREELGTG  668

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DK+FTAMC+GK+IDPL++CL EWNGAPLPI 
Sbjct  669  LLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPIS  713



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQAIDLRHLEENLK+  KN VSQV+K+VLT G
Sbjct  491  SLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAVKNTVSQVSKRVLTTG  550

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDREYVFAY DDPCS  YPLMQKLRQV VDHAL NGE E++ 
Sbjct  551  ANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQVFVDHALENGENEKNF  610

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KI AFEEELKA+LPKE+E AR   ++G +AI N+I++CRS+PLYKFVR ELGT 
Sbjct  611  STSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTV  670

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTAMC+GK+IDP+L+CL EWNG+PLPIC
Sbjct  671  LLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK+  KN VSQVAK+ LT G
Sbjct  495  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKSSAKNTVSQVAKRTLTTG  554

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPCS  YPLMQKLRQVLVDHAL NGE E++ 
Sbjct  555  VNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALVNGEYEKNL  614

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FE+ELKA+LPKE+E AR   E+G  AIPN+I++CRS+PLYKFVR ELGT 
Sbjct  615  NTSIFQKIATFEDELKALLPKEVESARAAYESGNPAIPNKIKECRSYPLYKFVREELGTG  674

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPG E DK+FTAMC GK+IDPLL+CL EWNGAPLPIC
Sbjct  675  LLTGEKVRSPGGEFDKLFTAMCRGKIIDPLLECLGEWNGAPLPIC  719



>gb|AAM28276.1| phenylalanine ammonia-lyase, partial [Ananas comosus]
Length=295

 Score =   359 bits (921),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA++ILKLM++TY+VALCQAIDLRHLEENLK+  KNAV Q AK+VLTVG
Sbjct  71   SLGLISARKTAEAVEILKLMTSTYLVALCQAIDLRHLEENLKSAVKNAVGQAAKRVLTVG  130

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
              GELHP+RF EKDL+KVVDR++VFAYADDPCS  YPLMQKLRQVLV+ AL NGE E+  
Sbjct  131  AGGELHPARFCEKDLIKVVDRDHVFAYADDPCSSTYPLMQKLRQVLVEQALGNGEKEKDP  190

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            + SIF KI AFEEELKA LPKE+E AR   ENG +AI NRIQ+CRS+PLY+FVR ELG  
Sbjct  191  NNSIFQKIAAFEEELKAQLPKEVEAARVAFENGTSAIANRIQECRSYPLYRFVREELGAG  250

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKVRSPGEE +KVF A+C+GK IDP+L+CLKEWNGAPLP+C
Sbjct  251  YLTGEKVRSPGEEFNKVFNAICKGKAIDPMLECLKEWNGAPLPLC  295



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EALDILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  58   SLGLISSRKTVEALDILKLMSSTYLVALCQAIDLRHLEENLKHAVKNTVSQVAKRTLTMG  117

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL++VVDREYVF+Y DDPC   YPLMQKLRQVLV+HAL NGE E+S 
Sbjct  118  ANGELHPSRFCEKDLIRVVDREYVFSYIDDPCLATYPLMQKLRQVLVEHALKNGEGEKSV  177

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIFHKI  FEEEL A+LPKE+E AR  LE+G  A+PNRI +CRS+PLYKF+R +LG  
Sbjct  178  STSIFHKIEQFEEELMALLPKEVESARIALESGSPAVPNRIAECRSYPLYKFIREDLGAG  237

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK  SPGEECD VFTA+  G ++DPLLDCLK WNG PLPIC
Sbjct  238  FLTGEKAVSPGEECDMVFTALSNGLIVDPLLDCLKAWNGQPLPIC  282



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL++  KN VSQVAK+ LT+G
Sbjct  497  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRSAVKNTVSQVAKRTLTMG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREYVFAYADDPCS  YPLMQKLRQVLVDHA+ NGE E++ 
Sbjct  557  ANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMKNGESEKNV  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA LPKE+E AR  +E+G  AIPNRI +CRS+PLY+ VR ELG+ 
Sbjct  617  NSSIFQKIVAFEDELKAALPKEVESARAVVESGNPAIPNRITECRSYPLYRLVRQELGSE  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC G++IDPLL+CLK WNGAPLPIC
Sbjct  677  LLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>ref|XP_011041026.1| PREDICTED: phenylalanine ammonia-lyase G2B-like isoform X1 [Populus 
euphratica]
Length=749

 Score =   374 bits (960),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKL+S T++V LCQA+DLRH+EENLK   KN V+QVAK+VLT+G
Sbjct  525  SLGLISSRKTAEAVDILKLVSTTFLVGLCQAVDLRHVEENLKNTVKNTVNQVAKRVLTMG  584

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             + ELHP RF EKDLLKVVDRE+VF+Y DDPCS  YPLMQKLRQVLV+HAL NGE ER+S
Sbjct  585  FSDELHPLRFYEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQVLVEHALVNGERERNS  644

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG+FEEELK +LPKE+E AR E+ENG  AIPNRI++CRS+PLYKFVR ELGT 
Sbjct  645  TTSIFQKIGSFEEELKTLLPKEVENARLEVENGNPAIPNRIKECRSYPLYKFVREELGTR  704

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTA+C GKLIDPLL+CLKEWNGAPLPIC
Sbjct  705  LLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC  749



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   373 bits (957),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LT+G
Sbjct  493  SLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTMG  552

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREY+FAYADD CS  YPLMQKLRQVLVDHAL NGE E++ 
Sbjct  553  ANGELHPARFCEKELLRVVDREYLFAYADDTCSSTYPLMQKLRQVLVDHALNNGESEKNV  612

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  LE+G  +IPNRI +CRS+PLY+ VR ELGT 
Sbjct  613  NSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECRSYPLYRLVRKELGTE  672

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+VRSPGEE DKVFTAMC G++IDPLL+CLK WNGAPLPIC
Sbjct  673  LLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   372 bits (956),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMSAT++VALCQAIDLRHLEENLK   KN VSQVAKKVLT  
Sbjct  484  SLGLISSRKTAEAIDILKLMSATFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTTS  543

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
            +NG LHPSRF EKDLLKVVDREY FAY DDPCS  YPLMQKLRQV+V+HAL NGE E+  
Sbjct  544  SNGTLHPSRFCEKDLLKVVDREYAFAYIDDPCSATYPLMQKLRQVIVEHALNNGEGEKDL  603

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KIG FEEELK +LPKE+E  R   ENG A I N+I++CRS+PLYKFVR ELGT 
Sbjct  604  ATSIFQKIGTFEEELKTVLPKEVESVRLAYENGDATIENQIKECRSYPLYKFVREELGTK  663

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEEC+KVFTA+C+GK+IDP+L+CLKEWNGAP+PIC
Sbjct  664  LLTGEKVISPGEECEKVFTALCQGKMIDPILECLKEWNGAPIPIC  708



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   373 bits (957),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKTAEA+DILKLMS+TY+VALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  498  SLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMG  557

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREYVFAYADDPCS  YPLMQKLRQVLVDHA+ NGE E++ 
Sbjct  558  ANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQVLVDHAMNNGESEKNV  617

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFE+ELKA+LPKE+E AR  LE+G  +IPNRI +CRS+PLYK VR ELG+ 
Sbjct  618  NSSIFQKIVAFEDELKAMLPKEVESARAVLESGNPSIPNRITECRSYPLYKLVRQELGSE  677

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC G++IDPLL+CL+ WNGAPLPIC
Sbjct  678  LLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLQSWNGAPLPIC  722



>ref|XP_010529727.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Tarenaya hassleriana]
Length=725

 Score =   373 bits (957),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 200/225 (89%), Gaps = 1/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA++ILKLMS T++VALCQA+DLRHLEENLK   KN VSQVAKKVLT G
Sbjct  501  SLGLISSRKTAEAMEILKLMSTTFLVALCQAVDLRHLEENLKQTVKNTVSQVAKKVLTTG  560

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK+VDRE+VF+YADDPC+  YPL+QKLR +LVDHAL+NGE E++S
Sbjct  561  INGELHPSRFCEKDLLKLVDREHVFSYADDPCNSTYPLIQKLRHILVDHALSNGENEQNS  620

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKA-AIPNRIQDCRSFPLYKFVRAELGT  363
            +TSIFHKIGAFEEELK +LPKE++  R   ENGK   IPNRI++CRS+PLY+F R ELGT
Sbjct  621  ATSIFHKIGAFEEELKRVLPKEVDAIRAAYENGKTMMIPNRIKECRSYPLYRFAREELGT  680

Query  362  SLLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
             LLTGEKVRSPGEE DKVFTA+CEGK+IDP+++CLKEWNGAP+PI
Sbjct  681  ELLTGEKVRSPGEEFDKVFTAICEGKIIDPMMECLKEWNGAPIPI  725



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   372 bits (956),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENL+   KN VSQVAK+ LT G
Sbjct  488  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAYADDPC   YPLMQKLRQVLVDHAL N E E++S
Sbjct  548  VNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQVLVDHALVNTEGEKNS  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FE+ELKAILPKE+E AR   ENG++ I N+I++CRS+PLYKFVR ELGT+
Sbjct  608  NTSIFQKIATFEDELKAILPKEVESARTAYENGQSGISNKIKECRSYPLYKFVREELGTA  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDK+FTAMC+GK++DPL++CL EWNGAPLPIC
Sbjct  668  LLTGEKVISPGEECDKLFTAMCQGKIVDPLMECLGEWNGAPLPIC  712



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   372 bits (956),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA++ILKLMS+TY+VALCQAIDLRHLEENLK   KN VSQVAK+ LTVG
Sbjct  492  SLGLISSRKTAEAVEILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTVG  551

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL++VVDREYVFAY DDPCS  YPLM+KLRQV+VDHAL NGE E++ 
Sbjct  552  VNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLMEKLRQVIVDHALQNGESEKNV  611

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFE+ELK +LPKE+E AR  LENG  AIPNRI++CRS+PLYKFVR ++G  
Sbjct  612  NTSIFQKIAAFEDELKTVLPKEVESARTALENGNPAIPNRIKECRSYPLYKFVREDVGAE  671

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEK RSPGEE DKVFTAMC  K+IDPLL+CLKEWNGAPLPIC
Sbjct  672  FLTGEKDRSPGEEFDKVFTAMCNEKIIDPLLECLKEWNGAPLPIC  716



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   372 bits (956),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 197/224 (88%), Gaps = 0/224 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQV+K++LT G
Sbjct  489  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSVKNTVSQVSKRILTTG  548

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREY+F+Y DDPCS  YPLMQKLRQVLVDHAL N E E+  
Sbjct  549  VNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQVLVDHALVNAECEKDV  608

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI  FEEELK +LPKE+EGAR   E+GKAAIPN+IQ+CRS+PLYKFVR ELGT 
Sbjct  609  NSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECRSYPLYKFVREELGTG  668

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPI  228
            LLTGEKVRSPGEE DK+FTAMC+GK+IDPL++CL EWNGAPLPI
Sbjct  669  LLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPI  712



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   372 bits (956),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQV+K++LT G
Sbjct  488  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSVKNTVSQVSKRILTTG  547

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVF+Y DDPCS  YPLMQKLRQVLVDHAL N E E+  
Sbjct  548  VNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQVLVDHALVNAENEKDM  607

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FEEELK  LPKE+E AR   E+GKAAIPN+IQ+CRS+PLYKFVR ELGT 
Sbjct  608  NTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECRSYPLYKFVREELGTG  667

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DK+FTAMC+GK+IDPLL+CL EWNGAPLPI 
Sbjct  668  LLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIS  712



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   372 bits (956),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS T++VALCQAIDLRHLEENLK+  KN VSQV+K+VLT G
Sbjct  490  SLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAVKNTVSQVSKRVLTTG  549

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EK+LLKVVDRE VFAYADDPCS  YPLMQKLRQV VDHAL NGE E++ 
Sbjct  550  ANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQVFVDHALENGENEKNF  609

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STS+F KI AFEEELKA+LPKE+E AR   ++G +AI N+I++CRS+PLYKFVR ELGT 
Sbjct  610  STSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECRSYPLYKFVREELGTV  669

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV+SPGEE DKVFTAMC+GK+IDP+L+CL EWNGAPLPIC
Sbjct  670  LLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   372 bits (954),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   K+ VSQVAKKVLT G
Sbjct  487  SLGLISSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNVVKSTVSQVAKKVLTTG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NG LHPSRF EKDLLKVVDREY FAY DD CS  YPLMQKLRQVLV+HAL NGE E+ +
Sbjct  547  VNGALHPSRFCEKDLLKVVDREYTFAYVDDACSATYPLMQKLRQVLVEHALENGEDEKDA  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKAILPKE+E AR   ENG + I N+I++CRS+PLYKFVR ELGT 
Sbjct  607  STSIFQKIRAFEEELKAILPKEVENARLSYENGTSTIENQIKECRSYPLYKFVREELGTG  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEEC+KVFTA+C+GK+IDP+L+CLKEWNGAP+PIC
Sbjct  667  LLTGEKVISPGEECEKVFTALCQGKMIDPILECLKEWNGAPIPIC  711



>gb|KDO50673.1| hypothetical protein CISIN_1g005031mg [Citrus sinensis]
Length=718

 Score =   372 bits (954),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAKKVLTVG
Sbjct  494  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             +GELHPSRF EKDLLK  DRE+VFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  554  ASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFEEELK +LPKE+E AR  +ENG   IPNRI++CRS+PLY+ VR ELG++
Sbjct  614  NSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRLVREELGSN  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV SPGEE DKVFTAMC+GK+IDP+L+CL+EWNGAPLPIC
Sbjct  674  FLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  718



>ref|XP_006428759.1| hypothetical protein CICLE_v10011175mg [Citrus clementina]
 ref|XP_006481494.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR41999.1| hypothetical protein CICLE_v10011175mg [Citrus clementina]
Length=718

 Score =   372 bits (954),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   KN VSQVAKKVLTVG
Sbjct  494  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVG  553

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             +GELHPSRF EKDLLK  DRE+VFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  554  ASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTA  613

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFEEELK +LPKE+E AR  +ENG   IPNRI++CRS+PLY+FVR  LG++
Sbjct  614  NSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSN  673

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV SPGEE DKVFTAMC+GK+IDP+L+CL+EWNGAPLPIC
Sbjct  674  FLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  718



>gb|AFI71896.1| phenylalanine ammonia-lyase [Paeonia lactiflora]
Length=706

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 199/226 (88%), Gaps = 1/226 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA+DILKLMS+T++VALCQAIDLRHLEEN++   KN VSQVAK+VLT+G
Sbjct  481  SLGLISSRKTEEAVDILKLMSSTFLVALCQAIDLRHLEENMRNTVKNTVSQVAKRVLTMG  540

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDREYVFAY DDPC   YPLMQKLRQVLV+HAL NGE E++S
Sbjct  541  ANGELHPSRFCEKDLLKVVDREYVFAYIDDPCLATYPLMQKLRQVLVEHALVNGEREKNS  600

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAA-IPNRIQDCRSFPLYKFVRAELGT  363
            STSIF KI AFEEEL  +LPKE++ AR E E+  A+ IPNRI++CRS+PLYKFVR ELG+
Sbjct  601  STSIFQKIAAFEEELMTLLPKEVDSARSEYESQSASLIPNRIKECRSYPLYKFVREELGS  660

Query  362  SLLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LLTG+K RSPGE+ DKVF+AMCEGKLIDP+LDCLKEWNGAPLPIC
Sbjct  661  GLLTGDKTRSPGEDFDKVFSAMCEGKLIDPMLDCLKEWNGAPLPIC  706



>gb|AFG26322.1| phenylalanine ammonia-lyase [Cinnamomum osmophloeum]
Length=708

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMSATY+V LCQAIDLRHLEENLK+  KN VSQVAK+VLT+G
Sbjct  484  SLGLISSRKTAEAVDILKLMSATYLVGLCQAIDLRHLEENLKSTVKNTVSQVAKRVLTIG  543

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDL+KVVDREY+FAY DDPCS  YPLMQKLRQVLV+HAL N E E+  
Sbjct  544  VNGELHPSRFCEKDLIKVVDREYLFAYIDDPCSSTYPLMQKLRQVLVEHALNNEEKEKDL  603

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI AFEEELK  LPKE+E AR E E+G  AI NRI++CRS+PLYKFVR EL TS
Sbjct  604  NTSIFQKIAAFEEELKTHLPKEVESARAEWESGNPAIANRIKECRSYPLYKFVREELKTS  663

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGE+VRSPGEE DKVF A+CEGK+IDP L+CL+EWNGAPLPIC
Sbjct  664  LLTGERVRSPGEEFDKVFAAICEGKVIDPFLECLREWNGAPLPIC  708



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EALDILKLMS+T+++ALCQAIDLRHLEENL+   KN VSQVAK+ LT+G
Sbjct  487  SLGLISSRKTVEALDILKLMSSTFLIALCQAIDLRHLEENLRLAVKNTVSQVAKRTLTMG  546

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLL+VVDREYVFAYADDPCSENYPLMQKLRQVLVDHAL NG+ E+++
Sbjct  547  VNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALNNGDKEKNA  606

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            STSIF KI AFEEELKA+LPKE+EGAR  +E GK  I NRI++CRS+PLYKF+R E+GT 
Sbjct  607  STSIFQKIQAFEEELKAVLPKEVEGARLAVEGGKEVIGNRIKECRSYPLYKFIREEVGTE  666

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV SPGEECDKVF A+  G ++DPL  CL+ WNGAPLPIC
Sbjct  667  FLTGEKVTSPGEECDKVFKALTNGLMVDPLFKCLEAWNGAPLPIC  711



>emb|CAB42793.1| phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata]
Length=721

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   K+ VSQVA+KVLTVG
Sbjct  497  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKDTVSQVARKVLTVG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK  DRE+VFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  557  ANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNA  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFEEELKA+LPKE+E AR  +ENG   IPNRI++CRS+PLY+ VR ELGT+
Sbjct  617  NSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVREELGTN  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV SPGE+ DKVFTAMC+GK+IDP+L+CL+EWNGAPLPIC
Sbjct  677  FLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKT EA++ILKLMS+T+++ALCQAIDLRHLEENLK   KN VSQVAK+ LT G
Sbjct  499  SLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSVKNIVSQVAKRTLTTG  558

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLKVVDRE+VFAY DDPCS  YPLMQKLRQVLVDHAL NGE E++ 
Sbjct  559  VNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQVLVDHALVNGENEKNL  618

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            +TSIF KI  FE+ELK +LPKE+E AR   E+G  AIPN+I  CRS+PLYKFVR ELGTS
Sbjct  619  NTSIFQKIATFEDELKTLLPKEVESARAAYESGNPAIPNKINGCRSYPLYKFVREELGTS  678

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKV SPGEECDK+FTAMC+GK+IDPLL+CL EWNGAPLP+C
Sbjct  679  LLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPVC  723



>ref|XP_006481493.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
Length=721

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLISSRKTAEA+DILKLMS+T++VALCQAIDLRHLEENLK   K+ VSQVA+KVLTVG
Sbjct  497  SLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKDTVSQVARKVLTVG  556

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHPSRF EKDLLK  DRE+VFAY DDPCS  YPLMQKLRQVLV+HAL NGE E+++
Sbjct  557  ANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNA  616

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KI AFEEELKA+LPKE+E AR  +ENG   IPNRI++CRS+PLY+ VR ELGT+
Sbjct  617  NSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECRSYPLYRLVREELGTN  676

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
             LTGEKV SPGE+ DKVFTAMC+GK+IDP+L+CL+EWNGAPLPIC
Sbjct  677  FLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  899  SLGLISSRKTAEALDILKLMSATYMVALCQAIDLRHLEENLKACTKNAVSQVAKKVLTVG  720
            SLGLIS+RKT EA+DILKLMS+TY+VALCQAIDLRHLEENLK+  KN VSQVAK+ LT+G
Sbjct  499  SLGLISARKTVEAVDILKLMSSTYLVALCQAIDLRHLEENLKSAVKNTVSQVAKRTLTMG  558

Query  719  NNGELHPSRFSEKDLLKVVDREYVFAYADDPCSENYPLMQKLRQVLVDHALANGEMERSS  540
             NGELHP+RF EK+LL+VVDREY+FAYADDPCS NYPLMQKLRQVLVD A+ NGE E++ 
Sbjct  559  ANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQVLVDQAMKNGESEKNV  618

Query  539  STSIFHKIGAFEEELKAILPKEIEGARCELENGKAAIPNRIQDCRSFPLYKFVRAELGTS  360
            ++SIF KIGAFE+EL A+LPKE+E  R  +E+G  +IPNRI +CRS+PLY+ VR ELGT 
Sbjct  619  NSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECRSYPLYRLVRQELGTE  678

Query  359  LLTGEKVRSPGEECDKVFTAMCEGKLIDPLLDCLKEWNGAPLPIC  225
            LLTGEKVRSPGEE DKVFTAMC G++IDPLL+CLK WNGAPLPIC
Sbjct  679  LLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2063602007762