BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12380

Length=862
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98623.1|  unnamed protein product                                373   9e-125   Coffea canephora [robusta coffee]
ref|XP_009598629.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    373   6e-124   Nicotiana tomentosiformis
ref|XP_006364388.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    372   8e-124   Solanum tuberosum [potatoes]
ref|NP_001234368.1|  D-cysteine desulfhydrase                           370   7e-123   Solanum lycopersicum
ref|XP_009761444.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    369   2e-122   Nicotiana sylvestris
ref|XP_010687041.1|  PREDICTED: putative D-cysteine desulfhydrase...    365   8e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006364399.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    372   2e-121   
ref|XP_006441358.1|  hypothetical protein CICLE_v100243011mg            358   4e-121   
ref|XP_007037066.1|  D-cysteine desulfhydrase isoform 1                 365   5e-121   
gb|KJB39189.1|  hypothetical protein B456_007G002100                    361   6e-121   Gossypium raimondii
gb|ABK95965.1|  unknown                                                 362   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011072033.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    363   4e-120   Sesamum indicum [beniseed]
ref|XP_002318328.2|  hypothetical protein POPTR_0012s03600g             363   7e-120   
gb|KJB39180.1|  hypothetical protein B456_007G002100                    360   6e-119   Gossypium raimondii
ref|XP_010932486.1|  PREDICTED: putative D-cysteine desulfhydrase...    355   1e-118   Elaeis guineensis
ref|XP_010276233.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    358   2e-118   Nelumbo nucifera [Indian lotus]
ref|XP_011000759.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    359   2e-118   Populus euphratica
ref|XP_006478104.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    357   7e-118   Citrus sinensis [apfelsine]
gb|ACN36628.1|  unknown                                                 352   9e-117   Zea mays [maize]
ref|XP_007209158.1|  hypothetical protein PRUPE_ppa006016mg             353   3e-116   Prunus persica
ref|XP_003631148.1|  D-cysteine desulfhydrase                           351   6e-116   Medicago truncatula
gb|ACL52405.1|  unknown                                                 351   8e-116   Zea mays [maize]
ref|XP_002527688.1|  1-aminocyclopropane-1-carboxylate deaminase,...    352   9e-116   Ricinus communis
gb|KCW57844.1|  hypothetical protein EUGRSUZ_H00596                     347   1e-115   Eucalyptus grandis [rose gum]
gb|EYU22265.1|  hypothetical protein MIMGU_mgv1a006748mg                351   2e-115   Erythranthe guttata [common monkey flower]
gb|AFK35260.1|  unknown                                                 350   2e-115   Medicago truncatula
ref|XP_010549032.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    349   2e-115   Tarenaya hassleriana [spider flower]
dbj|BAJ94783.1|  predicted protein                                      351   2e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT31928.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    350   3e-115   
ref|XP_008240383.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    350   4e-115   Prunus mume [ume]
gb|EMS48554.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    349   5e-115   Triticum urartu
gb|ACF86644.1|  unknown                                                 348   1e-114   Zea mays [maize]
ref|NP_001130254.1|  hypothetical protein                               348   1e-114   Zea mays [maize]
gb|ACF84959.1|  unknown                                                 347   1e-114   Zea mays [maize]
ref|XP_002454633.1|  hypothetical protein SORBIDRAFT_04g034640          347   2e-114   
ref|XP_004954079.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    347   5e-114   Setaria italica
ref|XP_008467141.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    348   8e-114   Cucumis melo [Oriental melon]
gb|KFK36096.1|  hypothetical protein AALP_AA4G076800                    345   1e-113   Arabis alpina [alpine rockcress]
ref|XP_003570540.1|  PREDICTED: putative D-cysteine desulfhydrase...    345   2e-113   Brachypodium distachyon [annual false brome]
ref|XP_010069481.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    346   3e-113   Eucalyptus grandis [rose gum]
ref|XP_004137385.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    346   5e-113   Cucumis sativus [cucumbers]
ref|XP_009341768.1|  PREDICTED: putative D-cysteine desulfhydrase...    340   2e-112   Pyrus x bretschneideri [bai li]
gb|AFK42354.1|  unknown                                                 339   2e-111   Lotus japonicus
ref|XP_010534203.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    339   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_010500366.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    339   4e-111   
ref|XP_010091758.1|  Putative 1-aminocyclopropane-1-carboxylate d...    338   6e-111   
ref|XP_006580387.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    335   1e-110   Glycine max [soybeans]
ref|XP_008393481.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    339   1e-110   Malus domestica [apple tree]
ref|XP_012072903.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    338   1e-110   Jatropha curcas
ref|XP_010461660.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    338   1e-110   
ref|XP_010479263.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    337   1e-110   
ref|XP_009349823.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    338   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_009341766.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    338   1e-110   
ref|XP_009341767.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    338   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_002894112.1|  D-cysteine desulfhydrase                           336   5e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_006647985.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    335   6e-110   
gb|EEC74091.1|  hypothetical protein OsI_09120                          335   7e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_004503246.1|  PREDICTED: putative 1-aminocyclopropane-1-ca...    335   1e-109   Cicer arietinum [garbanzo]
ref|NP_001048267.1|  Os02g0773300                                       335   1e-109   
emb|CDX93667.1|  BnaA06g03810D                                          334   2e-109   
ref|XP_003525175.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    333   5e-109   Glycine max [soybeans]
ref|NP_175275.3|  1-aminocyclopropane-1-carboxylate deaminase 1         333   5e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32737.1|  Unknown protein                                         333   7e-109   Arabidopsis thaliana [mouse-ear cress]
sp|Q6ZHE5.2|DCYD1_ORYSJ  RecName: Full=Putative D-cysteine desulf...    334   8e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006580386.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    332   9e-109   Glycine max [soybeans]
ref|XP_007160569.1|  hypothetical protein PHAVU_002G332800g             332   2e-108   Phaseolus vulgaris [French bean]
emb|CDY49670.1|  BnaC06g01990D                                          330   9e-108   Brassica napus [oilseed rape]
ref|XP_006849530.1|  PREDICTED: putative D-cysteine desulfhydrase...    329   1e-107   
ref|XP_009147970.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    329   4e-107   Brassica rapa
ref|XP_006306308.1|  hypothetical protein CARUB_v10012175mg             329   1e-106   
gb|AGK36098.1|  1-aminocyclopropane-1-carboxylate deaminase             327   2e-106   Vitis vinifera
ref|XP_010645769.1|  PREDICTED: putative D-cysteine desulfhydrase...    323   5e-106   
ref|XP_006393414.1|  hypothetical protein EUTSA_v10011539mg             326   6e-106   Eutrema salsugineum [saltwater cress]
ref|XP_009417666.1|  PREDICTED: putative D-cysteine desulfhydrase...    326   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF79717.1|AC020889_25  T1N15.3                                      324   3e-105   Arabidopsis thaliana [mouse-ear cress]
emb|CBI38261.3|  unnamed protein product                                322   1e-104   Vitis vinifera
ref|XP_002263358.2|  PREDICTED: putative D-cysteine desulfhydrase...    322   2e-104   Vitis vinifera
ref|XP_010276234.1|  PREDICTED: putative D-cysteine desulfhydrase...    320   1e-103   Nelumbo nucifera [Indian lotus]
gb|ABK24303.1|  unknown                                                 319   8e-103   Picea sitchensis
ref|XP_004299485.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    318   1e-102   Fragaria vesca subsp. vesca
gb|ABR17681.1|  unknown                                                 316   2e-101   Picea sitchensis
gb|KFK36095.1|  hypothetical protein AALP_AA4G076700                    311   1e-100   Arabis alpina [alpine rockcress]
gb|KDP23066.1|  hypothetical protein JCGZ_01161                         310   5e-100   Jatropha curcas
ref|XP_012089571.1|  PREDICTED: putative D-cysteine desulfhydrase...    310   6e-100   Jatropha curcas
ref|XP_007037068.1|  D-cysteine desulfhydrase isoform 3                 296   3e-94    
ref|XP_010091756.1|  Putative 1-aminocyclopropane-1-carboxylate d...    294   6e-94    Morus notabilis
ref|XP_001777657.1|  predicted protein                                  287   3e-91    
gb|EMT11299.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    286   2e-90    
ref|XP_006478105.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    273   1e-85    
gb|AFW73686.1|  hypothetical protein ZEAMMB73_104591                    271   8e-85    
gb|KHN00124.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    260   4e-83    Glycine soja [wild soybean]
ref|XP_002971172.1|  hypothetical protein SELMODRAFT_94611              265   5e-83    
ref|XP_002961916.1|  hypothetical protein SELMODRAFT_77084              264   2e-82    
gb|ABR26105.1|  1-aminocyclopropane-1-carboxylate deaminase             252   1e-80    Oryza sativa Indica Group [Indian rice]
gb|EPS62548.1|  d-cysteine desulfhydrase                                235   5e-74    Genlisea aurea
ref|XP_008671364.1|  PREDICTED: uncharacterized protein LOC103648725    234   9e-73    Zea mays [maize]
gb|KGN63956.1|  hypothetical protein Csa_1G031770                       239   6e-72    Cucumis sativus [cucumbers]
gb|KEH21438.1|  1-aminocyclopropane-1-carboxylate deaminase, puta...    234   2e-71    Medicago truncatula
gb|EMT14169.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    233   2e-70    
gb|AAN74942.1|  putative 1-aminocyclopropane-1-carboxylate deaminase    228   7e-70    Betula pendula [white birch]
gb|KIY95661.1|  hypothetical protein MNEG_12301                         202   8e-59    Monoraphidium neglectum
ref|XP_001700834.1|  hypothetical protein CHLREDRAFT_98369              196   4e-56    Chlamydomonas reinhardtii
ref|XP_007200136.1|  hypothetical protein PRUPE_ppa017238mg             188   1e-55    
ref|XP_005850727.1|  hypothetical protein CHLNCDRAFT_34235              193   6e-55    Chlorella variabilis
ref|XP_005649299.1|  pyridoxal phosphate-depend                         193   6e-55    Coccomyxa subellipsoidea C-169
ref|XP_002955139.1|  hypothetical protein VOLCADRAFT_65498              191   5e-54    Volvox carteri f. nagariensis
gb|KDO46413.1|  hypothetical protein CISIN_1g019410mg                   186   5e-53    Citrus sinensis [apfelsine]
gb|KDO46412.1|  hypothetical protein CISIN_1g019410mg                   186   8e-53    Citrus sinensis [apfelsine]
gb|KJB39183.1|  hypothetical protein B456_007G002100                    186   1e-52    Gossypium raimondii
gb|KDO46411.1|  hypothetical protein CISIN_1g019410mg                   186   3e-52    Citrus sinensis [apfelsine]
gb|KDO37019.1|  hypothetical protein CISIN_1g039995mg                   175   6e-51    Citrus sinensis [apfelsine]
gb|KHG12264.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    181   7e-51    Gossypium arboreum [tree cotton]
ref|XP_008898732.1|  hypothetical protein PPTG_06545                    182   7e-51    Phytophthora parasitica INRA-310
gb|ETO59840.1|  hypothetical protein F444_21871                         182   7e-51    Phytophthora parasitica P1976
gb|ETL78167.1|  hypothetical protein L917_20968                         182   7e-51    Phytophthora parasitica
ref|XP_009515993.1|  hypothetical protein PHYSODRAFT_309478             182   8e-51    Phytophthora sojae
ref|XP_002895266.1|  D-cysteine desulfhydrase, putative                 179   2e-50    Phytophthora infestans T30-4
ref|XP_009840456.1|  hypothetical protein H257_14374                    181   9e-50    Aphanomyces astaci
ref|XP_002906856.1|  D-cysteine desulfhydrase, putative                 179   1e-49    Phytophthora infestans T30-4
ref|XP_011409801.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    179   2e-49    
ref|XP_002109431.1|  hypothetical protein TRIADDRAFT_53453              179   3e-49    Trichoplax adhaerens
gb|KEH21437.1|  1-aminocyclopropane-1-carboxylate deaminase, puta...    176   3e-49    Medicago truncatula
ref|NP_001229618.1|  uncharacterized protein LOC578025                  175   4e-48    Strongylocentrotus purpuratus [purple urchin]
ref|XP_002121189.1|  PREDICTED: putative D-cysteine desulfhydrase...    175   8e-48    Ciona intestinalis [sea vase]
emb|CAN60273.1|  hypothetical protein VITISV_024840                     168   1e-46    Vitis vinifera
ref|XP_002591482.1|  hypothetical protein BRAFLDRAFT_105254             170   1e-46    Branchiostoma floridae
ref|XP_011424022.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    171   3e-46    
ref|XP_011424021.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    171   3e-46    
ref|XP_008789210.1|  PREDICTED: putative D-cysteine desulfhydrase...    162   3e-46    Phoenix dactylifera
ref|XP_011667662.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    165   3e-45    Strongylocentrotus purpuratus [purple urchin]
gb|KDO27924.1|  hypothetical protein SPRG_07198                         168   3e-45    Saprolegnia parasitica CBS 223.65
ref|XP_006823418.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    168   3e-45    Saccoglossus kowalevskii
ref|XP_002184089.1|  predicted protein                                  166   4e-45    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_011399663.1|  Putative 1-aminocyclopropane-1-carboxylate d...    167   7e-45    Auxenochlorella protothecoides
ref|XP_782004.3|  PREDICTED: putative D-cysteine desulfhydrase 1,...    166   1e-44    Strongylocentrotus purpuratus [purple urchin]
ref|XP_001637312.1|  predicted protein                                  166   2e-44    Nematostella vectensis
ref|XP_002505216.1|  predicted protein                                  165   2e-44    Micromonas commoda
gb|EKC20722.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    173   3e-44    Crassostrea gigas
ref|XP_008604210.1|  hypothetical protein SDRG_00508                    165   3e-44    Saprolegnia diclina VS20
ref|XP_787534.1|  PREDICTED: bifunctional D-cysteine desulfhydras...    164   6e-44    Strongylocentrotus purpuratus [purple urchin]
ref|XP_008877014.1|  hypothetical protein H310_11927                    164   2e-43    Aphanomyces invadans
ref|XP_004342345.1|  Dcysteine desulfhydrase                            165   6e-43    Acanthamoeba castellanii str. Neff
ref|XP_009053466.1|  hypothetical protein LOTGIDRAFT_175080             161   1e-42    Lottia gigantea
ref|XP_796433.2|  PREDICTED: bifunctional D-cysteine desulfhydras...    156   7e-41    Strongylocentrotus purpuratus [purple urchin]
gb|ELT93489.1|  hypothetical protein CAPTEDRAFT_123695                  154   4e-40    Capitella teleta
ref|XP_002288615.1|  predicted protein                                  154   7e-40    Thalassiosira pseudonana CCMP1335
gb|EJK45891.1|  hypothetical protein THAOC_35476                        154   8e-40    Thalassiosira oceanica
ref|XP_002735695.1|  PREDICTED: probable 1-aminocyclopropane-1-ca...    144   9e-37    Saccoglossus kowalevskii
ref|WP_011989078.1|  D-cysteine desulfhydrase                           143   2e-36    Clostridium kluyveri
ref|WP_017417108.1|  hypothetical protein                               141   9e-36    Clostridium tunisiense
ref|XP_001630447.1|  predicted protein                                  142   1e-35    Nematostella vectensis
ref|WP_005982040.1|  D-cysteine desulfhydrase                           140   2e-35    Fusobacterium ulcerans
ref|WP_029482059.1|  cysteine desulfhydrase                             140   4e-35    Clostridiales bacterium VE202-18
ref|WP_008792520.1|  D-cysteine desulfhydrase                           139   4e-35    Coprobacillus sp. 8_2_54BFAA
ref|XP_001630448.1|  predicted protein                                  140   4e-35    Nematostella vectensis
ref|WP_008697125.1|  D-cysteine desulfhydrase                           139   5e-35    Fusobacterium ulcerans
ref|WP_009300429.1|  MULTISPECIES: D-cysteine desulfhydrase             139   5e-35    Erysipelotrichaceae
ref|WP_005978024.1|  D-cysteine desulfhydrase                           139   6e-35    Fusobacterium ulcerans
ref|WP_003535429.1|  D-cysteine desulfhydrase                           139   8e-35    Erysipelatoclostridium ramosum
ref|WP_005950565.1|  D-cysteine desulfhydrase                           138   2e-34    Fusobacterium varium
ref|WP_013624170.1|  D-cysteine desulfhydrase                           137   3e-34    Syntrophobotulus glycolicus
ref|WP_023050567.1|  hypothetical protein                               136   1e-33    Cetobacterium somerae
ref|WP_008825528.1|  D-cysteine desulfhydrase                           135   1e-33    Haloplasma contractile
ref|WP_011971727.1|  D-cysteine desulfhydrase                           135   2e-33    Alkaliphilus metalliredigens
ref|WP_007087484.1|  D-cysteine desulfhydrase                           135   2e-33    Bacillus bataviensis
ref|WP_009298784.1|  D-cysteine desulfhydrase                           135   3e-33    Clostridium sp. 7_3_54FAA
ref|WP_003503279.1|  D-cysteine desulfhydrase [                         135   3e-33    Clostridiales
ref|WP_022425163.1|  d-cysteine desulfhydrase family pyridoxal ph...    134   7e-33    
ref|WP_021642770.1|  putative D-cysteine desulfhydrase [                133   1e-32    [Clostridium] symbiosum
gb|EKD31727.1|  Pyridoxal phosphate-dependent enzyme                    131   1e-32    uncultured bacterium
ref|XP_001748624.1|  hypothetical protein                               134   1e-32    Monosiga brevicollis MX1
ref|WP_007232100.1|  D-cysteine desulfhydrase                           133   2e-32    gamma proteobacterium HTCC2207
ref|XP_005783691.1|  hypothetical protein EMIHUDRAFT_418319             134   2e-32    Emiliania huxleyi CCMP1516
ref|WP_027623144.1|  cysteine desulfhydrase                             132   2e-32    Clostridium lundense
ref|XP_005787529.1|  hypothetical protein EMIHUDRAFT_429282             132   5e-32    Emiliania huxleyi CCMP1516
ref|WP_035134048.1|  cysteine desulfhydrase                             131   7e-32    Clostridium sulfidigenes
gb|ABD80923.1|  Pyridoxal phosphate-dependent deaminase                 131   8e-32    Saccharophagus degradans 2-40
ref|WP_041324464.1|  cysteine desulfhydrase                             131   8e-32    Saccharophagus degradans
ref|XP_003383708.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    131   1e-31    Amphimedon queenslandica
ref|WP_045432621.1|  hypothetical protein                               130   2e-31    
ref|WP_045670987.1|  cysteine desulfhydrase                             129   4e-31    Paenibacillus beijingensis
ref|WP_038051708.1|  cysteine desulfhydrase                             128   6e-31    Thermotoga sp. Mc24
ref|WP_012830343.1|  D-cysteine desulfhydrase                           128   7e-31    Haliangium ochraceum
ref|XP_001619528.1|  hypothetical protein NEMVEDRAFT_v1g42395           126   1e-30    Nematostella vectensis
ref|WP_020209703.1|  hypothetical protein                               127   1e-30    Gilvimarinus chinensis
ref|WP_041523161.1|  cysteine desulfhydrase                             127   1e-30    Gilvimarinus agarilyticus
ref|WP_040193666.1|  cysteine desulfhydrase                             127   2e-30    Clostridium sp. CL-6
ref|WP_021282477.1|  hypothetical protein                               127   2e-30    Clostridium sp. BL8
ref|WP_008193862.1|  MULTISPECIES: D-cysteine desulfhydrase             126   2e-30    Thermotoga
ref|WP_004082912.1|  MULTISPECIES: D-cysteine desulfhydrase             126   3e-30    Thermotoga maritima
ref|WP_036860353.1|  cysteine desulfhydrase                             127   3e-30    Porticoccus hydrocarbonoclasticus
ref|WP_005586944.1|  putative 1-aminocyclopropane-1-carboxylate d...    126   5e-30    
gb|KJB39184.1|  hypothetical protein B456_007G002100                    124   1e-29    Gossypium raimondii
ref|WP_038033348.1|  MULTISPECIES: cysteine desulfhydrase               124   2e-29    Thermotoga
ref|WP_019470022.1|  hypothetical protein                               124   3e-29    Staphylococcus cohnii
ref|WP_011943303.1|  MULTISPECIES: D-cysteine desulfhydrase             124   3e-29    Thermotoga
ref|WP_040029759.1|  cysteine desulfhydrase                             124   3e-29    Staphylococcus
ref|XP_007037067.1|  D-cysteine desulfhydrase isoform 2                 123   4e-29    
ref|WP_015595624.1|  D-cysteine desulfhydrase                           123   5e-29    Bacillus sp. 1NLA3E
ref|WP_041870641.1|  hypothetical protein                               122   1e-28    
ref|WP_028828759.1|  cysteine desulfhydrase                             122   1e-28    Proteocatella sphenisci
ref|WP_008695708.1|  D-cysteine desulfhydrase                           121   1e-28    
emb|CBY09114.1|  unnamed protein product                                119   2e-28    Oikopleura dioica
ref|WP_026573864.1|  cysteine desulfhydrase                             121   3e-28    
emb|CBY35070.1|  unnamed protein product                                120   7e-28    Oikopleura dioica
ref|WP_045518945.1|  cysteine desulfhydrase                             119   1e-27    Bacillus niacini
ref|WP_025641883.1|  cysteine desulfhydrase                             119   1e-27    [Clostridium] ultunense
ref|WP_042740341.1|  cysteine desulfhydrase                             119   1e-27    Staphylococcus
ref|XP_003383705.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    120   1e-27    Amphimedon queenslandica
gb|EPS62545.1|  hypothetical protein M569_12243                         117   2e-27    Genlisea aurea
ref|WP_035488452.1|  cysteine desulfhydrase                             119   2e-27    Gammaproteobacteria bacterium MOLA455
ref|WP_022545791.1|  hypothetical protein                               118   3e-27    Bacteroidales bacterium CF
ref|WP_035525771.1|  cysteine desulfhydrase                             117   7e-27    Haliea salexigens
ref|WP_016565713.1|  putative pyridoxal-phosphate-dependent enzyme      117   1e-26    
dbj|GAL63705.1|  pyridoxal phosphate-dependent deaminase putative       117   1e-26    Algibacter lectus
ref|WP_042505529.1|  cysteine desulfhydrase                             117   1e-26    
ref|WP_040802912.1|  cysteine desulfhydrase                             117   1e-26    
ref|WP_041083355.1|  cysteine desulfhydrase                             117   1e-26    Thermotoga profunda
ref|WP_017723753.1|  hypothetical protein                               117   1e-26    Staphylococcus xylosus
gb|EIF44157.1|  D-cysteine desulfhydrase                                117   1e-26    gamma proteobacterium BDW918
ref|WP_006929754.1|  Pyridoxal-5'-phosphate-dependent protein bet...    116   1e-26    Caldithrix abyssi
gb|EHQ57260.1|  1-aminocyclopropane-1-carboxylate deaminase             116   2e-26    gamma proteobacterium HIMB55
ref|WP_040801727.1|  cysteine desulfhydrase                             116   2e-26    
emb|CEF17799.1|  D-cysteine desulfhydrase                               115   2e-26    Staphylococcus xylosus
ref|WP_013362190.1|  D-cysteine desulfhydrase [                         115   4e-26    Acetoanaerobium sticklandii
ref|WP_037258113.1|  1-aminocyclopropane-1-carboxylate deaminase        115   4e-26    Kibdelosporangium aridum
ref|WP_041446158.1|  hypothetical protein                               115   4e-26    
gb|AER67420.1|  D-cysteine desulfhydrase                                115   4e-26    Thermovirga lienii DSM 17291
ref|WP_028398585.1|  cysteine desulfhydrase                             115   5e-26    Bacillus sp. FJAT-14578
ref|WP_002470882.1|  D-cysteine desulfhydrase                           114   6e-26    Staphylococcus pettenkoferi
ref|WP_029378211.1|  cysteine desulfhydrase                             114   7e-26    Staphylococcus xylosus
ref|WP_038679163.1|  cysteine desulfhydrase                             114   7e-26    Staphylococcus xylosus
ref|WP_012238709.1|  D-cysteine desulfhydrase                           114   8e-26    Sorangium cellulosum
ref|WP_007227684.1|  D-cysteine desulfhydrase                           114   1e-25    marine gamma proteobacterium HTCC2148
ref|WP_034264832.1|  hypothetical protein                               114   1e-25    
ref|WP_042362002.1|  cysteine desulfhydrase                             114   1e-25    Staphylococcus xylosus
ref|WP_041079351.1|  cysteine desulfhydrase                             114   1e-25    Staphylococcus saprophyticus
ref|WP_044244732.1|  cysteine desulfhydrase                             113   2e-25    Chondromyces apiculatus
ref|WP_039069285.1|  cysteine desulfhydrase                             113   2e-25    Staphylococcus xylosus
ref|WP_009019997.1|  D-cysteine desulfhydrase                           113   2e-25    Luminiphilus syltensis
ref|WP_005540296.1|  hypothetical protein                               113   2e-25    Johnsonella ignava
ref|WP_015046098.1|  D-cysteine desulfhydrase                           113   2e-25    Simiduia agarivorans
ref|WP_011302317.1|  D-cysteine desulfhydrase                           113   2e-25    Staphylococcus saprophyticus
ref|WP_002482297.1|  D-cysteine desulfhydrase                           113   3e-25    Staphylococcus saprophyticus
gb|EAW41951.1|  D-cysteine desulfhydrase                                113   3e-25    marine gamma proteobacterium HTCC2080
ref|WP_034600917.1|  cysteine desulfhydrase                             112   3e-25    
ref|WP_045859980.1|  cysteine desulfhydrase                             113   3e-25    Cellvibrionaceae bacterium Bs12
ref|WP_040811353.1|  cysteine desulfhydrase                             112   3e-25    
ref|WP_041076635.1|  cysteine desulfhydrase                             112   3e-25    Thermotoga caldifontis
ref|WP_020677022.1|  hypothetical protein                               112   4e-25    Geopsychrobacter electrodiphilus
ref|WP_010884169.1|  1-aminocyclopropane-1-carboxylate deaminase        112   4e-25    Pyrococcus horikoshii
ref|WP_019976074.1|  hypothetical protein                               112   5e-25    Empedobacter brevis
dbj|BAA29122.1|  328aa long hypothetical 1-aminocyclopropane-1-ca...    112   5e-25    Pyrococcus horikoshii OT3
ref|WP_045652067.1|  cysteine desulfhydrase                             112   5e-25    
ref|WP_043317968.1|  cysteine desulfhydrase                             111   9e-25    
ref|WP_040981109.1|  cysteine desulfhydrase                             111   1e-24    Oceanobacillus jeddahense
ref|WP_007716619.1|  cytochrome C biogenesis protein CcmE               110   1e-24    Brevibacillus sp. BC25
ref|WP_011575441.1|  cytochrome C biogenesis protein CcmE               110   2e-24    Pseudoalteromonas atlantica
ref|WP_036827742.1|  cytochrome C biogenesis protein CcmE               110   2e-24    Photobacterium sanctipauli
ref|WP_020739110.1|  hypothetical protein                               110   2e-24    Sorangium cellulosum
ref|WP_033391815.1|  1-aminocyclopropane-1-carboxylate deaminase        110   3e-24    
ref|WP_040629445.1|  cysteine desulfhydrase                             110   3e-24    
ref|WP_018276569.1|  D-cysteine desulfhydrase                           109   4e-24    Teredinibacter turnerae
ref|WP_022290456.1|  putative pyridoxal-phosphate-dependent enzyme      109   4e-24    
ref|WP_022957125.1|  D-cysteine desulfhydrase                           109   5e-24    Spongiibacter tropicus
ref|WP_023558156.1|  cytochrome C biogenesis protein CcmE               108   7e-24    Brevibacillus panacihumi
ref|WP_040986641.1|  MULTISPECIES: cytochrome C biogenesis protei...    108   9e-24    Vibrio renipiscarius
ref|WP_011011122.1|  1-aminocyclopropane-1-carboxylate deaminase        108   1e-23    Pyrococcus furiosus
ref|WP_038029883.1|  cysteine desulfhydrase                             108   1e-23    Thermonema rossianum
ref|WP_007956287.1|  cytochrome C biogenesis protein CcmE               108   1e-23    Pelosinus fermentans
ref|WP_042533966.1|  cysteine desulfhydrase                             108   1e-23    Oceanobacillus oncorhynchi
ref|WP_010867187.1|  1-aminocyclopropane-1-carboxylate deaminase        108   1e-23    Pyrococcus abyssi
ref|WP_015820700.1|  D-cysteine desulfhydrase                           108   1e-23    Teredinibacter turnerae
ref|WP_018016026.1|  D-cysteine desulfhydrase                           108   1e-23    Teredinibacter turnerae
ref|WP_039882519.1|  cysteine desulfhydrase                             107   2e-23    
ref|WP_019606438.1|  D-cysteine desulfhydrase                           108   2e-23    Teredinibacter turnerae
ref|WP_014731804.1|  D-cysteine desulfhydrase                           107   2e-23    
dbj|GAL80297.1|  pyridoxal phosphate-dependent deaminase                105   2e-23    Algibacter lectus
emb|CCU85070.1|  putative 1-aminocyclopropane-1-carboxylate deami...    107   2e-23    Mesotoga infera
gb|AAL80134.1|  1-aminocyclopropane-1-carboxylate deaminase             108   2e-23    
gb|EFQ24669.1|  pyridoxal phosphate-dependent enzymes, D-cysteine...    107   2e-23    
ref|WP_041844054.1|  cysteine desulfhydrase                             107   2e-23    
ref|WP_040346200.1|  hypothetical protein                               107   2e-23    
ref|WP_045825394.1|  cysteine desulfhydrase                             107   2e-23    
gb|ACM22637.1|  Putative 1-aminocyclopropane-1-carboxylate deaminase    107   2e-23    
ref|WP_028560590.1|  cysteine desulfhydrase                             107   2e-23    
ref|WP_041437482.1|  cysteine desulfhydrase                             107   2e-23    
ref|WP_028886870.1|  cysteine desulfhydrase                             107   2e-23    
ref|WP_028882366.1|  cysteine desulfhydrase                             107   3e-23    
ref|WP_017251284.1|  cytochrome C biogenesis protein CcmE               107   3e-23    
ref|WP_027872533.1|  cysteine desulfhydrase                             107   3e-23    
ref|WP_012633648.1|  D-cysteine desulfhydrase                           107   4e-23    
ref|WP_007083161.1|  D-cysteine desulfhydrase                           106   4e-23    
ref|WP_018415066.1|  D-cysteine desulfhydrase                           106   5e-23    
ref|WP_027294407.1|  hypothetical protein                               106   5e-23    
ref|WP_016742210.1|  cytochrome C biogenesis protein CcmE               106   5e-23    
ref|WP_040823088.1|  cysteine desulfhydrase                             106   6e-23    
ref|WP_033187050.1|  cytochrome C biogenesis protein CcmE               106   6e-23    
ref|WP_007989397.1|  D-cysteine desulfhydrase                           106   6e-23    
gb|EAW31256.1|  D-cysteine desulfhydrase                                106   6e-23    
ref|XP_002451911.1|  hypothetical protein SORBIDRAFT_04g009828          100   6e-23    
ref|WP_011368425.1|  cytochrome C biogenesis protein CcmE               106   6e-23    
ref|WP_028584555.1|  cytochrome C biogenesis protein CcmE               106   7e-23    
ref|WP_040552301.1|  cysteine desulfhydrase                             105   7e-23    
gb|EGY79963.1|  D-cysteine desulfhydrase                                105   8e-23    
ref|WP_031503284.1|  cysteine desulfhydrase                             105   8e-23    
ref|WP_029072112.1|  hypothetical protein                               105   9e-23    
ref|WP_013932067.1|  D-cysteine desulfhydrase                           105   1e-22    
dbj|GAC24673.1|  D-cysteine desulfhydrase                               105   1e-22    
ref|WP_039987278.1|  cytochrome C biogenesis protein CcmE               105   1e-22    
ref|WP_027181312.1|  cytochrome C biogenesis protein CcmE               105   1e-22    
ref|WP_012623983.1|  cytochrome C biogenesis protein CcmE               105   1e-22    
ref|WP_015892935.1|  cytochrome C biogenesis protein CcmE               105   1e-22    
ref|WP_013748049.1|  1-aminocyclopropane-1-carboxylate deaminase        105   1e-22    
ref|WP_008683417.1|  cytochrome C biogenesis protein CcmE               105   2e-22    
ref|WP_046017930.1|  cytochrome C biogenesis protein CcmE               105   2e-22    
gb|EEF94358.1|  D-cysteine desulfhydrase domain protein                 101   2e-22    
ref|WP_002511540.1|  MULTISPECIES: D-cysteine desulfhydrase             104   2e-22    
ref|WP_021338615.1|  D-cysteine desulfhydrase                           104   2e-22    
emb|CEL83228.1|  D-cysteine desulfhydrase                               104   2e-22    
ref|WP_004203467.1|  MULTISPECIES: D-cysteine desulfhydrase             104   2e-22    
ref|WP_044524005.1|  cysteine desulfhydrase                             104   2e-22    
ref|WP_013753424.1|  cytochrome C biogenesis protein CcmE               104   2e-22    
gb|EJX18501.1|  D-cysteine desulfhydrase                                104   2e-22    
ref|WP_037338342.1|  cytochrome C biogenesis protein CcmE               104   3e-22    
ref|WP_027858214.1|  cytochrome C biogenesis protein CcmE               103   3e-22    
ref|WP_004744649.1|  cytochrome C biogenesis protein CcmE               103   3e-22    
ref|WP_040369503.1|  cytochrome C biogenesis protein CcmE               103   4e-22    
ref|WP_017900235.1|  D-cysteine desulfhydrase                           103   4e-22    
gb|EEB33612.1|  D-cysteine desulfhydrase                                103   4e-22    
ref|WP_038312659.1|  pyridoxal-5'-phosphate-dependent protein           103   4e-22    
ref|WP_012002604.1|  MULTISPECIES: D-cysteine desulfhydrase             103   4e-22    
gb|ETA66565.1|  1-aminocyclopropane-1-carboxylate deaminase             103   5e-22    
ref|WP_015741679.1|  D-cysteine desulfhydrase                           103   5e-22    
ref|WP_009302740.1|  cytochrome C biogenesis protein CcmE               103   5e-22    
ref|WP_045819283.1|  cysteine desulfhydrase                             103   6e-22    
ref|WP_034899769.1|  cytochrome C biogenesis protein CcmE               103   6e-22    
dbj|GAC38670.1|  D-cysteine desulfhydrase                               103   7e-22    
ref|WP_040147861.1|  cysteine desulfhydrase                             103   7e-22    
ref|WP_027671208.1|  cytochrome C biogenesis protein CcmE               103   7e-22    
ref|WP_034275375.1|  1-aminocyclopropane-1-carboxylate deaminase        103   7e-22    
ref|WP_039207249.1|  cytochrome C biogenesis protein CcmE               103   7e-22    
ref|WP_007615732.1|  D-cysteine desulfhydrase                           103   7e-22    
ref|WP_028468189.1|  cytochrome C biogenesis protein CcmE               103   8e-22    
ref|WP_024983423.1|  cytochrome C biogenesis protein CcmE               102   8e-22    
gb|AGH45190.1|  D-cysteine desulfhydrase                                103   8e-22    
ref|WP_041250498.1|  cytochrome C biogenesis protein CcmE               102   8e-22    
ref|WP_023290282.1|  D-cysteine desulfhydrase                           102   9e-22    
ref|WP_022117247.1|  putative pyridoxal-phosphate-dependent enzyme      102   9e-22    
ref|WP_025849097.1|  cytochrome C biogenesis protein CcmE               102   9e-22    
ref|WP_018706755.1|  hypothetical protein                               102   1e-21    
ref|WP_042284003.1|  cysteine desulfhydrase                             102   1e-21    
ref|WP_043235036.1|  hypothetical protein                               102   1e-21    
emb|CDL64911.1|  D-cysteine desulfhydrase                               102   1e-21    
ref|WP_026858955.1|  cytochrome C biogenesis protein CcmE               102   1e-21    
ref|WP_028283591.1|  cysteine desulfhydrase                             102   1e-21    
ref|WP_032441803.1|  cysteine desulfhydrase                             102   1e-21    
ref|WP_039070664.1|  cytochrome C biogenesis protein CcmE               102   1e-21    
emb|CDL11852.1|  D-cysteine desulfhydrase                               102   1e-21    
ref|WP_042506667.1|  cysteine desulfhydrase                             102   2e-21    
ref|WP_025826656.1|  pyridoxal-5'-phosphate-dependent protein           102   2e-21    
ref|WP_031931914.1|  cytochrome C biogenesis protein CcmE               102   2e-21    
ref|WP_032435971.1|  cysteine desulfhydrase                             102   2e-21    
ref|WP_032453408.1|  cysteine desulfhydrase                             102   2e-21    
ref|WP_004184677.1|  D-cysteine desulfhydrase                           102   2e-21    
ref|WP_003389590.1|  D-cysteine desulfhydrase                           102   2e-21    
ref|WP_004141132.1|  MULTISPECIES: D-cysteine desulfhydrase             102   2e-21    
ref|WP_012097186.1|  D-cysteine desulfhydrase                           102   2e-21    
ref|WP_045444287.1|  cysteine desulfhydrase                             102   2e-21    
ref|WP_007769705.1|  D-cysteine desulfhydrase                           101   2e-21    
ref|WP_029496927.1|  cysteine desulfhydrase                             101   2e-21    
ref|WP_032411894.1|  cysteine desulfhydrase                             101   2e-21    
ref|WP_029031827.1|  cytochrome C biogenesis protein CcmE               101   2e-21    
ref|WP_004148884.1|  D-cysteine desulfhydrase                           101   2e-21    
ref|WP_043948678.1|  hypothetical protein                               101   2e-21    
ref|WP_021313403.1|  D-cysteine desulfhydrase                           101   2e-21    
ref|WP_045511251.1|  cysteine desulfhydrase                             101   2e-21    
ref|WP_040220308.1|  cysteine desulfhydrase                             101   2e-21    
ref|WP_044297453.1|  hypothetical protein                               101   2e-21    
ref|WP_038856855.1|  cysteine desulfhydrase                             101   2e-21    
ref|WP_041278495.1|  cytochrome C biogenesis protein CcmE               101   2e-21    
ref|WP_005832585.1|  D-cysteine desulfhydrase                           101   2e-21    
ref|WP_040151462.1|  cysteine desulfhydrase                             101   3e-21    
ref|WP_001128243.1|  D-cysteine desulfhydrase                           101   3e-21    
ref|WP_007794583.1|  D-cysteine desulfhydrase                           101   3e-21    
ref|WP_032982001.1|  cysteine desulfhydrase                             101   3e-21    
ref|WP_026558136.1|  cytochrome C biogenesis protein CcmE               101   3e-21    
ref|WP_042188515.1|  1-aminocyclopropane-1-carboxylate deaminase        101   3e-21    
ref|WP_021536484.1|  D-cysteine desulfhydrase                           101   3e-21    
emb|CAG36238.1|  probable 1-aminocyclopropane-1-carboxylate deami...    101   3e-21    
ref|WP_043953170.1|  cysteine desulfhydrase                             101   3e-21    
ref|WP_014733258.1|  1-aminocyclopropane-1-carboxylate deaminase        101   3e-21    
ref|WP_007784500.1|  cytochrome C biogenesis protein CcmE               101   3e-21    
ref|WP_039899346.1|  cysteine desulfhydrase                             101   3e-21    
ref|WP_007699163.1|  D-cysteine desulfhydrase                           101   3e-21    
ref|WP_038641541.1|  cysteine desulfhydrase                             101   3e-21    
ref|WP_034043678.1|  cysteine desulfhydrase                             101   3e-21    
ref|WP_029884083.1|  cysteine desulfhydrase                             101   3e-21    
ref|WP_023286647.1|  D-cysteine desulfhydrase                           101   3e-21    
ref|WP_007776058.1|  MULTISPECIES: D-cysteine desulfhydrase             101   3e-21    
ref|WP_023341900.1|  D-cysteine desulfhydrase                           101   3e-21    
ref|WP_042307711.1|  cysteine desulfhydrase                             100   4e-21    
ref|WP_029602086.1|  cysteine desulfhydrase                             100   4e-21    
ref|WP_008305792.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_014229876.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_032225571.1|  cysteine desulfhydrase                             100   4e-21    
ref|WP_009307523.1|  MULTISPECIES: D-cysteine desulfhydrase             100   4e-21    
gb|EPF16367.1|  D-cysteine desulfhydrase                                100   4e-21    
ref|WP_004180445.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_032448405.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_002911550.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_040075046.1|  cysteine desulfhydrase                             100   4e-21    
ref|WP_001128214.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_001128224.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_032414537.1|  cysteine desulfhydrase                             100   4e-21    
ref|WP_007732336.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_001128250.1|  D-cysteine desulfhydrase                           100   4e-21    
ref|WP_025711133.1|  cysteine desulfhydrase                             100   5e-21    
ref|WP_042003790.1|  D-cysteine desulfhydrase                           100   5e-21    
ref|WP_032240387.1|  D-cysteine desulfhydrase                           100   5e-21    
ref|WP_023283997.1|  D-cysteine desulfhydrase                           100   5e-21    
ref|WP_040190072.1|  cysteine desulfhydrase                             100   5e-21    
gb|ABU76566.1|  hypothetical protein ESA_01304                          100   5e-21    
ref|WP_007901773.1|  D-cysteine desulfhydrase                           100   5e-21    
ref|WP_004387976.1|  D-cysteine desulfhydrase                           100   5e-21    
ref|WP_025368104.1|  D-cysteine desulfhydrase                           100   5e-21    
ref|WP_016161403.1|  D-cysteine desulfhydrase                           100   5e-21    
ref|WP_031589258.1|  D-cysteine desulfhydrase                           100   6e-21    
ref|XP_011664993.1|  PREDICTED: bifunctional D-cysteine desulfhyd...    100   6e-21    
ref|WP_045360556.1|  cysteine desulfhydrase                             100   6e-21    
ref|WP_008804214.1|  MULTISPECIES: D-cysteine desulfhydrase             100   6e-21    
ref|WP_035530569.1|  cysteine desulfhydrase                             100   6e-21    
ref|WP_045215764.1|  cytochrome C biogenesis protein CcmE               100   6e-21    
dbj|GAN72007.1|  1-aminocyclopropane-1-carboxylate deaminase            100   6e-21    
ref|WP_024176155.1|  cysteine desulfhydrase                             100   6e-21    
ref|WP_028245853.1|  hypothetical protein                               100   7e-21    
ref|WP_003834032.1|  D-cysteine desulfhydrase                           100   7e-21    
ref|WP_007290494.1|  cytochrome C biogenesis protein CcmE               100   7e-21    
ref|WP_001549321.1|  D-cysteine desulfhydrase                           100   7e-21    
gb|KGZ31649.1|  cysteine desulfhydrase                                  100   7e-21    
ref|WP_032943823.1|  cysteine desulfhydrase                             100   7e-21    
ref|WP_012541230.1|  MULTISPECIES: D-cysteine desulfhydrase             100   8e-21    
ref|WP_032992795.1|  cysteine desulfhydrase                             100   8e-21    
ref|WP_032206899.1|  cysteine desulfhydrase                             100   8e-21    
ref|WP_008785096.1|  D-cysteine desulfhydrase                           100   8e-21    
gb|ESD77205.1|  D-cysteine desulfhydrase                                100   8e-21    
ref|WP_045171716.1|  cysteine desulfhydrase                             100   8e-21    
ref|WP_040089213.1|  D-cysteine desulfhydrase                           100   8e-21    
ref|WP_028019577.1|  cysteine desulfhydrase                           99.8    9e-21    
ref|WP_032612072.1|  cysteine desulfhydrase                           99.8    9e-21    
ref|WP_021561318.1|  D-cysteine desulfhydrase                         99.8    9e-21    
gb|ABV19426.1|  D-cysteine desulfhydrase                                100   9e-21    
ref|WP_021547002.1|  D-cysteine desulfhydrase                         99.8    1e-20    
gb|EGI21496.1|  D-cysteine desulfhydrase                              98.6    1e-20    
ref|WP_001639625.1|  D-cysteine desulfhydrase                         99.8    1e-20    
ref|WP_001128238.1|  D-cysteine desulfhydrase                         99.8    1e-20    
ref|WP_001128213.1|  MULTISPECIES: D-cysteine desulfhydrase           99.8    1e-20    
ref|WP_039072051.1|  cysteine desulfhydrase                           99.8    1e-20    
ref|WP_032303259.1|  cysteine desulfhydrase                           99.8    1e-20    
ref|WP_001128200.1|  D-cysteine desulfhydrase                         99.8    1e-20    
ref|WP_015851271.1|  cytochrome C biogenesis protein CcmE             99.8    1e-20    
ref|WP_001638043.1|  D-cysteine desulfhydrase                         99.8    1e-20    
ref|WP_042108414.1|  cysteine desulfhydrase                           99.0    1e-20    
ref|WP_001128210.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001568965.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001128246.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001128239.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_033544877.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001695857.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_015963962.1|  pyridoxal phosphate-dependent enzyme, D-cyst...  99.4    1e-20    
gb|ESD75013.1|  D-cysteine desulfhydrase                              99.8    1e-20    
ref|WP_032237561.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_032249276.1|  cysteine desulfhydrase                           99.4    1e-20    
ref|WP_044715203.1|  cysteine desulfhydrase                           99.0    1e-20    
gb|EFK46261.1|  D-cysteine desulfhydrase                              99.8    1e-20    
ref|WP_001128218.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_042318308.1|  cysteine desulfhydrase                           99.4    1e-20    
ref|WP_001128223.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_021570826.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001373912.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001568179.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001135583.1|  D-cysteine desulfhydrase                         99.4    1e-20    
ref|WP_001128249.1|  MULTISPECIES: D-cysteine desulfhydrase           99.4    2e-20    
ref|WP_001128220.1|  D-cysteine desulfhydrase                         99.4    2e-20    
gb|EHX61850.1|  D-cysteine desulfhydrase monomer                      99.0    2e-20    
ref|WP_045907347.1|  cysteine desulfhydrase                           99.0    2e-20    
ref|WP_001681146.1|  D-cysteine desulfhydrase                         99.0    2e-20    
ref|WP_001128231.1|  D-cysteine desulfhydrase                         99.0    2e-20    
emb|CCK47150.1|  putative 1-aminocyclopropane-1-carboxylate deami...  99.4    2e-20    
ref|WP_021550927.1|  D-cysteine desulfhydrase                         99.0    2e-20    
ref|WP_039059182.1|  D-cysteine desulfhydrase                         99.0    2e-20    
ref|WP_023566983.1|  D-cysteine desulfhydrase                         99.0    2e-20    
ref|WP_006684073.1|  D-cysteine desulfhydrase                         99.0    2e-20    
ref|WP_045354271.1|  cysteine desulfhydrase                           99.0    2e-20    
ref|WP_003291494.1|  cytochrome C biogenesis protein CcmE             99.0    2e-20    
ref|WP_042091634.1|  cysteine desulfhydrase                           99.0    2e-20    
ref|WP_024226220.1|  cysteine desulfhydrase                           99.0    2e-20    
ref|WP_001128204.1|  D-cysteine desulfhydrase                         99.0    2e-20    
ref|WP_039023114.1|  D-cysteine desulfhydrase                         99.0    2e-20    
ref|WP_040090843.1|  cysteine desulfhydrase                           99.0    2e-20    



>emb|CDO98623.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   373 bits (958),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 193/210 (92%), Gaps = 2/210 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAIREIE QLQ +  +  FDDIVVACGSGGT+AGL
Sbjct  178  LLREGRRPYVIPVGGSNSLGTWGYIEAIREIEHQLQHS--KSGFDDIVVACGSGGTVAGL  235

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            SIGSWLS LKAKVHA CVCDDPEYFY+YVQGLLDGL+AG+SSHDIV IQNAKGLGYAM+T
Sbjct  236  SIGSWLSNLKAKVHAFCVCDDPEYFYDYVQGLLDGLDAGVSSHDIVDIQNAKGLGYAMST  295

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKEIAETTGVILDPVYSGKAAY MMKDM ENP  WEGRKILFIHTGGLLGL+DK
Sbjct  296  SEELKFVKEIAETTGVILDPVYSGKAAYHMMKDMAENPAMWEGRKILFIHTGGLLGLYDK  355

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E++A LVG WR+MDIHESVPR++GTGKMF
Sbjct  356  VEQIAPLVGKWRQMDIHESVPRKEGTGKMF  385



>ref|XP_009598629.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Nicotiana tomentosiformis]
Length=426

 Score =   373 bits (957),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -3

Query  854  HEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
            +EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQLQ ++ E KFDDIVVACGSGGT+AGLSI
Sbjct  219  NEGRKPYVIPVGGSNSLGTWGYIEAIREVEQQLQHSSSEWKFDDIVVACGSGGTVAGLSI  278

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSE  495
             S LSGLKAKV+A CVCDDP+YFYEYVQGLLDG+NAG+SS DIVSIQNAKGLGYAM+T++
Sbjct  279  ASRLSGLKAKVNAFCVCDDPDYFYEYVQGLLDGINAGVSSRDIVSIQNAKGLGYAMSTAD  338

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSE  315
            ELKFVK++AE TGVILDPVYSGKAAYGM+KDM ENP KWEGRKILFIHTGGLLGL+DK++
Sbjct  339  ELKFVKQVAEATGVILDPVYSGKAAYGMIKDMNENPTKWEGRKILFIHTGGLLGLYDKAD  398

Query  314  EMASLVGNWRKMDIHESVPRRDGTGKMF  231
            EMASL+G WRKMDI+ES+PR+DG GKMF
Sbjct  399  EMASLMGKWRKMDINESIPRQDGIGKMF  426



>ref|XP_006364388.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006364389.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X2 [Solanum tuberosum]
Length=425

 Score =   372 bits (956),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL+EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQLQ  + EQKFDDIVVACGSGGT+AGL
Sbjct  216  LLNEGRKPYVIPVGGSNSLGTWGYIEAIRELEQQLQHLSIEQKFDDIVVACGSGGTVAGL  275

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            SI S LSGLKAK++A CVCDDP+YFYEYVQGLLDG+ AG+SS DIVSI+ AKGLGYAM+T
Sbjct  276  SIASMLSGLKAKINAFCVCDDPDYFYEYVQGLLDGITAGVSSRDIVSIETAKGLGYAMST  335

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            ++ELKFVK++AETTGVILDPVYSGKAAYGMMKDM+ENP KWEGRKILFIHTGGLLGL+DK
Sbjct  336  ADELKFVKQVAETTGVILDPVYSGKAAYGMMKDMSENPTKWEGRKILFIHTGGLLGLYDK  395

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++E+ SL+G WRKMDI+ES+PR+DG GKMF
Sbjct  396  ADEIGSLMGKWRKMDINESIPRQDGIGKMF  425



>ref|NP_001234368.1| D-cysteine desulfhydrase [Solanum lycopersicum]
 gb|ACC95419.1| D-cysteine desulfhydrase [Solanum lycopersicum]
Length=425

 Score =   370 bits (949),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL+EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQLQ  + EQKFDDIVVACGSGGT+AGL
Sbjct  216  LLNEGRKPYVIPVGGSNSLGTWGYIEAIRELEQQLQHLSIEQKFDDIVVACGSGGTVAGL  275

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            SI S LSGLKAK++A CVCDDP+YFYEYVQGLLDG+ AG+SS DIVSI+ AKGLGYA++T
Sbjct  276  SIASMLSGLKAKINAFCVCDDPDYFYEYVQGLLDGITAGVSSRDIVSIKTAKGLGYALST  335

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            ++ELKFVK++AETTGVILDPVYSGKAAYGMMKDM ENP KWEGRKILFIHTGGLLGL+DK
Sbjct  336  TDELKFVKQVAETTGVILDPVYSGKAAYGMMKDMGENPTKWEGRKILFIHTGGLLGLYDK  395

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++E+ SL+G WRKMDI+ES+PR+DG GKMF
Sbjct  396  ADEIGSLMGKWRKMDINESIPRQDGIGKMF  425



>ref|XP_009761444.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Nicotiana sylvestris]
Length=445

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -3

Query  854  HEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
            +EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQLQ ++ E KFDDIVVACGSGGT+AGLSI
Sbjct  238  NEGRKPYVIPVGGSNSLGTWGYIEAIREVEQQLQHSSSEWKFDDIVVACGSGGTVAGLSI  297

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSE  495
             S LSGLKAKV+A CVCDDP+YFYEYVQGLLDG+NAG+SS DIVSIQNAKGLGYAM+T++
Sbjct  298  ASRLSGLKAKVNAFCVCDDPDYFYEYVQGLLDGINAGVSSRDIVSIQNAKGLGYAMSTAD  357

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSE  315
            ELKFVK++AE TGVILDPVYSGKAAYGM+KDM ENP KWEGRKILFIHTGGLLGL+DK++
Sbjct  358  ELKFVKQVAEATGVILDPVYSGKAAYGMIKDMNENPTKWEGRKILFIHTGGLLGLYDKAD  417

Query  314  EMASLVGNWRKMDIHESVPRRDGTGKMF  231
            EMASL+G WRKMDI+ES PR++G GKMF
Sbjct  418  EMASLMGKWRKMDINESTPRQEGIGKMF  445



>ref|XP_010687041.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=379

 Score =   365 bits (938),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSN LGTWGYIEAIREIEQQL   A  ++FDDIVVACGSGGTIAGL
Sbjct  170  LISEGRKPYVIPVGGSNCLGTWGYIEAIREIEQQLHTVADSRRFDDIVVACGSGGTIAGL  229

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LKAKVHA  VCDDP+YFY+YVQGLLDGL AGISS DIV+IQNAKGLGYA+NT
Sbjct  230  SLGSWLSNLKAKVHAFSVCDDPDYFYDYVQGLLDGLKAGISSRDIVNIQNAKGLGYAINT  289

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             EEL FVK+IA  TGV+LDPVYSGKAA+G+MKDMTENPKKWEGR+ILFIHTGGLLGLFDK
Sbjct  290  QEELNFVKDIASATGVVLDPVYSGKAAFGLMKDMTENPKKWEGRRILFIHTGGLLGLFDK  349

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++E+  LVGNW++M +HESVPR+DG GKMF
Sbjct  350  ADELVKLVGNWKQMQLHESVPRQDGIGKMF  379



>ref|XP_006364399.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Solanum tuberosum]
Length=608

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL+EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQLQ  + EQKFDDIVVACGSGGT+AGL
Sbjct  399  LLNEGRKPYVIPVGGSNSLGTWGYIEAIRELEQQLQHLSIEQKFDDIVVACGSGGTVAGL  458

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            SI S LSGLKAK++A CVCDDP+YFYE+VQGLLDG+ AG+SS DIVSI+ AKGLGYAM+T
Sbjct  459  SIASMLSGLKAKINAFCVCDDPDYFYEHVQGLLDGITAGVSSRDIVSIETAKGLGYAMST  518

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            ++ELKFVK++AETTGVILDPVYSGKAAYGMMKDM ENP+KWEGRKILFIHTGGLLGL+DK
Sbjct  519  ADELKFVKQVAETTGVILDPVYSGKAAYGMMKDMGENPRKWEGRKILFIHTGGLLGLYDK  578

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++E+ SL+G WRKMDI+ES+PR+DG GKMF
Sbjct  579  ADEIGSLMGKWRKMDINESIPRQDGIGKMF  608



>ref|XP_006441358.1| hypothetical protein CICLE_v100243011mg, partial [Citrus clementina]
 gb|ESR54598.1| hypothetical protein CICLE_v100243011mg, partial [Citrus clementina]
Length=241

 Score =   358 bits (920),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNS+GTWGYIEAI+EIEQQLQ      KFDDIVVACGSGGTIAGL
Sbjct  32   LLKEGRRPYVIPVGGSNSIGTWGYIEAIKEIEQQLQTGTGGVKFDDIVVACGSGGTIAGL  91

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY+Y QGLLDGLNAG+ SHDIV+IQN+KGLGYA+NT
Sbjct  92   SLGSWLGTLKAKVHAFSVCDDPDYFYDYTQGLLDGLNAGVDSHDIVNIQNSKGLGYAINT  151

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVK+IA  TGV+LDPVYSGKAAYGM+ DM +NPKKWEGRK+LF+HTGGLLGLFDK
Sbjct  152  SEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDK  211

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MA  V NW +MD+HESVPR+DGTGKMF
Sbjct  212  VDQMAPRVKNWSRMDVHESVPRKDGTGKMF  241



>ref|XP_007037066.1| D-cysteine desulfhydrase isoform 1 [Theobroma cacao]
 gb|EOY21567.1| D-cysteine desulfhydrase isoform 1 [Theobroma cacao]
Length=425

 Score =   365 bits (937),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REIEQQLQ  +   KFDDIVVACGSGGTIAGL
Sbjct  216  LLKEGRRPYVIPVGGSNSLGTWGYIEAMREIEQQLQIRSNGVKFDDIVVACGSGGTIAGL  275

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA CVCDDP+YFY++VQGL+DGL AG+ S DIVSI NAKGLGYA+NT
Sbjct  276  SLGSWLGELKAKVHAFCVCDDPDYFYDFVQGLVDGLQAGVDSRDIVSIINAKGLGYAINT  335

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKEIA  TGV+LDPVYSGKAAYGMMKDM ENPK WEGRK+LFIHTGGLLGLFDK
Sbjct  336  SEELKFVKEIAAATGVVLDPVYSGKAAYGMMKDMAENPKNWEGRKVLFIHTGGLLGLFDK  395

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SLVGNW++MD++ES+PR+DG GKMF
Sbjct  396  VDQMSSLVGNWQRMDVNESIPRKDGIGKMF  425



>gb|KJB39189.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=315

 Score =   361 bits (926),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REIE+QLQ  +   KFDDIVVACGSGGTIAGL
Sbjct  106  LLKEGRRPYVIPVGGSNSLGTWGYIEAMREIEEQLQIRSNRVKFDDIVVACGSGGTIAGL  165

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA CVCDDP+YFY++VQ L+DGL AG+++ DIVSI NAKGLGYA+NT
Sbjct  166  SLGSWLGALKAKVHAFCVCDDPDYFYDFVQDLIDGLQAGVNARDIVSIINAKGLGYAINT  225

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKE+A  TGV+LDPVYSGKAAYGMMKDM ENP KWEGRK+LF+HTGGLLGLFDK
Sbjct  226  SEELKFVKEVAAATGVVLDPVYSGKAAYGMMKDMAENPNKWEGRKVLFVHTGGLLGLFDK  285

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MA LVGNW++MD++ES+PR++G GKMF
Sbjct  286  VDQMAPLVGNWQRMDVNESIPRKEGIGKMF  315



>gb|ABK95965.1| unknown [Populus trichocarpa]
Length=387

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q T    KFDDIVVACGSGGTIAGL
Sbjct  178  LVKEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQVQATTGRIKFDDIVVACGSGGTIAGL  237

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY +VQ L+DGL AG+ SHDIV+IQNAKGLGYA+NT
Sbjct  238  SLGSWLGTLKAKVHAFAVCDDPDYFYNFVQDLIDGLKAGVDSHDIVNIQNAKGLGYAINT  297

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKEIA TTGV+LDPVYSGKAAYGMMKDM ENPK WEGRK+LFIHTGGLLGLFDK
Sbjct  298  SEELKFVKEIATTTGVVLDPVYSGKAAYGMMKDMAENPKNWEGRKVLFIHTGGLLGLFDK  357

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SLV NW +M++ ESVPR+DG GKMF
Sbjct  358  VDQMSSLVENWGRMEVQESVPRKDGIGKMF  387



>ref|XP_011072033.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Sesamum indicum]
Length=435

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREI++QL+    +  FDDIV ACGSG T+AGL
Sbjct  226  LLSEGRKPYVIPVGGSNSLGTWGYIEAIREIKEQLEKGNGDLAFDDIVSACGSGATVAGL  285

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GSWLS L+AKVHA CVCDDP+YFYE+ QGLLDG+ AGI S DIV IQNAKGLGYA+NT
Sbjct  286  AVGSWLSDLRAKVHAYCVCDDPKYFYEFTQGLLDGIQAGIDSRDIVDIQNAKGLGYAINT  345

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL FVK+IA++TGV+LDPVYSGKAA+GMMKDM ENP KWEGRK+LFIHTGGLLGLFDK
Sbjct  346  AEELAFVKQIAQSTGVVLDPVYSGKAAFGMMKDMAENPAKWEGRKVLFIHTGGLLGLFDK  405

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +E+M+SLVGNWR+MDIHESVPR++GTGKMF
Sbjct  406  TEQMSSLVGNWRRMDIHESVPRKEGTGKMF  435



>ref|XP_002318328.2| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 ref|XP_006376696.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 ref|XP_006376697.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 gb|EEE96548.2| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 gb|ERP54493.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
 gb|ERP54494.1| hypothetical protein POPTR_0012s03600g [Populus trichocarpa]
Length=443

 Score =   363 bits (931),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q T    KFDDIVVACGSGGTIAGL
Sbjct  234  LVKEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQVQATTGRIKFDDIVVACGSGGTIAGL  293

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY +VQ L+DGL AG+ SHDIV+IQNAKGLGYA+NT
Sbjct  294  SLGSWLGTLKAKVHAFAVCDDPDYFYNFVQDLIDGLKAGVDSHDIVNIQNAKGLGYAINT  353

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKEIA TTGV+LDPVYSGKAAYGMMKDM ENPK WEGRK+LFIHTGGLLGLFDK
Sbjct  354  SEELKFVKEIATTTGVVLDPVYSGKAAYGMMKDMAENPKNWEGRKVLFIHTGGLLGLFDK  413

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SLV NW +M++ ESVPR+DG GKMF
Sbjct  414  VDQMSSLVENWGRMEVQESVPRKDGIGKMF  443



>gb|KJB39180.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=431

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REIE+QLQ  +   KFDDIVVACGSGGTIAGL
Sbjct  222  LLKEGRRPYVIPVGGSNSLGTWGYIEAMREIEEQLQIRSNRVKFDDIVVACGSGGTIAGL  281

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA CVCDDP+YFY++VQ L+DGL AG+++ DIVSI NAKGLGYA+NT
Sbjct  282  SLGSWLGALKAKVHAFCVCDDPDYFYDFVQDLIDGLQAGVNARDIVSIINAKGLGYAINT  341

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKE+A  TGV+LDPVYSGKAAYGMMKDM ENP KWEGRK+LF+HTGGLLGLFDK
Sbjct  342  SEELKFVKEVAAATGVVLDPVYSGKAAYGMMKDMAENPNKWEGRKVLFVHTGGLLGLFDK  401

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MA LVGNW++MD++ES+PR++G GKMF
Sbjct  402  VDQMAPLVGNWQRMDVNESIPRKEGIGKMF  431



>ref|XP_010932486.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Elaeis guineensis]
Length=315

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q  + E +FDDIVVACGSGGTIAGL
Sbjct  106  LLSEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQTGSGEIRFDDIVVACGSGGTIAGL  165

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKAKVHA  VCDDP YFY +VQGL+DGL+AGI SHDIV+IQ+AKGLGYAMNT
Sbjct  166  SLGSRLSNLKAKVHAFAVCDDPGYFYNFVQGLIDGLDAGIDSHDIVNIQDAKGLGYAMNT  225

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVK+IA+ TGV+LDPVYSGKAAYGM+KDM+ NP KW GRK+LFIHTGGLLGL+DK
Sbjct  226  SEELKFVKDIADATGVVLDPVYSGKAAYGMLKDMSANPAKWRGRKVLFIHTGGLLGLYDK  285

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MAS+VG W +M+I ES+ RRDGTGKMF
Sbjct  286  VDQMASMVGKWCRMEIDESIQRRDGTGKMF  315



>ref|XP_010276233.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial isoform X1 [Nelumbo 
nucifera]
Length=419

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REI+QQ+Q       FDDIVVACGSGGTIAGL
Sbjct  210  LLSEGRRPYVIPVGGSNSLGTWGYIEAVREIQQQIQRGPGIIGFDDIVVACGSGGTIAGL  269

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LKAKVHA  VCD P+YFY+YVQGLLDGL AG+SS +IVSIQ+AKGLGYAMNT
Sbjct  270  SLGSWLSDLKAKVHAFSVCDSPDYFYDYVQGLLDGLQAGVSSRNIVSIQDAKGLGYAMNT  329

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVKE+A  TGV+LDPVYSGKAAYG++KDM ENP KWEGRK+LF+HTGGLLGLFDK
Sbjct  330  TEELKFVKEVASATGVVLDPVYSGKAAYGLLKDMVENPTKWEGRKVLFVHTGGLLGLFDK  389

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MAS+VGNW ++DIHESVPR+DG GKMF
Sbjct  390  VEQMASMVGNWHQLDIHESVPRKDGIGKMF  419



>ref|XP_011000759.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Populus euphratica]
 ref|XP_011000760.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Populus euphratica]
 ref|XP_011000761.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Populus euphratica]
Length=442

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q T    KFDDIVVACGSGGTIAGL
Sbjct  233  LVKEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQVQATTGRIKFDDIVVACGSGGTIAGL  292

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY +VQ L+DGL AG+ SHDIV+I NAKGLGYA+NT
Sbjct  293  SLGSWLGTLKAKVHAFAVCDDPDYFYNFVQDLIDGLKAGVDSHDIVNIHNAKGLGYAINT  352

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKEIA  TGVILDPVYSGKAAYGMMKDM ENPK WEGRK+LFIHTGGLLGLFDK
Sbjct  353  SEELKFVKEIATATGVILDPVYSGKAAYGMMKDMAENPKNWEGRKVLFIHTGGLLGLFDK  412

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SLV NW +M++ ESVPR+DG GKMF
Sbjct  413  VDQMSSLVKNWGQMEVQESVPRKDGIGKMF  442



>ref|XP_006478104.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X1 [Citrus sinensis]
Length=428

 Score =   357 bits (917),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNS+GTWGYIEAI+EIEQQLQ      KFDDIVVACGSGGTIAGL
Sbjct  219  LLKEGRRPYVIPVGGSNSIGTWGYIEAIKEIEQQLQTGTGGVKFDDIVVACGSGGTIAGL  278

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY+Y QGLLDGLNAG+ S DIV+IQN+KGLGYA+NT
Sbjct  279  SLGSWLGTLKAKVHAFSVCDDPDYFYDYTQGLLDGLNAGVDSRDIVNIQNSKGLGYAINT  338

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVK+IA  TGV+LDPVYSGKAAYGM+ DM +NPKKWEGRK+LF+HTGGLLGLFDK
Sbjct  339  SEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDK  398

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MA L+ NW +MD+HESVPR+DGTGKMF
Sbjct  399  VDQMAPLLKNWSRMDVHESVPRKDGTGKMF  428



>gb|ACN36628.1| unknown [Zea mays]
Length=373

 Score =   352 bits (904),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 192/210 (91%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q +A + +FDDIVVACGSGGTIAGL
Sbjct  165  LLEEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQQSA-DVQFDDIVVACGSGGTIAGL  223

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L  KVHA  VCDDPEYFY+YVQGL+DGLN+G+ SHDIVSI+NAKGLGYAMNT
Sbjct  224  ALGSRLSSLNTKVHAFSVCDDPEYFYDYVQGLIDGLNSGLDSHDIVSIENAKGLGYAMNT  283

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA +TG+ILDPVYSGKA YG++KDM  NP KW+GRK+LFIHTGGLLGL+DK
Sbjct  284  AEELKFVKDIAASTGIILDPVYSGKAVYGLLKDMAGNPAKWKGRKVLFIHTGGLLGLYDK  343

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++SL G+WR+MD+ +SVPR+DGTGKMF
Sbjct  344  ADQLSSLAGSWRRMDLEDSVPRQDGTGKMF  373



>ref|XP_007209158.1| hypothetical protein PRUPE_ppa006016mg [Prunus persica]
 gb|EMJ10357.1| hypothetical protein PRUPE_ppa006016mg [Prunus persica]
Length=432

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAIREIE+QLQ    + KFDDIVVACGSGGTIAGL
Sbjct  223  LLKEGRRPYVIPVGGSNSLGTWGYIEAIREIEEQLQSGTDKVKFDDIVVACGSGGTIAGL  282

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
             +GSWLS LKAKV A  VCDDP+YFY+YVQGLLDGL AG+ S DIV++QNA+GLGYA+NT
Sbjct  283  GLGSWLSSLKAKVRAFSVCDDPDYFYDYVQGLLDGLEAGVDSRDIVNVQNARGLGYAINT  342

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFV EIA +TGV+LDPVYSGKAAYGM+KDM EN KKWEGRKILFIHTGGLLGLFDK
Sbjct  343  SEELKFVAEIAASTGVVLDPVYSGKAAYGMLKDMAENTKKWEGRKILFIHTGGLLGLFDK  402

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MA  +GNWR+MD+ ESVP  DG GKMF
Sbjct  403  VEQMAPSLGNWRRMDVQESVPPSDGIGKMF  432



>ref|XP_003631148.1| D-cysteine desulfhydrase [Medicago truncatula]
 gb|AET05624.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Medicago 
truncatula]
Length=388

 Score =   351 bits (900),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+++GR+PYVIPVGGSNSLGTWGY+EA+REIE Q+Q      KFDDIVVACGSGGTIAGL
Sbjct  179  LINQGRRPYVIPVGGSNSLGTWGYLEAVREIELQIQSGTSNVKFDDIVVACGSGGTIAGL  238

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS LKA+VHA  VCDDP+YF+ +VQGLLDGL AG+SS DIV IQNAKGLGYAMNT
Sbjct  239  ALGSSLSTLKARVHAFSVCDDPDYFHNFVQGLLDGLKAGVSSRDIVHIQNAKGLGYAMNT  298

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVKE+AE TGV+LDPVYSGKAAY M+KDM ENPKKWEGRKILF+HTGGLLGL+DK
Sbjct  299  SEELNFVKEVAEATGVVLDPVYSGKAAYAMLKDMNENPKKWEGRKILFVHTGGLLGLYDK  358

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +++ S VGNW++MD++ESVPR+DG GKMF
Sbjct  359  VDQLGSFVGNWQRMDVNESVPRQDGIGKMF  388



>gb|ACL52405.1| unknown [Zea mays]
Length=395

 Score =   351 bits (900),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 192/210 (91%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q +A + +FDDIVVACGSGGTIAGL
Sbjct  187  LLEEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQQSA-DVQFDDIVVACGSGGTIAGL  245

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L  KVHA  VCDDPEYFY+YVQGL+DGLN+G+ SHDIVSI+NAKGLGYAMNT
Sbjct  246  ALGSRLSSLNTKVHAFSVCDDPEYFYDYVQGLIDGLNSGLDSHDIVSIENAKGLGYAMNT  305

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA +TG+ILDPVYSGKA YG++KDM  NP KW+GRK+LFIHTGGLLGL+DK
Sbjct  306  AEELKFVKDIAASTGIILDPVYSGKAVYGLLKDMAGNPAKWKGRKVLFIHTGGLLGLYDK  365

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++SL G+WR+MD+ +SVPR+DGTGKMF
Sbjct  366  ADQLSSLAGSWRRMDLEDSVPRQDGTGKMF  395



>ref|XP_002527688.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Ricinus 
communis]
 gb|EEF34687.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Ricinus 
communis]
Length=427

 Score =   352 bits (902),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL +GRKPYVIPVGGSN +GTWGY+EAI+EIEQQ Q +  + KFDDIVVACGSGGTIAGL
Sbjct  218  LLKQGRKPYVIPVGGSNLIGTWGYVEAIKEIEQQCQASCGKLKFDDIVVACGSGGTIAGL  277

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY +VQGL+DGL AG+++HDIV+IQNAKG+GYAMNT
Sbjct  278  SLGSWLGTLKAKVHAFSVCDDPDYFYNFVQGLIDGLEAGVNTHDIVNIQNAKGIGYAMNT  337

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            S+EL+FVKE+A  TGV+LDPVYSGKAAY MMKDM ENPKKWEGRKILF+HTGGLLGL+DK
Sbjct  338  SDELQFVKEVATATGVVLDPVYSGKAAYAMMKDMAENPKKWEGRKILFVHTGGLLGLYDK  397

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SLV NW +MD+ ESVPR  GTGKMF
Sbjct  398  VDQMSSLVKNWSRMDVDESVPRNAGTGKMF  427



>gb|KCW57844.1| hypothetical protein EUGRSUZ_H00596 [Eucalyptus grandis]
Length=315

 Score =   347 bits (891),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYV+PVGGSNSLGTWGYIEAIREIEQQ+ +     KFDD+VVACGSGGTIAGL
Sbjct  106  LLKEGRKPYVVPVGGSNSLGTWGYIEAIREIEQQVHNAGGRIKFDDVVVACGSGGTIAGL  165

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS +K KVHA  VCD+P YFY++VQ LLDG+ AG+ S DIV I NAKGLGYAM+T
Sbjct  166  SLGSWLSTMKMKVHAFSVCDEPNYFYDFVQVLLDGIQAGVLSRDIVDIHNAKGLGYAMST  225

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL FVKE+A  TGV+LDPVYSGKAAYGMM+DM ENP KWEGR++LF+HTGGLLGLFDK
Sbjct  226  AEELNFVKEVATATGVVLDPVYSGKAAYGMMRDMAENPTKWEGRRVLFVHTGGLLGLFDK  285

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +EMAS VGNW++MD+ ESVPR++G GKMF
Sbjct  286  VDEMASTVGNWQRMDVDESVPRKEGVGKMF  315



>gb|EYU22265.1| hypothetical protein MIMGU_mgv1a006748mg [Erythranthe guttata]
Length=433

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEA+REI++QLQ    E  FDDIVVACGSGGTIAGL
Sbjct  224  LLSEGRKPYVIPVGGSNSLGTWGYIEAVREIQEQLQKNGGELAFDDIVVACGSGGTIAGL  283

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+ S LS L AKVHA CVCDDPEYFY+Y QGLLDGL A ++S DIV I+NAKGLGYAMNT
Sbjct  284  SVASSLSNLGAKVHAYCVCDDPEYFYDYAQGLLDGLQARVNSRDIVEIKNAKGLGYAMNT  343

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             EELKFV+EIAE+TG++LDPVYSGKA YGMMKDM  NP+KWEGRK+LF+HTGGLLGLF+K
Sbjct  344  EEELKFVREIAESTGIVLDPVYSGKAVYGMMKDMAANPEKWEGRKVLFVHTGGLLGLFEK  403

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +E++  L+G WR+MDIHESV R++GTGKMF
Sbjct  404  TEQIIPLLGKWRRMDIHESVTRKEGTGKMF  433



>gb|AFK35260.1| unknown [Medicago truncatula]
Length=388

 Score =   350 bits (897),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+++GR+PYVIPVGGSNSLGTWGY+EA+REIE Q+Q      KFDDIVVACGSGGTIAGL
Sbjct  179  LINQGRRPYVIPVGGSNSLGTWGYLEAVREIELQIQSGTSNVKFDDIVVACGSGGTIAGL  238

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS LKA+VHA  VCDDP++F+ +VQGLLDGL AG+SS DIV IQNAKGLGYAMNT
Sbjct  239  ALGSSLSTLKARVHAFSVCDDPDFFHNFVQGLLDGLKAGVSSRDIVHIQNAKGLGYAMNT  298

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVKE+AE TGV+LDPVYSGKAAY M+KDM ENPKKWEGRKILF+HTGGLLGL+DK
Sbjct  299  SEELNFVKEVAEATGVVLDPVYSGKAAYAMLKDMNENPKKWEGRKILFVHTGGLLGLYDK  358

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +++ S VGNW++MD++ESVPR+DG GKMF
Sbjct  359  VDQLGSFVGNWQRMDVNESVPRQDGIGKMF  388



>ref|XP_010549032.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Tarenaya hassleriana]
Length=374

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L +EGRKPYVIPVGGSNSLGTWGYIEA REIEQQLQ  +   KFDDI+VACGSGGT+AG+
Sbjct  165  LENEGRKPYVIPVGGSNSLGTWGYIEAAREIEQQLQSRSDGLKFDDIIVACGSGGTVAGI  224

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YF+++VQGLLDGL AG++SHD+VSI NAKGLGYAMNT
Sbjct  225  SLGSWLGPLKAKVHAFSVCDDPDYFHDFVQGLLDGLQAGVNSHDVVSIHNAKGLGYAMNT  284

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL++VKE+A  TGVILDPVYSGKAAYG+M++M ++PKKWEGRKILFIHTGGLLGL+DK
Sbjct  285  SEELQYVKEVANATGVILDPVYSGKAAYGLMQEMAKDPKKWEGRKILFIHTGGLLGLYDK  344

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MA LVG+W +MD+ ESVPR+DG GKMF
Sbjct  345  VDQMAPLVGSWGRMDVQESVPRKDGIGKMF  374



>dbj|BAJ94783.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEA+RE+EQQ+Q +  + +FDDIVVACGSGGTIAGL
Sbjct  214  LLEEGRKPYVIPVGGSNSLGTWGYIEAVRELEQQIQLSG-DVQFDDIVVACGSGGTIAGL  272

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS LKAKVHA  VCDDPEYFY+YVQGL+DGL +G+ SHDIVSIQNAKGLGYAMNT
Sbjct  273  ALGSKLSSLKAKVHAFSVCDDPEYFYDYVQGLIDGLQSGLDSHDIVSIQNAKGLGYAMNT  332

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA  TG++LDPVYSGK AY M+KDM  NP KW GRK+LF+HTGGLLGL+DK
Sbjct  333  AEELKFVKDIAAATGIVLDPVYSGKGAYAMLKDMAANPSKWNGRKVLFVHTGGLLGLYDK  392

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  393  VDQMSSLAGSWRRMDLEESVPRKDGTGKMF  422



>gb|EMT31928.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Aegilops 
tauschii]
Length=424

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEA+RE+EQQ+Q +  + +FDDIVVACGSGGTIAGL
Sbjct  216  LLEEGRKPYVIPVGGSNSLGTWGYIEAVRELEQQIQLSG-DVQFDDIVVACGSGGTIAGL  274

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS LKAKVHA  VCDDPEYFY+YVQGL+DGL +G+ SHDIVSIQNAKGLGYAMNT
Sbjct  275  ALGSKLSSLKAKVHAFSVCDDPEYFYDYVQGLIDGLQSGLDSHDIVSIQNAKGLGYAMNT  334

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA  TG++LDPVYSGK AY M+KDM +NP KW+GRK+LF+HTGGLLGL+DK
Sbjct  335  AEELKFVKDIATATGIVLDPVYSGKGAYAMLKDMADNPSKWKGRKVLFVHTGGLLGLYDK  394

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  395  VDQMSSLAGSWRRMDLEESVPRKDGTGKMF  424



>ref|XP_008240383.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
[Prunus mume]
Length=431

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGR+PYVIPVGGSNSLG WGYIEAIREIE+QLQ    + KFDDIVVACGSGGTIAGL
Sbjct  223  LIKEGRRPYVIPVGGSNSLGVWGYIEAIREIEEQLQSATDKVKFDDIVVACGSGGTIAGL  282

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GSWLS LKAKVHA  VCDDP+YFYEYVQGLLDGL AG+ S DIV+IQNA+GLGYA+NT
Sbjct  283  ALGSWLSSLKAKVHAFSVCDDPDYFYEYVQGLLDGLEAGVDSRDIVNIQNARGLGYAINT  342

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFV EIA TTG++LDPVYSGKAAYGM+KDM  N KKWEGRKILFIHTGGLLGLFDK
Sbjct  343  SEELKFVTEIAATTGIVLDPVYSGKAAYGMLKDMAGNTKKWEGRKILFIHTGGLLGLFDK  402

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MA  +GNWR+MD+ +SVP RD  GKMF
Sbjct  403  VEQMAPSLGNWRRMDVQDSVP-RDRIGKMF  431



>gb|EMS48554.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Triticum 
urartu]
Length=412

 Score =   349 bits (896),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 189/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEA+RE+EQQ+Q +  + +FDDIVVACGSGGTIAGL
Sbjct  204  LLEEGRKPYVIPVGGSNSLGTWGYIEAVRELEQQIQLSG-DVQFDDIVVACGSGGTIAGL  262

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L AKVHA  VCDDPEYFY+YVQGL+DGL +G+ SHDIVSIQNAKGLGYAMNT
Sbjct  263  ALGSKLSSLTAKVHAFSVCDDPEYFYDYVQGLIDGLQSGLDSHDIVSIQNAKGLGYAMNT  322

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA  TG++LDPVYSGK AY M+KDM +NP KW+GRK+LF+HTGGLLGL+DK
Sbjct  323  AEELKFVKDIATATGIVLDPVYSGKGAYAMLKDMADNPSKWKGRKVLFVHTGGLLGLYDK  382

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  383  VDQMSSLAGSWRRMDLEESVPRKDGTGKMF  412



>gb|ACF86644.1| unknown [Zea mays]
Length=395

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 191/210 (91%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q ++ + +FDDIVVACGSGGTIAGL
Sbjct  187  LLEEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQQSS-DVQFDDIVVACGSGGTIAGL  245

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L  KVHA  VCDDPEYFY+YVQGL+DGLN+G  SHDIVS++NAKGLGYAMNT
Sbjct  246  ALGSRLSSLNTKVHAFSVCDDPEYFYDYVQGLIDGLNSGFDSHDIVSMENAKGLGYAMNT  305

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA +TG++LDPVYSGKA YG++KDM  NP KW+GRK+LFIHTGGLLGL+DK
Sbjct  306  AEELKFVKDIAASTGIVLDPVYSGKAVYGLLKDMAGNPAKWKGRKVLFIHTGGLLGLYDK  365

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++SL G+WR+MD+ +SVPR+DGTGKMF
Sbjct  366  ADQLSSLAGSWRRMDLEDSVPRKDGTGKMF  395



>ref|NP_001130254.1| hypothetical protein [Zea mays]
 gb|ACF78422.1| unknown [Zea mays]
 gb|AFW73687.1| hypothetical protein ZEAMMB73_104591 [Zea mays]
Length=395

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 191/210 (91%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q ++ + +FDDIVVACGSGGTIAGL
Sbjct  187  LLEEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQQSS-DVQFDDIVVACGSGGTIAGL  245

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L  KVHA  VCDDPEYFY+YVQGL+DGLN+G  SHDIVS++NAKGLGYAMNT
Sbjct  246  ALGSRLSSLNTKVHAFSVCDDPEYFYDYVQGLIDGLNSGFDSHDIVSMENAKGLGYAMNT  305

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA +TG++LDPVYSGKA YG++KDM  NP KW+GRK+LFIHTGGLLGL+DK
Sbjct  306  AEELKFVKDIAASTGIVLDPVYSGKAVYGLLKDMAGNPAKWKGRKVLFIHTGGLLGLYDK  365

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++SL G+WR+MD+ +SVPR+DGTGKMF
Sbjct  366  ADQLSSLAGSWRRMDLEDSVPRKDGTGKMF  395



>gb|ACF84959.1| unknown [Zea mays]
 gb|AFW73685.1| hypothetical protein ZEAMMB73_104591 [Zea mays]
Length=390

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 191/210 (91%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q ++ + +FDDIVVACGSGGTIAGL
Sbjct  182  LLEEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQQSS-DVQFDDIVVACGSGGTIAGL  240

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L  KVHA  VCDDPEYFY+YVQGL+DGLN+G  SHDIVS++NAKGLGYAMNT
Sbjct  241  ALGSRLSSLNTKVHAFSVCDDPEYFYDYVQGLIDGLNSGFDSHDIVSMENAKGLGYAMNT  300

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA +TG++LDPVYSGKA YG++KDM  NP KW+GRK+LFIHTGGLLGL+DK
Sbjct  301  AEELKFVKDIAASTGIVLDPVYSGKAVYGLLKDMAGNPAKWKGRKVLFIHTGGLLGLYDK  360

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++SL G+WR+MD+ +SVPR+DGTGKMF
Sbjct  361  ADQLSSLAGSWRRMDLEDSVPRKDGTGKMF  390



>ref|XP_002454633.1| hypothetical protein SORBIDRAFT_04g034640 [Sorghum bicolor]
 gb|EES07609.1| hypothetical protein SORBIDRAFT_04g034640 [Sorghum bicolor]
Length=395

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q +A + +FDDIVVACGSGGTIAGL
Sbjct  187  LLEEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQQSA-DVQFDDIVVACGSGGTIAGL  245

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L  KVHA  VCDDPEYFY+Y QGL+DGL++G+ SHDIVSI+NAKGLGYAMNT
Sbjct  246  ALGSRLSSLNTKVHAFSVCDDPEYFYDYAQGLIDGLDSGLDSHDIVSIKNAKGLGYAMNT  305

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA  TG++LDPVYSGKA YG++KDM  NP KW+GR++LFIHTGGLLGL+DK
Sbjct  306  AEELKFVKDIAAATGIVLDPVYSGKAVYGLLKDMAANPTKWKGRRVLFIHTGGLLGLYDK  365

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++SL G+WR+MD+ +SVPR+DGTGKMF
Sbjct  366  ADQLSSLAGSWRRMDLEDSVPRKDGTGKMF  395



>ref|XP_004954079.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Setaria italica]
Length=423

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 192/210 (91%), Gaps = 1/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIE IREIEQQ+Q +A +  FDDIVVACGSGGTIAGL
Sbjct  215  LLEEGRKPYVIPVGGSNSLGTWGYIEVIREIEQQIQQSA-DAHFDDIVVACGSGGTIAGL  273

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS LKAKVHA  VCDDPEYFY+YVQGL+DGL +G++SHDIVSI+NAKGLGYAMNT
Sbjct  274  ALGSRLSSLKAKVHAFSVCDDPEYFYDYVQGLIDGLQSGLNSHDIVSIENAKGLGYAMNT  333

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVK+IA  TG++LDPVYSGKAAYG++KDM+ NP KW+GRKILF+HTGGLLGL+DK
Sbjct  334  AEELKFVKDIAAATGIVLDPVYSGKAAYGLLKDMSGNPAKWKGRKILFVHTGGLLGLYDK  393

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++SL G+WR+M++ +S+ R+DGTGKMF
Sbjct  394  ADQLSSLAGSWRRMNLEDSISRKDGTGKMF  423



>ref|XP_008467141.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
[Cucumis melo]
Length=456

 Score =   348 bits (892),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQL     + KFDDIVVACGSGGT+AGL
Sbjct  247  LVAEGRKPYVIPVGGSNSLGTWGYIEAIRELEQQLDSGNGKIKFDDIVVACGSGGTVAGL  306

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LK K+ A  VCDDP+YFYE+VQGLLDGL+AG+ S DIV IQNAKGLGYA+NT
Sbjct  307  SLGSWLSTLKTKIRAFSVCDDPDYFYEFVQGLLDGLHAGVDSRDIVEIQNAKGLGYAINT  366

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             +EL FVKE+AE+TGV+LDPVYSGKAAYGMMKDM ENPKKWEGRKILFIHTGGLLGL+DK
Sbjct  367  PDELNFVKEVAESTGVVLDPVYSGKAAYGMMKDMAENPKKWEGRKILFIHTGGLLGLYDK  426

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +++++S +G W ++D++ESVPR DG GKMF
Sbjct  427  ADQISSTLGKWHRLDVNESVPRIDGVGKMF  456



>gb|KFK36096.1| hypothetical protein AALP_AA4G076800 [Arabis alpina]
Length=382

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EGRKPYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+
Sbjct  173  LEKEGRKPYVIPVGGSNSLGTWGYIEAAREIEEQLKSRNDGLKFDDIVVACGSGGTIAGI  232

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY+YVQGLLDGL AG+++ DIV+I NAKG+GYAM+T
Sbjct  233  SLGSWLGALKAKVHAFSVCDDPDYFYDYVQGLLDGLQAGVNTRDIVNIHNAKGIGYAMST  292

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVK++A  TGV+LDPVYSGKA YG++ +MT++PK WEG+KILFIHTGGLLGL+DK
Sbjct  293  SEELKFVKDVANATGVVLDPVYSGKAVYGLINEMTKDPKNWEGKKILFIHTGGLLGLYDK  352

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MASL+GNWR+MD+ ESVPR+DG GKMF
Sbjct  353  VDQMASLIGNWRRMDVQESVPRKDGVGKMF  382



>ref|XP_003570540.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Brachypodium distachyon]
Length=419

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EGRKPYVIPVGGSNSLGTWGY+EAIREIEQQ+Q +  + +FDDI+VACGSGGTIAGL++G
Sbjct  214  EGRKPYVIPVGGSNSLGTWGYVEAIREIEQQIQLSG-DVQFDDIIVACGSGGTIAGLALG  272

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEE  492
            S LS LKAKVHA  VCDDPEYFY+YVQGL+DGL +G+ S DIVSI+NAKGLGYAMNT+EE
Sbjct  273  SKLSSLKAKVHAFSVCDDPEYFYDYVQGLIDGLQSGLDSRDIVSIENAKGLGYAMNTTEE  332

Query  491  LKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEE  312
            LKFVK+IA  TG++LDPVYSGK AYGM+KDM+ NP KW+GRK+LFIHTGGLLGL+DK ++
Sbjct  333  LKFVKDIAAATGIVLDPVYSGKGAYGMLKDMSSNPAKWKGRKVLFIHTGGLLGLYDKVDQ  392

Query  311  MASLVGNWRKMDIHESVPRRDGTGKMF  231
            M+SL G+WR+MD+ ES+PR+DGTGKMF
Sbjct  393  MSSLAGSWRRMDLQESLPRKDGTGKMF  419



>ref|XP_010069481.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Eucalyptus grandis]
 gb|KCW57843.1| hypothetical protein EUGRSUZ_H00596 [Eucalyptus grandis]
Length=445

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYV+PVGGSNSLGTWGYIEAIREIEQQ+ +     KFDD+VVACGSGGTIAGL
Sbjct  236  LLKEGRKPYVVPVGGSNSLGTWGYIEAIREIEQQVHNAGGRIKFDDVVVACGSGGTIAGL  295

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS +K KVHA  VCD+P YFY++VQ LLDG+ AG+ S DIV I NAKGLGYAM+T
Sbjct  296  SLGSWLSTMKMKVHAFSVCDEPNYFYDFVQVLLDGIQAGVLSRDIVDIHNAKGLGYAMST  355

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL FVKE+A  TGV+LDPVYSGKAAYGMM+DM ENP KWEGR++LF+HTGGLLGLFDK
Sbjct  356  AEELNFVKEVATATGVVLDPVYSGKAAYGMMRDMAENPTKWEGRRVLFVHTGGLLGLFDK  415

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +EMAS VGNW++MD+ ESVPR++G GKMF
Sbjct  416  VDEMASTVGNWQRMDVDESVPRKEGVGKMF  445



>ref|XP_004137385.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Cucumis sativus]
Length=454

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQL     + KFDDIVVACGSGGT+AGL
Sbjct  245  LVAEGRKPYVIPVGGSNSLGTWGYIEAIRELEQQLDSGNGKIKFDDIVVACGSGGTVAGL  304

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LK K+ A  VCDDP+YFYE+VQGLLDGL+AG+ S DIV IQNAKGLGYA+NT
Sbjct  305  SLGSWLSTLKTKIRAFSVCDDPDYFYEFVQGLLDGLHAGVDSRDIVEIQNAKGLGYAINT  364

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             +EL FVKE+AE+TGV+LDPVYSGKAAYGMMKDM ENPKKWEGRKILFIHTGGLLGL+DK
Sbjct  365  PDELNFVKEVAESTGVVLDPVYSGKAAYGMMKDMAENPKKWEGRKILFIHTGGLLGLYDK  424

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++++ S +G W ++D++E+VPR DG GKMF
Sbjct  425  ADQINSTLGKWHRLDVNETVPRIDGVGKMF  454



>ref|XP_009341768.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=315

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAI EIE+QLQ    + KFDDIVVACGSGGT+AGL
Sbjct  106  LLKEGRRPYVIPVGGSNSLGTWGYIEAIHEIEEQLQSGIDKVKFDDIVVACGSGGTVAGL  165

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+ SWLS LKAKV+A  VCDDP+YFY+YVQGLLDGL AG+ S +IV IQNAKGLGYA+NT
Sbjct  166  SLASWLSSLKAKVNAFSVCDDPDYFYDYVQGLLDGLEAGVDSRNIVDIQNAKGLGYAINT  225

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEE+ FVKEIA TTG++LDPVYSGKAAYGMMKDM ENPKKWEGRK+LFIHTGGLLGL+DK
Sbjct  226  SEEINFVKEIAATTGIVLDPVYSGKAAYGMMKDMAENPKKWEGRKVLFIHTGGLLGLYDK  285

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MA L+GNWR+MD++ESVPR DG GKMF
Sbjct  286  VEQMAPLLGNWRRMDVNESVPRIDGLGKMF  315



>gb|AFK42354.1| unknown [Lotus japonicus]
Length=381

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSNS+GTWGYIE++REIEQQ+Q      KFDDIVVACGSGGTIAGL
Sbjct  172  LIKEGRKPYVIPVGGSNSVGTWGYIESVREIEQQIQSGTSNVKFDDIVVACGSGGTIAGL  231

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKA+VHA  VCDDP+YF+++VQGLLDGL AG++S DIV IQNAKGLGYAMNT
Sbjct  232  SLGSSLSTLKARVHAFSVCDDPDYFHDFVQGLLDGLKAGVNSRDIVHIQNAKGLGYAMNT  291

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKE+AE TGV+LDPVYSGKAAY M+KDM ENPKKWEGRKILF HTGGLLGL+DK
Sbjct  292  SEELKFVKEVAEATGVVLDPVYSGKAAYAMLKDMNENPKKWEGRKILFKHTGGLLGLYDK  351

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +++AS VGNW+KMD++ES+PR+DGTGKMF
Sbjct  352  VDQLASFVGNWQKMDVNESIPRQDGTGKMF  381



>ref|XP_010534203.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Tarenaya 
hassleriana]
Length=399

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L +EGRKPYVIPVGGSN+LGTWGYIEA REIEQQLQ  +   KFDDI+VACGSGGT+AG+
Sbjct  191  LENEGRKPYVIPVGGSNTLGTWGYIEAAREIEQQLQSRSDGLKFDDIIVACGSGGTVAGI  250

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY++VQ LLD L AG+SSHDIV I NAKGLGYAMNT
Sbjct  251  SLGSWLGPLKAKVHAFSVCDDPDYFYDFVQDLLDELQAGVSSHDIVRIHNAKGLGYAMNT  310

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             EEL+ VKEIA  TGVILDPVYSGKAAYG+M++M ++P+KWEGRKILFIHTGGLLGL+DK
Sbjct  311  LEELQLVKEIANATGVILDPVYSGKAAYGLMQEMAKDPQKWEGRKILFIHTGGLLGLYDK  370

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKM  234
             ++MA  VGNW +MD+ ESVPR+DG GKM
Sbjct  371  VDQMAPFVGNWCRMDVQESVPRKDGIGKM  399



>ref|XP_010500366.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Camelina 
sativa]
Length=403

 Score =   339 bits (869),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  201  PYVIPVGGSNSLGTWGYIEAAREIEEQLKSRPDGLKFDDIVVACGSGGTIAGISLGSWLG  260

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL+AG++S DIV+I NAKG GYAMNTSEELKFV
Sbjct  261  ALKAKVHAFSVCDDPDYFYDFVQGLLDGLHAGVNSRDIVNIHNAKGKGYAMNTSEELKFV  320

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            KE+A +TGVILDPVYSGKA YG++ +MT+NPK WEGRKILFIHTGGLLGL+DK ++MASL
Sbjct  321  KEVASSTGVILDPVYSGKAVYGLINEMTKNPKNWEGRKILFIHTGGLLGLYDKVDQMASL  380

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR+DG GKMF
Sbjct  381  MGNWCRMDVSESVPRKDGVGKMF  403



>ref|XP_010091758.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
 gb|EXB45121.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
Length=381

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL+EGR+PYVIPVGGSNSLGTWGYIEAIRE+EQQ+Q    ++ FDDIVVACGSGGTIAGL
Sbjct  174  LLNEGRRPYVIPVGGSNSLGTWGYIEAIREVEQQVQTA--KENFDDIVVACGSGGTIAGL  231

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKAKVHA  VCDDP YFY++VQGLLDGL A +++HDIV IQNAKGLGYA+NT
Sbjct  232  SLGSSLSSLKAKVHAFSVCDDPNYFYDFVQGLLDGLEASVNAHDIVDIQNAKGLGYAINT  291

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVK+IA  TGVILDPVYSGKAA G++KDM ENPKKWEGRKILFIHTGGLLGL+DK
Sbjct  292  SEELKFVKDIAAATGVILDPVYSGKAASGLLKDMKENPKKWEGRKILFIHTGGLLGLYDK  351

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E++AS VGNW +MD+HESVPR+DGTGKMF
Sbjct  352  VEQLASSVGNWHRMDVHESVPRKDGTGKMF  381



>ref|XP_006580387.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
isoform X3 [Glycine max]
Length=315

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGR+PYVIPVGGSNSLGTWGYIEA+REIEQQ+Q      KFDDIVVACGSGGTIAGL
Sbjct  106  LIKEGRRPYVIPVGGSNSLGTWGYIEAVREIEQQIQKGTGNVKFDDIVVACGSGGTIAGL  165

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKA+VHA  VCDDP+YF+ + QGLLDGL AG+SS DIV IQNAKGLGYAMNT
Sbjct  166  SLGSSLSALKARVHAFSVCDDPDYFHNFAQGLLDGLKAGVSSRDIVHIQNAKGLGYAMNT  225

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVKE+A TTGV+LDPVYSGKAAY M+KDM+ENPKKWE RKILFIHTGGLLGL+DK
Sbjct  226  SEELNFVKEVAATTGVVLDPVYSGKAAYAMLKDMSENPKKWERRKILFIHTGGLLGLYDK  285

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +++AS VGNW++MD++ESVPR+DG GKMF
Sbjct  286  VDQLASFVGNWQRMDVNESVPRQDGIGKMF  315



>ref|XP_008393481.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
[Malus domestica]
Length=429

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAIREIE+QL+    + KFDDIVVACGSGG++AGL
Sbjct  220  LLKEGRRPYVIPVGGSNSLGTWGYIEAIREIEEQLRSGTDKVKFDDIVVACGSGGSVAGL  279

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+ SWLS LKAKV+A  VCDDP+YFY+YVQGLLDGL AG+ S +IV IQNAKGLGYA+NT
Sbjct  280  SLASWLSSLKAKVNAFSVCDDPDYFYDYVQGLLDGLEAGVDSRNIVDIQNAKGLGYAINT  339

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEE+ FVKEIA TTG++LDPVYSGKAAYGMMKDM ENPKKWEGR++LFIHTGGLLGL+DK
Sbjct  340  SEEINFVKEIAATTGIVLDPVYSGKAAYGMMKDMAENPKKWEGRRVLFIHTGGLLGLYDK  399

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MA L+GNWR+MD++ESVPR DG GKMF
Sbjct  400  VEQMAPLLGNWRRMDVNESVPRIDGLGKMF  429



>ref|XP_012072903.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Jatropha 
curcas]
 gb|KDP37415.1| hypothetical protein JCGZ_07942 [Jatropha curcas]
Length=425

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSN++GTWGYIEAI+EIEQQ+  +    KFDDIVVACGSGGTIAGL
Sbjct  216  LLKEGRKPYVIPVGGSNAIGTWGYIEAIKEIEQQVHASTGRLKFDDIVVACGSGGTIAGL  275

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL   KAKVHA  VCDDP+YFY +VQ L+DGL AG++SH+IV+IQNAK LGYAMNT
Sbjct  276  SLGSWLGTFKAKVHAFSVCDDPDYFYNFVQSLIDGLGAGVNSHEIVNIQNAKSLGYAMNT  335

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            S+ELKFV+E+A  TGV+LDPVYSGKAAYGMMKDM ENPKKWEGR+ILFIHTGG+LGL+DK
Sbjct  336  SDELKFVQEVATATGVVLDPVYSGKAAYGMMKDMAENPKKWEGRRILFIHTGGILGLYDK  395

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M+SLV +  +M + ESV R+DGTGKMF
Sbjct  396  VDQMSSLVEHCTRMHVDESVSRKDGTGKMF  425



>ref|XP_010461660.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Camelina 
sativa]
Length=404

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  202  PYVIPVGGSNSLGTWGYIEAAREIEEQLKSRPDGLKFDDIVVACGSGGTIAGISLGSWLG  261

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDG++AG++S DIV+I NAKG GYAMNTSEELKFV
Sbjct  262  ALKAKVHAFSVCDDPDYFYDFVQGLLDGIHAGVNSRDIVNIHNAKGKGYAMNTSEELKFV  321

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            KE+A +TGVILDPVYSGKA YG++ +MT+NPK WEGRKILFIHTGGLLGL+DK ++MASL
Sbjct  322  KEVASSTGVILDPVYSGKAVYGLINEMTKNPKNWEGRKILFIHTGGLLGLYDKVDQMASL  381

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR+DG GKMF
Sbjct  382  MGNWCRMDVSESVPRKDGVGKMF  404



>ref|XP_010479263.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Camelina sativa]
Length=383

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE QL+      KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  181  PYVIPVGGSNSLGTWGYIEAAREIEDQLKSRPDGLKFDDIVVACGSGGTIAGISLGSWLG  240

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL+AG++S DIV+I NAKG GYAMNTSEELKFV
Sbjct  241  ALKAKVHAFSVCDDPDYFYDFVQGLLDGLHAGVNSRDIVNIHNAKGKGYAMNTSEELKFV  300

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            KE+A +TGVILDPVYSGKA YG++ +MT+NPK WEGRKILFIHTGGLLGL+DK ++MASL
Sbjct  301  KEVASSTGVILDPVYSGKAVYGLVNEMTKNPKNWEGRKILFIHTGGLLGLYDKVDQMASL  360

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR+DG GKMF
Sbjct  361  MGNWCRMDVSESVPRKDGVGKMF  383



>ref|XP_009349823.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Pyrus x 
bretschneideri]
Length=429

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAI EIE+QLQ    + KFDDIVVACGSGGT+AGL
Sbjct  220  LLKEGRRPYVIPVGGSNSLGTWGYIEAIHEIEEQLQSGIDKVKFDDIVVACGSGGTVAGL  279

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+ SWLS LKAKV+A  VCDDP+YFY+YVQGLLDGL AG+ S +IV IQNAKGLGYA+NT
Sbjct  280  SLASWLSSLKAKVNAFSVCDDPDYFYDYVQGLLDGLEAGVDSRNIVDIQNAKGLGYAINT  339

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEE+ FVKEIA TTG++LDPVYSGKAAYGMMKDM ENPKKWEGRK+LFIHTGGLLGL+DK
Sbjct  340  SEEINFVKEIAATTGIVLDPVYSGKAAYGMMKDMAENPKKWEGRKVLFIHTGGLLGLYDK  399

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MA L+GNWR+MD++ESVPR DG GKMF
Sbjct  400  VEQMAPLLGNWRRMDVNESVPRIDGLGKMF  429



>ref|XP_009341766.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X1 [Pyrus x bretschneideri]
Length=429

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAI EIE+QLQ    + KFDDIVVACGSGGT+AGL
Sbjct  220  LLKEGRRPYVIPVGGSNSLGTWGYIEAIHEIEEQLQSGIDKVKFDDIVVACGSGGTVAGL  279

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+ SWLS LKAKV+A  VCDDP+YFY+YVQGLLDGL AG+ S +IV IQNAKGLGYA+NT
Sbjct  280  SLASWLSSLKAKVNAFSVCDDPDYFYDYVQGLLDGLEAGVDSRNIVDIQNAKGLGYAINT  339

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEE+ FVKEIA TTG++LDPVYSGKAAYGMMKDM ENPKKWEGRK+LFIHTGGLLGL+DK
Sbjct  340  SEEINFVKEIAATTGIVLDPVYSGKAAYGMMKDMAENPKKWEGRKVLFIHTGGLLGLYDK  399

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MA L+GNWR+MD++ESVPR DG GKMF
Sbjct  400  VEQMAPLLGNWRRMDVNESVPRIDGLGKMF  429



>ref|XP_009341767.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X2 [Pyrus x bretschneideri]
Length=429

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAI EIE+QLQ    + KFDDIVVACGSGGT+AGL
Sbjct  220  LLKEGRRPYVIPVGGSNSLGTWGYIEAIHEIEEQLQSGIDKVKFDDIVVACGSGGTVAGL  279

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+ SWLS LKAKV+A  VCDDP+YFY+YVQGLLDGL AG+ S +IV IQNAKGLGYA+NT
Sbjct  280  SLASWLSSLKAKVNAFSVCDDPDYFYDYVQGLLDGLEAGVDSRNIVDIQNAKGLGYAINT  339

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEE+ FVKEIA TTG++LDPVYSGKAAYGMMKDM ENPKKWEGRK+LFIHTGGLLGL+DK
Sbjct  340  SEEINFVKEIAATTGIVLDPVYSGKAAYGMMKDMAENPKKWEGRKVLFIHTGGLLGLYDK  399

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+MA L+GNWR+MD++ESVPR DG GKMF
Sbjct  400  VEQMAPLLGNWRRMDVNESVPRIDGLGKMF  429



>ref|XP_002894112.1| D-cysteine desulfhydrase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70371.1| D-cysteine desulfhydrase [Arabidopsis lyrata subsp. lyrata]
Length=402

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  200  PYVIPVGGSNSLGTWGYIEAAREIEEQLKSRPDSLKFDDIVVACGSGGTIAGISLGSWLG  259

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL AG++S DIVSI NAKG GYAMNTSEELKFV
Sbjct  260  ALKAKVHAFSVCDDPDYFYDFVQGLLDGLQAGVNSRDIVSIHNAKGKGYAMNTSEELKFV  319

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            KE+A +TGVILDPVYSGKA YG++ +++++PK WEGRKILFIHTGGLLGL+DK ++MASL
Sbjct  320  KEVASSTGVILDPVYSGKAVYGLINEISKDPKNWEGRKILFIHTGGLLGLYDKVDQMASL  379

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR+DG GKMF
Sbjct  380  MGNWCRMDVSESVPRKDGVGKMF  402



>ref|XP_006647985.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Oryza brachyantha]
Length=385

 Score =   335 bits (860),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EGRKPYVIPVGGSNSLGTWGYIEAI+EIE Q+Q +  + +FDDIVVACGSGGTIAGL++G
Sbjct  180  EGRKPYVIPVGGSNSLGTWGYIEAIQEIEHQIQISG-DVRFDDIVVACGSGGTIAGLALG  238

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEE  492
            S LS LKA VHA  VCDDPEYFY Y QGL+DGL++G+ S D+V+I+NAKGLGYAMNT+EE
Sbjct  239  SKLSSLKANVHAFSVCDDPEYFYAYAQGLIDGLHSGLVSRDLVNIENAKGLGYAMNTAEE  298

Query  491  LKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEE  312
            LKFVK+IA  TG++LDPVYSGKA YGM+KDM  NP KWEGRKILF+HTGGLLGL+DK +E
Sbjct  299  LKFVKDIAAATGIVLDPVYSGKAVYGMLKDMAANPAKWEGRKILFVHTGGLLGLYDKVDE  358

Query  311  MASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  359  LSSLSGSWRRMDLEESVPRKDGTGKMF  385



>gb|EEC74091.1| hypothetical protein OsI_09120 [Oryza sativa Indica Group]
Length=385

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EGRKPYVIPVGGSNSLGTWGYIEAIREIE Q+Q +  + +FDDIVVACGSGGTIAGL++G
Sbjct  180  EGRKPYVIPVGGSNSLGTWGYIEAIREIEHQIQISG-DVQFDDIVVACGSGGTIAGLALG  238

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEE  492
            S LS LKAKVHA  VCDDP YF+ YVQ L+DGL++ + SHD+V+I+NAKGLGYAMNT+EE
Sbjct  239  SKLSSLKAKVHAFSVCDDPGYFHSYVQDLIDGLHSDLRSHDLVNIENAKGLGYAMNTAEE  298

Query  491  LKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEE  312
            LKFVK+IA  TG++LDPVYSGKAAYGM+KDM  NP KWEGRKILF+HTGGLLGL+DK +E
Sbjct  299  LKFVKDIATATGIVLDPVYSGKAAYGMLKDMGANPAKWEGRKILFVHTGGLLGLYDKVDE  358

Query  311  MASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  359  LSSLSGSWRRMDLEESVPRKDGTGKMF  385



>ref|XP_004503246.1| PREDICTED: putative 1-aminocyclopropane-1-carboxylate deaminase-like 
[Cicer arietinum]
Length=407

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+++GR PYVIPVGGSNSLGTWGYIEA+REIE Q+Q      KFDDIVVACGSGGTIAGL
Sbjct  198  LINQGRNPYVIPVGGSNSLGTWGYIEAVREIEMQIQSGTSNVKFDDIVVACGSGGTIAGL  257

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKA+VHA  VCDDP+YF+++VQGL+DGL AG++S DIV IQNAKGLGYAMNT
Sbjct  258  SLGSSLSTLKARVHAFSVCDDPDYFHDFVQGLIDGLKAGVNSRDIVHIQNAKGLGYAMNT  317

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVKE+AE TGV+LDPVYSGKAAY M+KDM ENPKKWEGRKILFIHTGGLLGL+DK
Sbjct  318  SEELSFVKEVAEATGVVLDPVYSGKAAYAMLKDMNENPKKWEGRKILFIHTGGLLGLYDK  377

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +++AS VGNW++MD++ESVPR+DG GKMF
Sbjct  378  VDQLASFVGNWQRMDVNESVPRQDGIGKMF  407



>ref|NP_001048267.1| Os02g0773300 [Oryza sativa Japonica Group]
 dbj|BAD16875.1| putative 1-aminocyclopropane-1-carboxylate deaminase [Oryza sativa 
Japonica Group]
 dbj|BAF10181.1| Os02g0773300 [Oryza sativa Japonica Group]
 gb|EEE57887.1| hypothetical protein OsJ_08555 [Oryza sativa Japonica Group]
Length=385

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EGRKPYVIPVGGSNSLGTWGYIEAIREIE Q+Q +  + +FDDIVVACGSGGTIAGL++G
Sbjct  180  EGRKPYVIPVGGSNSLGTWGYIEAIREIEHQIQISG-DVQFDDIVVACGSGGTIAGLALG  238

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEE  492
            S LS LKAKVHA  VCDDP YF+ YVQ L+DGL++ + SHD+V+I+NAKGLGYAMNT+EE
Sbjct  239  SKLSSLKAKVHAFSVCDDPGYFHSYVQDLIDGLHSDLRSHDLVNIENAKGLGYAMNTAEE  298

Query  491  LKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEE  312
            LKFVK+IA  TG++LDPVYSGKAAYGM+KDM  NP KWEGRKILF+HTGGLLGL+DK +E
Sbjct  299  LKFVKDIATATGIVLDPVYSGKAAYGMLKDMGANPAKWEGRKILFVHTGGLLGLYDKVDE  358

Query  311  MASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  359  LSSLSGSWRRMDLEESVPRKDGTGKMF  385



>emb|CDX93667.1| BnaA06g03810D [Brassica napus]
Length=381

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G+KPYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+
Sbjct  172  LEKQGKKPYVIPVGGSNSLGTWGYIEAAREIEEQLKCRTDGLKFDDIVVACGSGGTIAGI  231

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  VCDDP+YFY++VQGLLDGL AG+++ DIVSI NAKG GYAMNT
Sbjct  232  SLGSWLGDLKAKVHAFSVCDDPDYFYDFVQGLLDGLEAGVNARDIVSIHNAKGKGYAMNT  291

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKF+K++A  T VILDPVYSGKAAYG++ +MT++PK WEG+KILFIHTGGLLGL+DK
Sbjct  292  SEELKFLKDLASATSVILDPVYSGKAAYGLINEMTKDPKNWEGKKILFIHTGGLLGLYDK  351

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MASL+GNW +MD+ ESVPR++G GKMF
Sbjct  352  VDQMASLMGNWSRMDVQESVPRKEGVGKMF  381



>ref|XP_003525175.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
isoform X1 [Glycine max]
 gb|KHN10517.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Glycine 
soja]
Length=379

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGR+PYVIPVGGSNSLGTWGYIEA+REIEQQ+Q      KFDDIVVACGSGGTIAGL
Sbjct  170  LIKEGRRPYVIPVGGSNSLGTWGYIEAVREIEQQIQKGTGNVKFDDIVVACGSGGTIAGL  229

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKA+VHA  VCDDP+YF+ + QGLLDGL AG+SS DIV IQNAKGLGYAMNT
Sbjct  230  SLGSSLSALKARVHAFSVCDDPDYFHNFAQGLLDGLKAGVSSRDIVHIQNAKGLGYAMNT  289

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVKE+A TTGV+LDPVYSGKAAY M+KDM+ENPKKWE RKILFIHTGGLLGL+DK
Sbjct  290  SEELNFVKEVAATTGVVLDPVYSGKAAYAMLKDMSENPKKWERRKILFIHTGGLLGLYDK  349

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +++AS VGNW++MD++ESVPR+DG GKMF
Sbjct  350  VDQLASFVGNWQRMDVNESVPRQDGIGKMF  379



>ref|NP_175275.3| 1-aminocyclopropane-1-carboxylate deaminase 1 [Arabidopsis thaliana]
 sp|F4HYF3.1|DCYD1_ARATH RecName: Full=Bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial; AltName: 
Full=1-aminocyclopropane-1-carboxylic acid deaminase 1; Short=AtACD1; 
AltName: Full=AtD-CDes1; Short=D-CDes1; AltName: Full=D-CDES; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32290.1| Dof-type transcription factor TMO6 [Arabidopsis thaliana]
Length=401

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL     + KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  199  PYVIPVGGSNSLGTWGYIEAAREIEEQLNYRPDDLKFDDIVVACGSGGTIAGISLGSWLG  258

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL+AG++S DIV+I NAKG GYAMNTSEEL+FV
Sbjct  259  ALKAKVHAFSVCDDPDYFYDFVQGLLDGLHAGVNSRDIVNIHNAKGKGYAMNTSEELEFV  318

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            K++A +TGVILDPVYSGKAAYG++ ++T++PK WEGRKILFIHTGGLLGL+DK ++MASL
Sbjct  319  KKVASSTGVILDPVYSGKAAYGLINEITKDPKCWEGRKILFIHTGGLLGLYDKVDQMASL  378

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR+DG GKMF
Sbjct  379  MGNWSRMDVSESVPRKDGVGKMF  401



>gb|AAL32737.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13324.1| unknown protein [Arabidopsis thaliana]
Length=382

 Score =   333 bits (853),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL     + KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  180  PYVIPVGGSNSLGTWGYIEAAREIEEQLNYRPDDLKFDDIVVACGSGGTIAGISLGSWLG  239

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL+AG++S DIV+I NAKG GYAMNTSEEL+FV
Sbjct  240  ALKAKVHAFSVCDDPDYFYDFVQGLLDGLHAGVNSRDIVNIHNAKGKGYAMNTSEELEFV  299

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            K++A +TGVILDPVYSGKAAYG++ ++T++PK WEGRKILFIHTGGLLGL+DK ++MASL
Sbjct  300  KKVASSTGVILDPVYSGKAAYGLINEITKDPKCWEGRKILFIHTGGLLGLYDKVDQMASL  359

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR+DG GKMF
Sbjct  360  MGNWSRMDVSESVPRKDGVGKMF  382



>sp|Q6ZHE5.2|DCYD1_ORYSJ RecName: Full=Putative D-cysteine desulfhydrase 1, mitochondrial; 
AltName: Full=OsD-CDes1; Short=D-CDes1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=426

 Score =   334 bits (856),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EGRKPYVIPVGGSNSLGTWGYIEAIREIE Q+Q +  + +FDDIVVACGSGGTIAGL++G
Sbjct  221  EGRKPYVIPVGGSNSLGTWGYIEAIREIEHQIQISG-DVQFDDIVVACGSGGTIAGLALG  279

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEE  492
            S LS LKAKVHA  VCDDP YF+ YVQ L+DGL++ + SHD+V+I+NAKGLGYAMNT+EE
Sbjct  280  SKLSSLKAKVHAFSVCDDPGYFHSYVQDLIDGLHSDLRSHDLVNIENAKGLGYAMNTAEE  339

Query  491  LKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEE  312
            LKFVK+IA  TG++LDPVYSGKAAYGM+KDM  NP KWEGRKILF+HTGGLLGL+DK +E
Sbjct  340  LKFVKDIATATGIVLDPVYSGKAAYGMLKDMGANPAKWEGRKILFVHTGGLLGLYDKVDE  399

Query  311  MASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  400  LSSLSGSWRRMDLEESVPRKDGTGKMF  426



>ref|XP_006580386.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase 
isoform X2 [Glycine max]
Length=382

 Score =   332 bits (852),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGR+PYVIPVGGSNSLGTWGYIEA+REIEQQ+Q      KFDDIVVACGSGGTIAGL
Sbjct  173  LIKEGRRPYVIPVGGSNSLGTWGYIEAVREIEQQIQKGTGNVKFDDIVVACGSGGTIAGL  232

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKA+VHA  VCDDP+YF+ + QGLLDGL AG+SS DIV IQNAKGLGYAMNT
Sbjct  233  SLGSSLSALKARVHAFSVCDDPDYFHNFAQGLLDGLKAGVSSRDIVHIQNAKGLGYAMNT  292

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVKE+A TTGV+LDPVYSGKAAY M+KDM+ENPKKWE RKILFIHTGGLLGL+DK
Sbjct  293  SEELNFVKEVAATTGVVLDPVYSGKAAYAMLKDMSENPKKWERRKILFIHTGGLLGLYDK  352

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +++AS VGNW++MD++ESVPR+DG GKMF
Sbjct  353  VDQLASFVGNWQRMDVNESVPRQDGIGKMF  382



>ref|XP_007160569.1| hypothetical protein PHAVU_002G332800g [Phaseolus vulgaris]
 gb|ESW32563.1| hypothetical protein PHAVU_002G332800g [Phaseolus vulgaris]
Length=384

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGR+PYVIPVGGSNSLGTWGY+EA+REIEQQ+Q  A   KFD+IVVACGSGGTIAGL
Sbjct  175  LIKEGRRPYVIPVGGSNSLGTWGYVEAVREIEQQIQRGADNIKFDNIVVACGSGGTIAGL  234

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKA VHA  VCDDP+YF+ + QGLLDGLNAG++S DIV I NAKGLGYAMNT
Sbjct  235  SLGSSLSTLKANVHAFSVCDDPDYFHNFAQGLLDGLNAGVNSRDIVHILNAKGLGYAMNT  294

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVK++A  TGVILDPVYSGKAAY M+KDM ENPKKWEGRK+LFIHTGGLLGL+DK
Sbjct  295  SEELNFVKDVAAATGVILDPVYSGKAAYAMLKDMVENPKKWEGRKVLFIHTGGLLGLYDK  354

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             +E+AS+VGNW++MD++ESVPR+DG GKMF
Sbjct  355  VDELASVVGNWQRMDVNESVPRQDGIGKMF  384



>emb|CDY49670.1| BnaC06g01990D [Brassica napus]
Length=402

 Score =   330 bits (847),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  200  PYVIPVGGSNSLGTWGYIEAAREIEEQLKCRTDGLKFDDIVVACGSGGTIAGISLGSWLG  259

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL AG++S DIVSI NAKG GYAMNTSEELKF+
Sbjct  260  ALKAKVHAFSVCDDPDYFYDFVQGLLDGLQAGVNSRDIVSIHNAKGKGYAMNTSEELKFL  319

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            K+ A  T VILDPVYSGKAAYG++ +MT++PK WEG+KILFIHTGGLLGL+DK ++MASL
Sbjct  320  KDTASATSVILDPVYSGKAAYGLINEMTKDPKSWEGKKILFIHTGGLLGLYDKVDQMASL  379

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR++G GKMF
Sbjct  380  MGNWSRMDVQESVPRKEGVGKMF  402



>ref|XP_006849530.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Amborella trichopoda]
 ref|XP_011625271.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Amborella trichopoda]
 gb|ERN11111.1| hypothetical protein AMTR_s00024p00154360 [Amborella trichopoda]
Length=374

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 181/210 (86%), Gaps = 2/210 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ +GR+PYVIPVGGSNSLGTWGYIEAIREIEQQ Q       FDDIVVACGSGG+IAGL
Sbjct  167  LISKGRRPYVIPVGGSNSLGTWGYIEAIREIEQQSQQMGL--CFDDIVVACGSGGSIAGL  224

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LKAKVHA  VCDDP YFY+Y QGL+DGL +G+SS D++ IQ+AKGLGYAMNT
Sbjct  225  SLGSWLSTLKAKVHAFSVCDDPNYFYDYTQGLIDGLQSGLSSRDVIDIQDAKGLGYAMNT  284

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL+F+KEIAE TGVILDPVYSGKAAY ++KDM +NP KWEG+KILFIHTGGLLG++DK
Sbjct  285  TEELQFIKEIAEATGVILDPVYSGKAAYVLLKDMKQNPAKWEGKKILFIHTGGLLGMYDK  344

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E++ SL+G W+K+ + ES PR DG GKMF
Sbjct  345  VEQLQSLMGKWQKLVVEESFPRIDGIGKMF  374



>ref|XP_009147970.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Brassica rapa]
Length=400

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  198  PYVIPVGGSNSLGTWGYIEAAREIEEQLKCRTDGLKFDDIVVACGSGGTIAGISLGSWLG  257

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL AG+++ DIVSI NAKG GYAMNTSEELKF+
Sbjct  258  DLKAKVHAFSVCDDPDYFYDFVQGLLDGLEAGVNARDIVSIHNAKGKGYAMNTSEELKFL  317

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            K++A  T VILDPVYSGKAAYG++ +MT++PK WEG+KILFIHTGGLLGL+DK ++MASL
Sbjct  318  KDLASATSVILDPVYSGKAAYGLINEMTKDPKSWEGKKILFIHTGGLLGLYDKVDQMASL  377

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR++G GKMF
Sbjct  378  MGNWSRMDVQESVPRKEGVGKMF  400



>ref|XP_006306308.1| hypothetical protein CARUB_v10012175mg, partial [Capsella rubella]
 gb|EOA39206.1| hypothetical protein CARUB_v10012175mg, partial [Capsella rubella]
Length=451

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 181/216 (84%), Gaps = 13/216 (6%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL+  +   KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  236  PYVIPVGGSNSLGTWGYIEAAREIEEQLKSRSEGLKFDDIVVACGSGGTIAGISLGSWLG  295

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQN-------------AKGL  519
             LKAKVHA  VCDDP+YFY++VQGLLDGL AG++S DIVSI N             AKG 
Sbjct  296  ALKAKVHAFSVCDDPDYFYDFVQGLLDGLQAGVNSRDIVSIHNYTGSEFDSFIILQAKGK  355

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYAMNTSEELKF+KE+A +TGVILDPVYSGKA YGM+ +MT++PK WEGRKILFIHTGGL
Sbjct  356  GYAMNTSEELKFLKEVASSTGVILDPVYSGKAVYGMINEMTKDPKNWEGRKILFIHTGGL  415

Query  338  LGLFDKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            LGL+DK ++MASL+GNW +MD+ ESVPR+DG GKMF
Sbjct  416  LGLYDKVDQMASLMGNWCRMDVSESVPRKDGVGKMF  451



>gb|AGK36098.1| 1-aminocyclopropane-1-carboxylate deaminase [Vitis vinifera]
Length=381

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAIREIEQQL     E  FDDIVVACGSG TIAGL
Sbjct  172  LLKEGRRPYVIPVGGSNSLGTWGYIEAIREIEQQLPTGTDEVGFDDIVVACGSGATIAGL  231

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS L  KVHA  VCDDP+YFY+YVQGLLDGL AG+ SHDIV IQNAKGLGYA+NT
Sbjct  232  SLGSSLSKLNTKVHAFSVCDDPDYFYDYVQGLLDGLQAGVRSHDIVDIQNAKGLGYAINT  291

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL F+KE+A +TGV+LDPVYSGKAAYGM+KDM ENP KWEGR ILFIHTGGLLGL+DK
Sbjct  292  TEELNFLKEVAISTGVVLDPVYSGKAAYGMIKDMAENPSKWEGRNILFIHTGGLLGLYDK  351

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+M SLVG W KMDI +S+PR DG GKMF
Sbjct  352  VEQMESLVGKWYKMDIDDSIPREDGIGKMF  381



>ref|XP_010645769.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X2 [Vitis vinifera]
Length=315

 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAIREIEQQL     E  FDDIVVACGSG TIAGL
Sbjct  106  LLKEGRRPYVIPVGGSNSLGTWGYIEAIREIEQQLPTGTDEVGFDDIVVACGSGATIAGL  165

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS L  KV A  VCDDP+YFY+YVQGLLDGL AG+ SHDIV IQNAKGLGYA+NT
Sbjct  166  SLGSSLSKLNTKVLAFSVCDDPDYFYDYVQGLLDGLQAGVRSHDIVDIQNAKGLGYAINT  225

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL F+KE+A +TGV+LDPVYSGKAAYGM+KDM ENP KWEGR ILFIHTGGLLGL+DK
Sbjct  226  TEELNFLKEVAVSTGVVLDPVYSGKAAYGMIKDMAENPSKWEGRNILFIHTGGLLGLYDK  285

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+M SLVG W KM+I +S+PR+DG GKMF
Sbjct  286  VEQMGSLVGKWCKMNIDDSIPRKDGIGKMF  315



>ref|XP_006393414.1| hypothetical protein EUTSA_v10011539mg [Eutrema salsugineum]
 gb|ESQ30700.1| hypothetical protein EUTSA_v10011539mg [Eutrema salsugineum]
Length=403

 Score =   326 bits (835),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL+      KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  201  PYVIPVGGSNSLGTWGYIEAAREIEEQLKSRTDGLKFDDIVVACGSGGTIAGISLGSWLG  260

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  VCDDP+YFY++VQGLLDGL AG++S DI++I NAKG GYAMNTSEEL+FV
Sbjct  261  NLKAKVHAFSVCDDPDYFYDFVQGLLDGLQAGVNSRDIINIHNAKGKGYAMNTSEELEFV  320

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            K++A  T VILDPVYSGKAAYG++ ++ ++ K WEGRKILFIHTGGLLGL+DK ++MASL
Sbjct  321  KKVASATSVILDPVYSGKAAYGLINEINKDLKSWEGRKILFIHTGGLLGLYDKVDQMASL  380

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            +GNW +MD+ ESVPR+DG GKMF
Sbjct  381  MGNWSRMDVQESVPRKDGVGKMF  403



>ref|XP_009417666.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=436

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ +GRKPYVIPVGGSNSLGTWGYIEAIRE+EQQ+ ++  E +FDDIVVACGSGGTIAGL
Sbjct  227  LMDQGRKPYVIPVGGSNSLGTWGYIEAIREVEQQIHNSCGEFQFDDIVVACGSGGTIAGL  286

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS LKAKVHA  VCDDP YFY +VQGL+DGL AG  SH I+ IQ+AKGLGYAMNT
Sbjct  287  SLGSRLSSLKAKVHAFSVCDDPTYFYNFVQGLIDGLEAGFDSHAIIDIQDAKGLGYAMNT  346

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL+FVK++A  TGV+LDPVYSGKAAYGM++DMT+NP KW+ RK+LF+HTGGLLGL+DK
Sbjct  347  AEELQFVKDVAAATGVVLDPVYSGKAAYGMLRDMTDNPTKWKKRKVLFVHTGGLLGLYDK  406

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+M SLVGNW+K++I ES+PR+DGTGKMF
Sbjct  407  VEQMTSLVGNWQKLEIEESIPRKDGTGKMF  436



>gb|AAF79717.1|AC020889_25 T1N15.3 [Arabidopsis thaliana]
 gb|AAD49754.2|AC007932_2 Contains similarity to 1-aminocyclopropane-1-carboxylate deaminase 
from Pseudomonas gb|M73488. ESTs gb|Z18033 and gb|Z34214 
come from this gene [Arabidopsis thaliana]
Length=414

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 182/216 (84%), Gaps = 13/216 (6%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIPVGGSNSLGTWGYIEA REIE+QL     + KFDDIVVACGSGGTIAG+S+GSWL 
Sbjct  199  PYVIPVGGSNSLGTWGYIEAAREIEEQLNYRPDDLKFDDIVVACGSGGTIAGISLGSWLG  258

Query  659  GLKAK-------------VHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGL  519
             LKAK             VHA  VCDDP+YFY++VQGLLDGL+AG++S DIV+I NAKG 
Sbjct  259  ALKAKLTDGSVKFPFIVQVHAFSVCDDPDYFYDFVQGLLDGLHAGVNSRDIVNIHNAKGK  318

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYAMNTSEEL+FVK++A +TGVILDPVYSGKAAYG++ ++T++PK WEGRKILFIHTGGL
Sbjct  319  GYAMNTSEELEFVKKVASSTGVILDPVYSGKAAYGLINEITKDPKCWEGRKILFIHTGGL  378

Query  338  LGLFDKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            LGL+DK ++MASL+GNW +MD+ ESVPR+DG GKMF
Sbjct  379  LGLYDKVDQMASLMGNWSRMDVSESVPRKDGVGKMF  414



>emb|CBI38261.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAIREIEQQL     E  FDDIVVACGSG TIAGL
Sbjct  172  LLKEGRRPYVIPVGGSNSLGTWGYIEAIREIEQQLPTGTDEVGFDDIVVACGSGATIAGL  231

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS L  KV A  VCDDP+YFY+YVQGLLDGL AG+ SHDIV IQNAKGLGYA+NT
Sbjct  232  SLGSSLSKLNTKVLAFSVCDDPDYFYDYVQGLLDGLQAGVRSHDIVDIQNAKGLGYAINT  291

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL F+KE+A +TGV+LDPVYSGKAAYGM+KDM ENP KWEGR ILFIHTGGLLGL+DK
Sbjct  292  TEELNFLKEVAVSTGVVLDPVYSGKAAYGMIKDMAENPSKWEGRNILFIHTGGLLGLYDK  351

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+M SLVG W KM+I +S+PR+DG GKMF
Sbjct  352  VEQMGSLVGKWCKMNIDDSIPRKDGIGKMF  381



>ref|XP_002263358.2| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X1 [Vitis vinifera]
Length=415

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEAIREIEQQL     E  FDDIVVACGSG TIAGL
Sbjct  206  LLKEGRRPYVIPVGGSNSLGTWGYIEAIREIEQQLPTGTDEVGFDDIVVACGSGATIAGL  265

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GS LS L  KV A  VCDDP+YFY+YVQGLLDGL AG+ SHDIV IQNAKGLGYA+NT
Sbjct  266  SLGSSLSKLNTKVLAFSVCDDPDYFYDYVQGLLDGLQAGVRSHDIVDIQNAKGLGYAINT  325

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL F+KE+A +TGV+LDPVYSGKAAYGM+KDM ENP KWEGR ILFIHTGGLLGL+DK
Sbjct  326  TEELNFLKEVAVSTGVVLDPVYSGKAAYGMIKDMAENPSKWEGRNILFIHTGGLLGLYDK  385

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E+M SLVG W KM+I +S+PR+DG GKMF
Sbjct  386  VEQMGSLVGKWCKMNIDDSIPRKDGIGKMF  415



>ref|XP_010276234.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=407

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REI+QQ+Q       FDDIVVACGSGGTIAGL
Sbjct  210  LLSEGRRPYVIPVGGSNSLGTWGYIEAVREIQQQIQRGPGIIGFDDIVVACGSGGTIAGL  269

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LKAKVHA  VCD P+YFY+YVQGLLDGL AG+SS +IVSIQ+AKGLGYAMNT
Sbjct  270  SLGSWLSDLKAKVHAFSVCDSPDYFYDYVQGLLDGLQAGVSSRNIVSIQDAKGLGYAMNT  329

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EELKFVKE+A  TGV+LDPVYSGKAAYG++KDM ENP KWEGRK+LF+HTGGLLGLFDK
Sbjct  330  TEELKFVKEVASATGVVLDPVYSGKAAYGLLKDMVENPTKWEGRKVLFVHTGGLLGLFDK  389

Query  320  SEEMASLVGNWRKMDIHE  267
             E+MAS++ +  K+ I +
Sbjct  390  VEQMASMINSCEKVCIAQ  407



>gb|ABK24303.1| unknown [Picea sitchensis]
Length=443

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 181/212 (85%), Gaps = 2/212 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFE--QKFDDIVVACGSGGTIA  687
            LL EGRKPYVIPVGGSNSLGTWGYIEA+REIEQQ+Q+        FDDIVVACGSGG+IA
Sbjct  232  LLKEGRKPYVIPVGGSNSLGTWGYIEAMREIEQQVQEKKVPGITFFDDIVVACGSGGSIA  291

Query  686  GLSIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAM  507
            GLS+GS+LS LKAKVHA  VCDDP+YFY+Y QGLLDGLNAG++S D+V+I NAKGLGYAM
Sbjct  292  GLSLGSYLSNLKAKVHAFAVCDDPDYFYDYTQGLLDGLNAGLNSRDLVNIINAKGLGYAM  351

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
            +T+EELK V EIAETTG+ILDPVYSGKA Y M+KD+ ENP KW GR+ILFIHTGGLLG+F
Sbjct  352  STAEELKCVTEIAETTGIILDPVYSGKAIYQMLKDIMENPSKWGGRRILFIHTGGLLGMF  411

Query  326  DKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            DK +++  L+G W+++ + ES+ + DG GKMF
Sbjct  412  DKVQQLQPLIGKWQRLKVDESMFQADGIGKMF  443



>ref|XP_004299485.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=427

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGR+PYVIPVGGS+SLGTWGYIEAI+EIEQQL     + KFDDIVVACGSGGTIAGL
Sbjct  218  LIKEGRRPYVIPVGGSDSLGTWGYIEAIQEIEQQLHCGTGKLKFDDIVVACGSGGTIAGL  277

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LKAKVHA  VCDDP+YFY++VQGLLDGL AG+ S  I++IQNAKGLGYA+NT
Sbjct  278  SLGSWLSSLKAKVHAFSVCDDPDYFYDFVQGLLDGLEAGVDSRHIINIQNAKGLGYAINT  337

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            +EEL FVKEIA TTGVILDPVYSGKAAYG++KD  ENPKKWEGRKILFIHTGGLLGLFDK
Sbjct  338  AEELTFVKEIAATTGVILDPVYSGKAAYGLLKDFAENPKKWEGRKILFIHTGGLLGLFDK  397

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             E++A  +G + +MD+ +SVPR+DG GKMF
Sbjct  398  VEQIAPSLGKYSRMDVCDSVPRKDGIGKMF  427



>gb|ABR17681.1| unknown [Picea sitchensis]
Length=443

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 180/212 (85%), Gaps = 2/212 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFE--QKFDDIVVACGSGGTIA  687
            LL EGRKPYVIPVGGSNSLGTWGYIEA+ EIEQQ+Q+        FDDIVVACGSGG+IA
Sbjct  232  LLKEGRKPYVIPVGGSNSLGTWGYIEAMTEIEQQVQEKKVPGITFFDDIVVACGSGGSIA  291

Query  686  GLSIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAM  507
            GLS+GS+LS LKAKVHA  VCDDP+YFY+Y QGLLDGLNAG++S D+++I NAKGLGYAM
Sbjct  292  GLSLGSYLSNLKAKVHAFAVCDDPDYFYDYTQGLLDGLNAGLNSRDLINIINAKGLGYAM  351

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
            +T+EELK V EIAETTG+ILDPVYSGKA Y M+KD+ ENP KW GR+ILFIHTGGLLG+F
Sbjct  352  STAEELKCVTEIAETTGIILDPVYSGKAIYQMLKDIMENPSKWGGRRILFIHTGGLLGMF  411

Query  326  DKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            DK +++  L+G W+++ + ES+ + DG GKMF
Sbjct  412  DKVQQLQPLIGKWQRLKVDESMFQADGIGKMF  443



>gb|KFK36095.1| hypothetical protein AALP_AA4G076700 [Arabis alpina]
Length=374

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EGRKPYV+P GGSN+LGTWGYIEA REIE+QL+      +FDDIVVACGSGGTIAG+
Sbjct  165  LEKEGRKPYVVPRGGSNALGTWGYIEAAREIEEQLKTRTDGLQFDDIVVACGSGGTIAGI  224

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA  V +DPEYFY+  QG+LDGL AG++  DIV+I N +G GYA++T
Sbjct  225  SLGSWLGTLKAKVHAFSVSNDPEYFYDVFQGILDGLQAGVNCRDIVNIHNGQGKGYAVST  284

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             EELKFVK++A  TGVILDP+YSGKAAYG++ +MT++PK WEG+KILFIHTGGLLGL+DK
Sbjct  285  PEELKFVKDVACATGVILDPLYSGKAAYGLINEMTKDPKNWEGKKILFIHTGGLLGLYDK  344

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++M SLVG+W +MD+ ESVPR+DG GKMF
Sbjct  345  VDQMGSLVGSWCRMDVQESVPRKDGVGKMF  374



>gb|KDP23066.1| hypothetical protein JCGZ_01161 [Jatropha curcas]
Length=386

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIP GGSN++GTWGYIEAI+EIEQQ+  +    KFDDIVVACGSGGT+AGLS+GSWL 
Sbjct  184  PYVIPAGGSNTIGTWGYIEAIKEIEQQVLASNERLKFDDIVVACGSGGTVAGLSLGSWLG  243

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  + D+P+YFY +VQ LLDG  AG++SH+IV+IQ+AKGLGYA NTS+ELKFV
Sbjct  244  TLKAKVHAFSIYDEPDYFYNFVQELLDGFGAGVNSHEIVNIQDAKGLGYAKNTSDELKFV  303

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            +E+A  TG+ILDPVYSGKAAYGMMKDM ENP+KWEGRKILFIHTGG LGL+DK ++M+SL
Sbjct  304  QEVATATGIILDPVYSGKAAYGMMKDMAENPRKWEGRKILFIHTGGFLGLYDKVDQMSSL  363

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            V +  +M I ESV R+D T KMF
Sbjct  364  VEHCVRMHIDESVSRKDDTAKMF  386



>ref|XP_012089571.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Jatropha curcas]
Length=395

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PYVIP GGSN++GTWGYIEAI+EIEQQ+  +    KFDDIVVACGSGGT+AGLS+GSWL 
Sbjct  193  PYVIPAGGSNTIGTWGYIEAIKEIEQQVLASNERLKFDDIVVACGSGGTVAGLSLGSWLG  252

Query  659  GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFV  480
             LKAKVHA  + D+P+YFY +VQ LLDG  AG++SH+IV+IQ+AKGLGYA NTS+ELKFV
Sbjct  253  TLKAKVHAFSIYDEPDYFYNFVQELLDGFGAGVNSHEIVNIQDAKGLGYAKNTSDELKFV  312

Query  479  KEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASL  300
            +E+A  TG+ILDPVYSGKAAYGMMKDM ENP+KWEGRKILFIHTGG LGL+DK ++M+SL
Sbjct  313  QEVATATGIILDPVYSGKAAYGMMKDMAENPRKWEGRKILFIHTGGFLGLYDKVDQMSSL  372

Query  299  VGNWRKMDIHESVPRRDGTGKMF  231
            V +  +M I ESV R+D T KMF
Sbjct  373  VEHCVRMHIDESVSRKDDTAKMF  395



>ref|XP_007037068.1| D-cysteine desulfhydrase isoform 3, partial [Theobroma cacao]
 gb|EOY21569.1| D-cysteine desulfhydrase isoform 3, partial [Theobroma cacao]
Length=423

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 163/209 (78%), Gaps = 31/209 (15%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGT                                GGTIAGL
Sbjct  246  LLKEGRRPYVIPVGGSNSLGT-------------------------------CGGTIAGL  274

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAKVHA CVCDDP+YFY++VQGL+DGL AG+ S DIVSI NAKGLGYA+NT
Sbjct  275  SLGSWLGELKAKVHAFCVCDDPDYFYDFVQGLVDGLQAGVDSRDIVSIINAKGLGYAINT  334

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEELKFVKEIA  TGV+LDPVYSGKAAYGMMKDM ENPK WEGRK+LFIHTGGLLGLFDK
Sbjct  335  SEELKFVKEIAAATGVVLDPVYSGKAAYGMMKDMAENPKNWEGRKVLFIHTGGLLGLFDK  394

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKM  234
             ++M+SLVGNW++MD++ES+PR+DG GKM
Sbjct  395  VDQMSSLVGNWQRMDVNESIPRKDGIGKM  423



>ref|XP_010091756.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
 gb|EXB45119.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Morus notabilis]
Length=374

 Score =   294 bits (753),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 173/200 (87%), Gaps = 2/200 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIP GGSNSLGTWGYIEAIREIEQQ+Q T  +QKFDDIVVACGSGGTIAGL
Sbjct  174  LLSEGRRPYVIPAGGSNSLGTWGYIEAIREIEQQIQTT--KQKFDDIVVACGSGGTIAGL  231

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS LKAKVH+     DP YFY+++QGL DGL AG++  DIV+IQN K LGY+++T
Sbjct  232  ALGSSLSSLKAKVHSFFPRRDPNYFYDFIQGLFDGLEAGVTVRDIVNIQNEKDLGYSVDT  291

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             E+LKF+K+IA  TGV+LDPV+SGKA YG+ KDMTENPKKWEGRKILFIHTGGLLGL+D 
Sbjct  292  FEQLKFIKDIAAATGVVLDPVFSGKAGYGLWKDMTENPKKWEGRKILFIHTGGLLGLYDY  351

Query  320  SEEMASLVGNWRKMDIHESV  261
             E+MASLVGNWR+MDIHE V
Sbjct  352  VEQMASLVGNWRRMDIHEYV  371



>ref|XP_001777657.1| predicted protein [Physcomitrella patens]
 gb|EDQ57559.1| predicted protein [Physcomitrella patens]
Length=374

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFE--QKFDDIVVACGSGGTIAGLS  678
            EGRKPYVIPVGGSNSLGTWGYIE ++E++ QL+       + FDDIV+ACGSGGT AGL+
Sbjct  165  EGRKPYVIPVGGSNSLGTWGYIEFVKELQGQLEGGKVSGIKHFDDIVMACGSGGTTAGLA  224

Query  677  IGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTS  498
            + + LS L+ K+HA  VCD PEYFYEYVQGL+DGL+AG+ S DIV + NAKGLGYAM+T+
Sbjct  225  LAAHLSNLQTKIHAYAVCDTPEYFYEYVQGLIDGLDAGVKSEDIVKVVNAKGLGYAMSTT  284

Query  497  EELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKS  318
            EELK VKE+AE TGVILDPVYSGKA  GM+KDM ENP +WEG+K+LF+HTGGLLG++DK 
Sbjct  285  EELKLVKEVAELTGVILDPVYSGKALIGMLKDMAENPSEWEGKKVLFVHTGGLLGMYDKV  344

Query  317  EEMASLVGNWRKMDIHESVPR-RDGTGKMF  231
            +++  L   W +  I E+V +  DG GKMF
Sbjct  345  QQLQPLTSKWERFKIAETVLQGGDGKGKMF  374



>gb|EMT11299.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Aegilops 
tauschii]
Length=429

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL +G KPYVI  GGSNSLG WGYIEA+REIEQQ+Q ++ + +FDDIVVACGSGGT+AGL
Sbjct  164  LLEKGWKPYVISGGGSNSLGDWGYIEAVREIEQQIQLSS-DVQFDDIVVACGSGGTVAGL  222

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS +KAKVH   VC +  YFY+ VQGL+DGL  G++S DIV I++AKGLGYAM+T
Sbjct  223  ALGSQLSSIKAKVHGFSVCYNLGYFYDNVQGLIDGLQPGLNSRDIVRIEDAKGLGYAMST  282

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             EELKFVK+IA  TG++LDPVYSGKAAYGM+KDM+ NP KWEGRK+LF+HTGGLLGL+DK
Sbjct  283  PEELKFVKDIAAATGIVLDPVYSGKAAYGMLKDMSNNPTKWEGRKVLFVHTGGLLGLYDK  342

Query  320  SEEMASLVGNWRKMDIHESV  261
             ++++ L G WRKMD+ E V
Sbjct  343  VDQLSCLAGRWRKMDLEELV  362



>ref|XP_006478105.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
isoform X2 [Citrus sinensis]
Length=390

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 154/210 (73%), Gaps = 38/210 (18%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNS+GTWGYIEAI+EIEQQLQ      KFDDIVVACGSGGTIAGL
Sbjct  219  LLKEGRRPYVIPVGGSNSIGTWGYIEAIKEIEQQLQTGTGGVKFDDIVVACGSGGTIAGL  278

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWL  LKAK                                      +KGLGYA+NT
Sbjct  279  SLGSWLGTLKAK--------------------------------------SKGLGYAINT  300

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            SEEL FVK+IA  TGV+LDPVYSGKAAYGM+ DM +NPKKWEGRK+LF+HTGGLLGLFDK
Sbjct  301  SEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDK  360

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
             ++MA L+ NW +MD+HESVPR+DGTGKMF
Sbjct  361  VDQMAPLLKNWSRMDVHESVPRKDGTGKMF  390



>gb|AFW73686.1| hypothetical protein ZEAMMB73_104591 [Zea mays]
Length=393

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 161/202 (80%), Gaps = 3/202 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQ+Q ++ + +FDDIVVACGSGGTIAGL
Sbjct  182  LLEEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQIQQSS-DVQFDDIVVACGSGGTIAGL  240

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS L  KVHA  VCDDPEYFY+YVQGL+DGLN+G  SHDIVS++NAKGLGYAMNT
Sbjct  241  ALGSRLSSLNTKVHAFSVCDDPEYFYDYVQGLIDGLNSGFDSHDIVSMENAKGLGYAMNT  300

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEG--RKILFIHTGGLLGLF  327
            +EELKFVK+IA +TG++LDPVYSGKA YG++KDM  NP KW+    KILF     L+   
Sbjct  301  AEELKFVKDIAASTGIVLDPVYSGKAVYGLLKDMAGNPAKWKEWILKILFHAKMALVRCS  360

Query  326  DKSEEMASLVGNWRKMDIHESV  261
            D+     S++ +  K  IH  V
Sbjct  361  DQYGPCDSMMAHSCKHCIHYRV  382



>gb|KHN00124.1| Putative 1-aminocyclopropane-1-carboxylate deaminase, partial 
[Glycine soja]
Length=206

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 158/206 (77%), Gaps = 18/206 (9%)
 Frame = -3

Query  794  GYIEAIREIEQQLQ------------DTAFEQKFDDIVVACGS------GGTIAGLSIGS  669
            GYIEA+REIEQQ+Q                E  F +  +A  S      GGTIA LS+GS
Sbjct  1    GYIEAVREIEQQIQRGQAMSSLMILLSVVAEAGFCNNFLASSSMSVVINGGTIADLSLGS  60

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEEL  489
             LS LKAKVHA  VCDDP+YF+ + QGLLDGL AG+SS DIV IQNAKGLGYAMNTSEEL
Sbjct  61   SLSILKAKVHAFSVCDDPDYFHNFTQGLLDGLKAGVSSRDIVHIQNAKGLGYAMNTSEEL  120

Query  488  KFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEM  309
             FVKE+A  TGV+LDPVY GKAAY M+KDM+ENPKKWEGRKILFIHTGGLLGL+DK +++
Sbjct  121  NFVKEVATATGVVLDPVYRGKAAYAMVKDMSENPKKWEGRKILFIHTGGLLGLYDKVDQL  180

Query  308  ASLVGNWRKMDIHESVPRRDGTGKMF  231
            AS VGNW++MD++ESVP+ DG GKMF
Sbjct  181  ASFVGNWQRMDVNESVPKHDGIGKMF  206



>ref|XP_002971172.1| hypothetical protein SELMODRAFT_94611 [Selaginella moellendorffii]
 gb|EFJ27770.1| hypothetical protein SELMODRAFT_94611 [Selaginella moellendorffii]
Length=357

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 160/196 (82%), Gaps = 1/196 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GRKPY+IPVGGSNSLGTWGYI A +EIEQQ++      +FD+IV+ACGSGGT AGL
Sbjct  162  LRAQGRKPYLIPVGGSNSLGTWGYISAAQEIEQQIEAGTCP-RFDEIVMACGSGGTTAGL  220

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++G+ LS +KAKVH   VCD P+YFY+Y+QGLLDGL+A + S DIV + +AKGLGYA+++
Sbjct  221  ALGNHLSMIKAKVHGYTVCDSPDYFYDYIQGLLDGLHAQVDSRDIVRLVDAKGLGYALSS  280

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            + EL+ VKEI+E TGVILDPVYSGKA +GM+KDM  + K W G+K+LFIHTGGLLG+FDK
Sbjct  281  TGELELVKEISEATGVILDPVYSGKALHGMVKDMVCDAKYWTGKKVLFIHTGGLLGMFDK  340

Query  320  SEEMASLVGNWRKMDI  273
             +++  L GNWR+M I
Sbjct  341  LQQIQPLTGNWRRMQI  356



>ref|XP_002961916.1| hypothetical protein SELMODRAFT_77084 [Selaginella moellendorffii]
 gb|EFJ37176.1| hypothetical protein SELMODRAFT_77084 [Selaginella moellendorffii]
Length=357

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 160/196 (82%), Gaps = 1/196 (1%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GRKPY+IPVGGSNSLGTWGYI A +EIEQQ++      +FD+IV+ACGSGGT AGL
Sbjct  162  LRAQGRKPYLIPVGGSNSLGTWGYISAAQEIEQQIEAGTCP-RFDEIVMACGSGGTTAGL  220

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++G+ LS +K+KVH   VCD P+YFY+Y+QGLLDGL+A + S DIV + +AKGLGYA+++
Sbjct  221  ALGNHLSMIKSKVHGYTVCDSPDYFYDYIQGLLDGLHAQVDSRDIVRLVDAKGLGYALSS  280

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
            + EL+ VKEI+E TGVILDPVYSGKA +GM+KDM  + K W G+K+LFIHTGGLLG+FDK
Sbjct  281  TGELELVKEISEATGVILDPVYSGKALHGMVKDMVCDAKYWTGKKVLFIHTGGLLGMFDK  340

Query  320  SEEMASLVGNWRKMDI  273
             +++  L GNWR+M I
Sbjct  341  LQQIQPLTGNWRRMQI  356



>gb|ABR26105.1| 1-aminocyclopropane-1-carboxylate deaminase [Oryza sativa Indica 
Group]
Length=156

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -3

Query  698  GTIAGLSIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGL  519
            GTIAGL++GS LS LKAKVHA  VCDDP YF+ YVQ L+DGL++ + SHD+V+I+NAKGL
Sbjct  1    GTIAGLALGSKLSSLKAKVHAFSVCDDPGYFHSYVQDLIDGLHSDLRSHDLVNIENAKGL  60

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYAMNT+EELKFVK+IA  TG++LDPVYSGKAAYGM+KDM  NP KWEGRKILF+HTGGL
Sbjct  61   GYAMNTAEELKFVKDIATATGIVLDPVYSGKAAYGMLKDMGANPAKWEGRKILFVHTGGL  120

Query  338  LGLFDKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            LGL+DK +E++SL G+WR+MD+ ESVPR+DGTGKMF
Sbjct  121  LGLYDKVDELSSLSGSWRRMDLEESVPRKDGTGKMF  156



>gb|EPS62548.1| d-cysteine desulfhydrase, partial [Genlisea aurea]
Length=139

 Score =   235 bits (599),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -3

Query  647  KVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFVKEIA  468
            K+HA  VCDDP+YFYEY QGLLDGL AG+SS DI++IQ+AKGLGYAMNT+EELKFVKE+ 
Sbjct  1    KIHAYTVCDDPDYFYEYTQGLLDGLGAGVSSRDIINIQDAKGLGYAMNTTEELKFVKEVG  60

Query  467  ETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASLVGNW  288
            ETTGV+LDPVYSGKAA  M KDM ENP KWEGRK+LF+HTGGLLGLFDK+E++ S++G W
Sbjct  61   ETTGVVLDPVYSGKAAMRMTKDMVENPWKWEGRKVLFVHTGGLLGLFDKTEQIGSMIGKW  120

Query  287  RKMDIHESVPRRDGTGKMF  231
             +MD+HES PR++GTGKMF
Sbjct  121  SRMDVHESFPRKEGTGKMF  139



>ref|XP_008671364.1| PREDICTED: uncharacterized protein LOC103648725 [Zea mays]
Length=219

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -3

Query  644  VHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFVKEIAE  465
            VHA  VCDDPEYFY+YVQGL+DGLN+G+ S DIVSI+NAKGLGYAMNT+EELKFVK+IA 
Sbjct  82   VHAFSVCDDPEYFYDYVQGLIDGLNSGLDSRDIVSIENAKGLGYAMNTAEELKFVKDIAA  141

Query  464  TTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEMASLVGNWR  285
            +TG++LDPVYSGKA YG++KDM  NP KW+GRK+LFIHTGGLLGL+DK+++++SL G+WR
Sbjct  142  STGIVLDPVYSGKAVYGLLKDMAGNPAKWKGRKVLFIHTGGLLGLYDKADQLSSLAGSWR  201

Query  284  KMDIHESVPRRDGTGKMF  231
            +MD+ +SVPR+DGTGKMF
Sbjct  202  RMDLEDSVPRKDGTGKMF  219



>gb|KGN63956.1| hypothetical protein Csa_1G031770 [Cucumis sativus]
Length=419

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 147/210 (70%), Gaps = 35/210 (17%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGRKPYVIPVGGSNSLGTWGYIEAIRE+EQQL     + KFDDIVVACG   ++ G 
Sbjct  245  LVAEGRKPYVIPVGGSNSLGTWGYIEAIRELEQQLDSGNGKIKFDDIVVACGRTFSMKG-  303

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
                W + +    H LC CD                              AKGLGYA+NT
Sbjct  304  ---CWFAHVWQ--HHLC-CD----------------------------VEAKGLGYAINT  329

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             +EL FVKE+AE+TGV+LDPVYSGKAAYGMMKDM ENPKKWEGRKILFIHTGGLLGL+DK
Sbjct  330  PDELNFVKEVAESTGVVLDPVYSGKAAYGMMKDMAENPKKWEGRKILFIHTGGLLGLYDK  389

Query  320  SEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            ++++ S +G W ++D++E+VPR DG GKMF
Sbjct  390  ADQINSTLGKWHRLDVNETVPRIDGVGKMF  419



>gb|KEH21438.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Medicago 
truncatula]
Length=321

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+++GR+PYVIPVGGSNSLGTWGY+EA+REIE Q+Q      KFDDIVVACGSGGTIAGL
Sbjct  179  LINQGRRPYVIPVGGSNSLGTWGYLEAVREIELQIQSGTSNVKFDDIVVACGSGGTIAGL  238

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GS LS LKA+VHA  VCDDP+YF+ +VQGLLDGL AG+SS DIV IQNAKGLGYAMNT
Sbjct  239  ALGSSLSTLKARVHAFSVCDDPDYFHNFVQGLLDGLKAGVSSRDIVHIQNAKGLGYAMNT  298

Query  500  SEELKFVKEIAETTGVILDPVY  435
            SEEL FVKE+AE TGV+LDPVY
Sbjct  299  SEELNFVKEVAEATGVVLDPVY  320



>gb|EMT14169.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Aegilops 
tauschii]
Length=356

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GR+PYVIP GGSN+LG WGYIEA+REIE+Q+Q +  + +FDDIVVACGSGGT+AGL++GS
Sbjct  201  GRRPYVIPAGGSNALGNWGYIEAVREIEEQIQLSGGDVQFDDIVVACGSGGTVAGLALGS  260

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEEL  489
             LS LKAKVHA  VC  P+YFY+ VQGL+D L +G++SHDIVSI++AKGLGYA +T+EEL
Sbjct  261  QLSSLKAKVHAFSVCYGPKYFYDCVQGLIDELQSGLNSHDIVSIEDAKGLGYARSTAEEL  320

Query  488  KFVKEIAETTGVILDPVYSGKAAYGMMKDMTENP  387
            +FVK++A  TG++LDPVY+GKAAY M+KDM++NP
Sbjct  321  RFVKDVAAATGIVLDPVYTGKAAYSMVKDMSDNP  354



>gb|AAN74942.1| putative 1-aminocyclopropane-1-carboxylate deaminase [Betula 
pendula]
Length=229

 Score =   228 bits (580),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL+EGR+PYVIPVGGSNSLGTWGYIEAIREIEQQLQ    E KFDDIVVACGSGGTIAGL
Sbjct  96   LLNEGRRPYVIPVGGSNSLGTWGYIEAIREIEQQLQTGTGEIKFDDIVVACGSGGTIAGL  155

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            S+GSWLS LKAKVHA  VCDDP+YFY+++QGLL+GL AG+ S DIV+I NAKGLGYA+NT
Sbjct  156  SLGSWLSTLKAKVHAFSVCDDPDYFYDFIQGLLNGLEAGVDSRDIVNIHNAKGLGYAINT  215

Query  500  SEELKFVKEIAETT  459
            SEELKFVKE+A  T
Sbjct  216  SEELKFVKEVAAAT  229



>gb|KIY95661.1| hypothetical protein MNEG_12301, partial [Monoraphidium neglectum]
Length=338

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 131/175 (75%), Gaps = 6/175 (3%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EGRKPY IPVGGSNSLG WGY+ A+ EI++Q +D  F  KFDDI++ACGSGGT AGL++G
Sbjct  167  EGRKPYFIPVGGSNSLGCWGYLMAVDEIQKQSEDLGF--KFDDIIMACGSGGTTAGLALG  224

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGL---NAGISSHDIVSIQNAKGLGYAMNT  501
            + LSG  A+VHA  VCDDP+YFY ++ GL  GL   +A  +   + ++Q A+GLGYA+++
Sbjct  225  NHLSGYGARVHAYGVCDDPDYFYNFIDGLYRGLGWPDAAGARGTLAAVQ-ARGLGYAISS  283

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLL  336
              EL  V+ +A  TGV+LDPVYSGKA + ++ D+   P +W GR++LF+HTGGLL
Sbjct  284  DAELATVQAVAGATGVVLDPVYSGKALHQLLADIAAAPGEWRGRRVLFLHTGGLL  338



>ref|XP_001700834.1| hypothetical protein CHLREDRAFT_98369 [Chlamydomonas reinhardtii]
 gb|EDP07088.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=352

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G+ PYVIPVGGS++LGTWGY++AI EI  Q ++    +   DI +ACGSGGT AGL++GS
Sbjct  170  GKNPYVIPVGGSSALGTWGYLQAIDEIIHQSREMG--ETITDIAMACGSGGTTAGLALGS  227

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSIQNAKGLGYAMNTSEE  492
             LSGL A+VHA  VCD P YFY+Y+ GL  GL    ++   ++    A+G GYA++T EE
Sbjct  228  HLSGLGARVHAYGVCDTPSYFYDYINGLFQGLGLEALAVQSLLRAVQARGAGYAISTEEE  287

Query  491  LKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEE  312
            L  V+ +A  TGV+LDPVYSGKA + +++++  +P  W GR +LF+HTGGLLG++DK ++
Sbjct  288  LATVQAVAAATGVVLDPVYSGKAVHALLREVRADPGAWRGRTVLFVHTGGLLGMYDKLDQ  347

Query  311  MASLV  297
            +  LV
Sbjct  348  LGPLV  352



>ref|XP_007200136.1| hypothetical protein PRUPE_ppa017238mg, partial [Prunus persica]
 gb|EMJ01335.1| hypothetical protein PRUPE_ppa017238mg, partial [Prunus persica]
Length=148

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 117/204 (57%), Gaps = 66/204 (32%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPV G                                          AGL
Sbjct  11   LLKEGRRPYVIPVMGVQ---------------------------------------FAGL  31

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNT  501
            ++GSWLS LKAKVHA  VCDDP+YFY+YVQGLLDGL AGI S DIV+IQN +        
Sbjct  32   ALGSWLSSLKAKVHAFSVCDDPDYFYDYVQGLLDGLEAGIDSRDIVNIQNVR--------  83

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
              E K                  GKAAYGM+KDM EN KKWEGRKILFIHTGGLLGLFDK
Sbjct  84   --EDK-----------------CGKAAYGMLKDMAENTKKWEGRKILFIHTGGLLGLFDK  124

Query  320  SEEMASLVGNWRKMDIHESVPRRD  249
             E+MA+  GNWR+MD+ ESVPR D
Sbjct  125  VEQMATSSGNWRRMDVQESVPRSD  148



>ref|XP_005850727.1| hypothetical protein CHLNCDRAFT_34235 [Chlorella variabilis]
 gb|EFN58625.1| hypothetical protein CHLNCDRAFT_34235 [Chlorella variabilis]
Length=373

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 135/189 (71%), Gaps = 9/189 (5%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G  P+VIPVGGS+S+G WGY+E +RE+EQQ+      Q F DI +ACGSGGT AG+++G+
Sbjct  176  GLNPFVIPVGGSSSMGVWGYLEMMREVEQQI----VGQGFTDIAMACGSGGTTAGIALGN  231

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA-----GISSHDIVSIQNAKGLGYAMN  504
             L GL  +VHA  VCDDP+YF+ +  GLL+GL A     G  S  +     A+G GYA++
Sbjct  232  HLGGLGLRVHAYGVCDDPDYFHTFCDGLLEGLGATRDVVGADSAGMFRAVQARGAGYAIS  291

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
              +EL+ V ++A  TG++LDPVY+GKA +G++ +M E P++W GRK+LF+HTGGLLG+++
Sbjct  292  REDELQAVADVAAATGIVLDPVYTGKALHGLLTEMRERPEEWRGRKVLFVHTGGLLGMYE  351

Query  323  KSEEMASLV  297
            K  ++  LV
Sbjct  352  KVAQLQPLV  360



>ref|XP_005649299.1| pyridoxal phosphate-depend, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24755.1| pyridoxal phosphate-depend, partial [Coccomyxa subellipsoidea 
C-169]
Length=373

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G++PYV+P+GGSN+LG+WGY++A +E+ ++    A      DIV+ACGSGGT AG+
Sbjct  190  LQSQGKRPYVVPLGGSNALGSWGYLQAAQEMLERFGKGAIT----DIVMACGSGGTTAGI  245

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGI-SSHDIVSIQNAKGLGYAMN  504
            ++G+ LSG  A+VHA  VCDD EYFY ++ G+   L A   +S D++    AKG GYA++
Sbjct  246  ALGNHLSGFGARVHAYGVCDDEEYFYNFIDGIFADLGATPDTSRDLLIAHQAKGAGYAIS  305

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
              EEL+ +  ++  TG+++D VYSGKA +   KDM  NP +W+GRK+LF+HTGGLLG++ 
Sbjct  306  RPEELQSILAVSHATGIVMDSVYSGKAFHAFQKDMQTNPAEWKGRKVLFLHTGGLLGMYS  365

Query  323  KSEEMASL  300
            ++ E+ +L
Sbjct  366  EAAELQTL  373



>ref|XP_002955139.1| hypothetical protein VOLCADRAFT_65498 [Volvox carteri f. nagariensis]
 gb|EFJ43893.1| hypothetical protein VOLCADRAFT_65498 [Volvox carteri f. nagariensis]
Length=403

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 134/195 (69%), Gaps = 11/195 (6%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQ---DTAFEQKFDDIVVACGSGGTIAGLS  678
            GRKPY+IPVGGSNSLG WGY+E+ ++++  LQ   D        DI +ACGSGGT AGL+
Sbjct  190  GRKPYIIPVGGSNSLGVWGYLESSQQLKYLLQLGGDDPAAPMITDIAMACGSGGTTAGLA  249

Query  677  IGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG--------LNAGISSHDIVSIQNAKG  522
            +GS LS L  +V A  VCD PEYFY+Y+ GLL G        L  G  + D++ +  A+G
Sbjct  250  LGSALSPLGGRVLAFGVCDTPEYFYDYIDGLLGGLGAAPGGELLGGRRARDLLYVIQARG  309

Query  521  LGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGG  342
             GYA++T  EL+ V+E+A  TGV+LDPVYSGKA + ++ D+    ++W GR +LF+HTGG
Sbjct  310  AGYAISTEAELRTVQEVAAATGVVLDPVYSGKAVHALLADIRARAEEWRGRTVLFVHTGG  369

Query  341  LLGLFDKSEEMASLV  297
            LLG++DK +++  LV
Sbjct  370  LLGMYDKLDQLEPLV  384



>gb|KDO46413.1| hypothetical protein CISIN_1g019410mg [Citrus sinensis]
Length=311

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNS+GTWGYIEAI+EIEQQLQ      KFDDIVVACGSGGTIAGL
Sbjct  174  LLKEGRRPYVIPVGGSNSIGTWGYIEAIKEIEQQLQTGTGGVKFDDIVVACGSGGTIAGL  233

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQN  531
            S+GSWL  LKAKVHA  VCDDP+YFY+Y QGLLDGLNAG+ S DIV+IQN
Sbjct  234  SLGSWLGTLKAKVHAFSVCDDPDYFYDYTQGLLDGLNAGVDSRDIVNIQN  283



>gb|KDO46412.1| hypothetical protein CISIN_1g019410mg [Citrus sinensis]
Length=315

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNS+GTWGYIEAI+EIEQQLQ      KFDDIVVACGSGGTIAGL
Sbjct  178  LLKEGRRPYVIPVGGSNSIGTWGYIEAIKEIEQQLQTGTGGVKFDDIVVACGSGGTIAGL  237

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQN  531
            S+GSWL  LKAKVHA  VCDDP+YFY+Y QGLLDGLNAG+ S DIV+IQN
Sbjct  238  SLGSWLGTLKAKVHAFSVCDDPDYFYDYTQGLLDGLNAGVDSRDIVNIQN  287



>gb|KJB39183.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=346

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REIE+QLQ  +   KFDDIVVACGSGGTIAGL
Sbjct  222  LLKEGRRPYVIPVGGSNSLGTWGYIEAMREIEEQLQIRSNRVKFDDIVVACGSGGTIAGL  281

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK  525
            S+GSWL  LKAKVHA CVCDDP+YFY++VQ L+DGL AG+++ DIVSI N +
Sbjct  282  SLGSWLGALKAKVHAFCVCDDPDYFYDFVQDLIDGLQAGVNARDIVSIINVR  333



>gb|KDO46411.1| hypothetical protein CISIN_1g019410mg [Citrus sinensis]
Length=341

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNS+GTWGYIEAI+EIEQQLQ      KFDDIVVACGSGGTIAGL
Sbjct  204  LLKEGRRPYVIPVGGSNSIGTWGYIEAIKEIEQQLQTGTGGVKFDDIVVACGSGGTIAGL  263

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNA  528
            S+GSWL  LKAKVHA  VCDDP+YFY+Y QGLLDGLNAG+ S DIV+IQN 
Sbjct  264  SLGSWLGTLKAKVHAFSVCDDPDYFYDYTQGLLDGLNAGVDSRDIVNIQNV  314



>gb|KDO37019.1| hypothetical protein CISIN_1g039995mg [Citrus sinensis]
Length=118

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -3

Query  530  AKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIH  351
            +KGLGYA+NTSEEL FVK+IA  TGV+LDPVYSGKAAYGM+ DM +NPKKWEGRK+LF+H
Sbjct  19   SKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVH  78

Query  350  TGGLLGLFDKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            TGGLLGLFDK ++MA L+ NW +MD+HESVPR+DGTGKMF
Sbjct  79   TGGLLGLFDKVDQMAPLLKNWSRMDVHESVPRKDGTGKMF  118



>gb|KHG12264.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Gossypium 
arboreum]
Length=333

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = -3

Query  530  AKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIH  351
            AKGLGYA+NTSEELKFVKE+A  TGV+LDPVYSGKAAYGMMKDM ENPKKWEGRK+LF+H
Sbjct  234  AKGLGYAINTSEELKFVKEVAAATGVVLDPVYSGKAAYGMMKDMAENPKKWEGRKVLFVH  293

Query  350  TGGLLGLFDKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            TGGLLGLFDK ++MA LVGNW++MD++ES+PR++G GKMF
Sbjct  294  TGGLLGLFDKVDQMAPLVGNWQRMDVNESIPRKEGIGKMF  333



>ref|XP_008898732.1| hypothetical protein PPTG_06545 [Phytophthora parasitica INRA-310]
 gb|ETI31124.1| hypothetical protein F443_21848 [Phytophthora parasitica P1569]
 gb|ETK71508.1| hypothetical protein L915_21243 [Phytophthora parasitica]
 gb|ETL24952.1| hypothetical protein L916_21110 [Phytophthora parasitica]
 gb|ETM31430.1| hypothetical protein L914_20985 [Phytophthora parasitica]
 gb|ETN16401.1| hypothetical protein PPTG_06545 [Phytophthora parasitica INRA-310]
 gb|ETP00943.1| hypothetical protein F441_21730 [Phytophthora parasitica CJ01A1]
 gb|ETP29080.1| hypothetical protein F442_21709 [Phytophthora parasitica P10297]
Length=370

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 130/202 (64%), Gaps = 16/202 (8%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EGR PY IPVGGSN LGTWGYI+AI EI  QL++  F+    DI  ACGSGGT AG+
Sbjct  160  LRKEGRHPYAIPVGGSNGLGTWGYIQAIDEINNQLKE--FDATITDIAFACGSGGTAAGI  217

Query  680  SIGSWLSG-----------LKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDIV  543
             +GS+L              K  VHA  VCD+ EYF+ ++ G +    G  + +SS   +
Sbjct  218  GLGSYLYAKAHPSAPLNFAAKIPVHAYIVCDNDEYFHGHIDGQILPAMGAPSDMSSRQFL  277

Query  542  SIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKI  363
             I NA+G GYA +T +EL+F+  ++  TGV++DPVYSGKA + +++++ E P+K+ G  I
Sbjct  278  QITNAQGTGYARSTKKELEFIYSVSRKTGVLMDPVYSGKALFHLIRELNEAPEKFVGTNI  337

Query  362  LFIHTGGLLGLFDKSEEMASLV  297
            LF+HTGG  G++DK + +  ++
Sbjct  338  LFVHTGGQFGMYDKVDALQEVI  359



>gb|ETO59840.1| hypothetical protein F444_21871 [Phytophthora parasitica P1976]
Length=370

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 130/202 (64%), Gaps = 16/202 (8%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EGR PY IPVGGSN LGTWGYI+AI EI  QL++  F+    DI  ACGSGGT AG+
Sbjct  160  LRKEGRHPYAIPVGGSNGLGTWGYIQAIDEINNQLKE--FDATITDIAFACGSGGTAAGI  217

Query  680  SIGSWLSG-----------LKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDIV  543
             +GS+L              K  VHA  VCD+ EYF+ ++ G +    G  + +SS   +
Sbjct  218  GLGSYLYAKAHPSAPLNFAAKIPVHAYIVCDNDEYFHGHIDGQILPAMGAPSDMSSRQFL  277

Query  542  SIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKI  363
             I NA+G GYA +T +EL+F+  ++  TGV++DPVYSGKA + +++++ E P+K+ G  I
Sbjct  278  QITNAQGTGYARSTKKELEFIYSVSRKTGVLMDPVYSGKALFHLIRELNEAPEKFVGTNI  337

Query  362  LFIHTGGLLGLFDKSEEMASLV  297
            LF+HTGG  G++DK + +  ++
Sbjct  338  LFVHTGGQFGMYDKVDALQEVI  359



>gb|ETL78167.1| hypothetical protein L917_20968 [Phytophthora parasitica]
Length=370

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 130/202 (64%), Gaps = 16/202 (8%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EGR PY IPVGGSN LGTWGYI+AI EI  QL++  F+    DI  ACGSGGT AG+
Sbjct  160  LRKEGRHPYAIPVGGSNGLGTWGYIQAIDEINNQLKE--FDATITDIAFACGSGGTAAGI  217

Query  680  SIGSWLSG-----------LKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDIV  543
             +GS+L              K  VHA  VCD+ EYF+ ++ G +    G  + +SS   +
Sbjct  218  GLGSYLYAKAHPSAPLNFAAKIPVHAYIVCDNDEYFHGHIDGQILPAMGAPSDMSSRQFL  277

Query  542  SIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKI  363
             I NA+G GYA +T +EL+F+  ++  TGV++DPVYSGKA + +++++ E P+K+ G  I
Sbjct  278  QITNAQGTGYARSTKKELEFIYSVSRKTGVLMDPVYSGKALFHLIRELNEAPEKFVGTNI  337

Query  362  LFIHTGGLLGLFDKSEEMASLV  297
            LF+HTGG  G++DK + +  ++
Sbjct  338  LFVHTGGQFGMYDKVDALQEVI  359



>ref|XP_009515993.1| hypothetical protein PHYSODRAFT_309478 [Phytophthora sojae]
 gb|EGZ28718.1| hypothetical protein PHYSODRAFT_309478 [Phytophthora sojae]
Length=370

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 132/202 (65%), Gaps = 16/202 (8%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EGR+PY IPVGGSN LGTWGYIEAI EI  QL++  ++    DI  ACGSGGT AG+
Sbjct  160  LKKEGRRPYAIPVGGSNGLGTWGYIEAIEEINSQLKE--YDLPVTDIAFACGSGGTAAGI  217

Query  680  SIGSWLSG-----------LKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDIV  543
             +G++L              K   HA  VCD+ EYF+ ++   +    G+ + ISS   +
Sbjct  218  GLGTYLYAKAHPNAALIFDTKIPAHAYIVCDNDEYFHGHIDNQILPAMGVPSDISSRQFL  277

Query  542  SIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKI  363
             I NA+G GYA +T +EL+F+  ++ +TGV++DPVYSGKA + +++++ E P+K+ G+ I
Sbjct  278  QITNAQGTGYARSTKKELEFIYSVSRSTGVLMDPVYSGKALFHLIRELNEAPEKFVGKNI  337

Query  362  LFIHTGGLLGLFDKSEEMASLV  297
            LF+HTGG  G++DK + +  ++
Sbjct  338  LFVHTGGQFGMYDKVDALQEVI  359



>ref|XP_002895266.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
 gb|EEY59031.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
Length=314

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 127/202 (63%), Gaps = 16/202 (8%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L +EGR+PY IPVGGSN LGTWGYI+AI EI  Q++D        DI  ACGSGGT  G+
Sbjct  104  LRNEGRRPYAIPVGGSNGLGTWGYIQAIDEINHQIKD--LNLPVTDIAFACGSGGTATGI  161

Query  680  SIGSWLSG-----------LKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDIV  543
             +GS+L              K   HA  VCD  EYF+ ++ G +    G  + I S   +
Sbjct  162  GLGSYLYAEAHPDAALNFDTKTPAHAYIVCDSDEYFHGHIDGQILPAMGAPSDILSRQFL  221

Query  542  SIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKI  363
             I NA+G GYA +T +EL+F+  ++  TGV++DPVYSGKA + +++++ E P+K+ G+ I
Sbjct  222  QITNAQGTGYARSTKKELEFIYSVSRKTGVLMDPVYSGKALFHLIRELNEAPEKFVGKTI  281

Query  362  LFIHTGGLLGLFDKSEEMASLV  297
            LF+HTGG  G+FDK + +  ++
Sbjct  282  LFVHTGGQFGMFDKVDALQEVI  303



>ref|XP_009840456.1| hypothetical protein H257_14374 [Aphanomyces astaci]
 gb|ETV70013.1| hypothetical protein H257_14374 [Aphanomyces astaci]
Length=407

 Score =   181 bits (458),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 134/202 (66%), Gaps = 20/202 (10%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GRKPY IPVGGSN LGTWGY+E+I E+E Q+++   E    DI  ACGSGG+ AG+
Sbjct  192  LRKQGRKPYGIPVGGSNGLGTWGYLESIEEMEHQIEE--LELPITDIAFACGSGGSAAGI  249

Query  680  SIGSWL-------SGLK------AKVHALCVCDDPEYFYEYV-QGLLDGLNAG----ISS  555
             +G++L       S L+        VHA  VCD P YFY+++ Q +L G+  G     SS
Sbjct  250  GVGAYLYAQAHQDSSLQFTRSELPPVHAYIVCDSPTYFYDHIDQVILPGMGLGTAPSFSS  309

Query  554  HDIVSIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWE  375
             D + + NA+GLGYA NT EEL ++  +A TTGV+LDPVYSGKA Y ++KD+ + P K+ 
Sbjct  310  RDCLQMTNAQGLGYAKNTKEELAYISLVARTTGVLLDPVYSGKALYMLVKDLQDAPHKFT  369

Query  374  GRKILFIHTGGLLGLFDKSEEM  309
            G+ ILF+HTGG  GLFDK  E+
Sbjct  370  GKSILFVHTGGQFGLFDKVAEL  391



>ref|XP_002906856.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
 gb|EEY66257.1| D-cysteine desulfhydrase, putative [Phytophthora infestans T30-4]
Length=370

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 127/202 (63%), Gaps = 16/202 (8%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L +EGR+PY IPVGGSN LGTWGYI+AI EI  Q++D        DI  ACGSGGT  G+
Sbjct  160  LRNEGRRPYAIPVGGSNGLGTWGYIQAIDEINHQIKD--LNLPVTDIAFACGSGGTATGI  217

Query  680  SIGSWLSG-----------LKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDIV  543
             +GS+L              K   HA  VCD  EYF+ ++ G +    G  + I S   +
Sbjct  218  GLGSYLYAEAHPDAALNFDTKTPAHAYIVCDSDEYFHGHIDGQILPAMGAPSDILSRQFL  277

Query  542  SIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKI  363
             I NA+G GYA +T +EL+F+  ++  TGV++DPVYSGKA + +++++ E P+K+ G+ I
Sbjct  278  QITNAQGTGYARSTKKELEFIYSVSRKTGVLMDPVYSGKALFHLIRELNEAPEKFVGKTI  337

Query  362  LFIHTGGLLGLFDKSEEMASLV  297
            LF+HTGG  G+FDK + +  ++
Sbjct  338  LFVHTGGQFGMFDKVDALQEVI  359



>ref|XP_011409801.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Amphimedon 
queenslandica]
Length=380

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G  PY I +GGSN LG WGY+E  +E+ QQ       ++FDDIV+A GSGGT AG+
Sbjct  181  LRSKGHNPYPITIGGSNLLGIWGYLECYQELVQQ----GVLERFDDIVMAIGSGGTAAGI  236

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLD--GLNAGISSHDIVS-IQNAKGLGYA  510
            +I ++ +G K KVHA+CVCD+ EYFY+++   +   GLN G+S+ +I++ I   KG GYA
Sbjct  237  AIANYFNGSKIKVHAVCVCDNAEYFYKFIDDHIQMFGLN-GVSAREIINLIDGYKGRGYA  295

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            ++T EELK + EI+ +TG++LD VY+ KA+ GM+++  +NP++++GRKILF+HTGG+  +
Sbjct  296  LSTEEELKRLVEISTSTGIVLDRVYTLKASIGMIEETKKNPQQFQGRKILFLHTGGIHSV  355

Query  329  FD  324
            FD
Sbjct  356  FD  357



>ref|XP_002109431.1| hypothetical protein TRIADDRAFT_53453 [Trichoplax adhaerens]
 gb|EDV27597.1| hypothetical protein TRIADDRAFT_53453 [Trichoplax adhaerens]
Length=383

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 125/178 (70%), Gaps = 7/178 (4%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G + Y+IP+GGSN +G +GYIE  RE+ +Q       + FDDIVV CGSGG+  GL++ +
Sbjct  178  GDECYLIPIGGSNVIGLFGYIECFRELVEQ----GLYENFDDIVVTCGSGGSTCGLALSN  233

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAG--ISSHDIVSIQNA-KGLGYAMNTS  498
            +L+G K K+HALC+C D  YFY+++   L  L     + + DIV I +   GLGY ++T 
Sbjct  234  YLTGSKVKMHALCICSDANYFYQHIDETLQQLKLSDQVKARDIVDIIDGYAGLGYGLSTE  293

Query  497  EELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            +E+KF  +++++TG+ILDPVY+ KA  GM+ ++  NP++++GR+IL+IHTGG+ G +D
Sbjct  294  DEMKFAYDVSKSTGIILDPVYNTKAVKGMLHELEHNPERFQGRRILYIHTGGIFGAYD  351



>gb|KEH21437.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Medicago 
truncatula]
Length=295

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+++GR+PYVIPVGGSNSLGTWGY+EA+REIE Q+Q      KFDDIVVACGSGGTIAGL
Sbjct  179  LINQGRRPYVIPVGGSNSLGTWGYLEAVREIELQIQSGTSNVKFDDIVVACGSGGTIAGL  238

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQN  531
            ++GS LS LKA+VHA  VCDDP+YF+ +VQGLLDGL AG+SS DIV IQN
Sbjct  239  ALGSSLSTLKARVHAFSVCDDPDYFHNFVQGLLDGLKAGVSSRDIVHIQN  288



>ref|NP_001229618.1| uncharacterized protein LOC578025 [Strongylocentrotus purpuratus]
Length=378

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 136/213 (64%), Gaps = 22/213 (10%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G+K Y IP+GGSNS+G +GY+E  RE+ QQ      +++F DIV+  GS G++AGL+IG+
Sbjct  167  GKKAYPIPIGGSNSVGVFGYLECFRELLQQ----NVQERFSDIVITSGSSGSLAGLAIGN  222

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGL-------NAGISSHDIVSI-QNAKGLGY  513
            +L+G K ++H + +CDD +YF+  +  +L  L       ++G+ S DIV + +  +GLGY
Sbjct  223  YLTGSKLRIHGMAICDDAKYFHGEINKVLRELGMQEGQGSSGVRSEDIVDVVEGVRGLGY  282

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
             ++  EEL+ + ++A TTG+ +DPVY+GKA + +M+ M E P +++G KILFIHTGG+  
Sbjct  283  GLSQPEELECINQVARTTGIFVDPVYTGKATFHLMRLMKEEPDRFQGSKILFIHTGGVFD  342

Query  332  LF--------DKSEEMASLVGNWRKMDIHESVP  258
            LF        DK       V +W  M++ E  P
Sbjct  343  LFSGAMGSMADKRTSSEKKVYDW--MEMTEKTP  373



>ref|XP_002121189.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Ciona intestinalis]
Length=391

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 127/179 (71%), Gaps = 6/179 (3%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G     IPVGGSNS+G +GYIEA +E+E Q   T     FDD+V+ACGSGG+IAGL+IG+
Sbjct  191  GNPVCCIPVGGSNSIGVFGYIEAWKEMEHQNVCT----DFDDVVIACGSGGSIAGLAIGN  246

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSIQNA-KGLGYAMNTSE  495
            +L+G K K+HA+ VCDD  +F+E+V  +L+ L  +G  S D+V I +  KG GY + T +
Sbjct  247  YLTGQKIKLHAVSVCDDKYFFHEHVNQMLNELGISGAQSEDLVDIIDGYKGEGYGLTTKQ  306

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKS  318
            + +F+  IA TTG++ DPVY+GKA  GM+ ++   P +++G ++L+IHTGG+ GLFD +
Sbjct  307  DHEFLHNIASTTGILCDPVYTGKAVKGMITELNNTPGRFKGSRVLYIHTGGVFGLFDST  365



>emb|CAN60273.1| hypothetical protein VITISV_024840 [Vitis vinifera]
Length=236

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  794  GYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLSGLKAKVHALCVCDDP  615
            GYIEAIREIEQQL     E  FDDIVVACGSG TIAGLS+GS LS L  KVHA  VCDDP
Sbjct  108  GYIEAIREIEQQLPTGTDEVGFDDIVVACGSGATIAGLSLGSSLSKLNTKVHAFSVCDDP  167

Query  614  EYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVY  435
            +YFY+YVQ LLDGL AG+ SHDIV IQNAKGLGYA+NT+EEL F+KE+A +TGV+LDPVY
Sbjct  168  DYFYDYVQDLLDGLQAGVRSHDIVDIQNAKGLGYAINTTEELNFLKEVAVSTGVVLDPVY  227



>ref|XP_002591482.1| hypothetical protein BRAFLDRAFT_105254 [Branchiostoma floridae]
 gb|EEN47493.1| hypothetical protein BRAFLDRAFT_105254 [Branchiostoma floridae]
Length=324

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 124/177 (70%), Gaps = 6/177 (3%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G++ Y+IPVGGSN  G +GYI A +E+ +Q       ++FDD+VV  GSGGT  GL + +
Sbjct  121  GKESYLIPVGGSNLAGLFGYITAFQELMEQ----GVLERFDDLVVTVGSGGTTCGLCVAN  176

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSI-QNAKGLGYAMNTSE  495
            +L+G K ++HA+ +CDD  YF+ ++   L  +    + S DIV I +  KG GYA++T +
Sbjct  177  YLTGSKIRIHAVAICDDAAYFHRHINNTLQEIGLMDVRSEDIVDIIEGYKGRGYALSTKK  236

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            EL+FV  IA T+G+ILDPVY+GKAA G+++++  N  +++G +ILF+HTGG+ GL+D
Sbjct  237  ELEFVANIAHTSGIILDPVYTGKAAIGLLQELRTNQSRFQGNRILFLHTGGIFGLYD  293



>ref|XP_011424022.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X2 [Crassostrea gigas]
Length=373

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 129/207 (62%), Gaps = 19/207 (9%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G + Y+IPVGGSN++G +G++    +I+  + D        DIVV CGSGGT AGL I +
Sbjct  172  GEESYLIPVGGSNTIGVFGFLTVFDDIQSSISDIT------DIVVTCGSGGTAAGLCIAN  225

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSI-QNAKGLGYAMNTSE  495
             L+G K KVHA+ VCDD +YF+++V   L  L    + S +I+ I +  KG GY ++T +
Sbjct  226  HLTGSKVKVHAVIVCDDAKYFHDHVNETLTELGLTDVRSEEILDIIEGYKGRGYGLSTQD  285

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD---  324
            EL+F+  I  TTGV+LDP Y+GKA  G++ ++  NP +++G KILFIHTGG  GLFD   
Sbjct  286  ELEFIMNIGATTGVVLDPTYTGKAVRGLVSELNNNPSRFKGNKILFIHTGGTYGLFDGRI  345

Query  323  ------KSEEMASLVGNWRKMDIHESV  261
                  +    +S+V  WR  D  ES+
Sbjct  346  NDLLKQRKTANSSMVQMWR--DKRESI  370



>ref|XP_011424021.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like isoform 
X1 [Crassostrea gigas]
Length=388

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 129/207 (62%), Gaps = 19/207 (9%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G + Y+IPVGGSN++G +G++    +I+  + D        DIVV CGSGGT AGL I +
Sbjct  187  GEESYLIPVGGSNTIGVFGFLTVFDDIQSSISD------ITDIVVTCGSGGTAAGLCIAN  240

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSI-QNAKGLGYAMNTSE  495
             L+G K KVHA+ VCDD +YF+++V   L  L    + S +I+ I +  KG GY ++T +
Sbjct  241  HLTGSKVKVHAVIVCDDAKYFHDHVNETLTELGLTDVRSEEILDIIEGYKGRGYGLSTQD  300

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD---  324
            EL+F+  I  TTGV+LDP Y+GKA  G++ ++  NP +++G KILFIHTGG  GLFD   
Sbjct  301  ELEFIMNIGATTGVVLDPTYTGKAVRGLVSELNNNPSRFKGNKILFIHTGGTYGLFDGRI  360

Query  323  ------KSEEMASLVGNWRKMDIHESV  261
                  +    +S+V  WR  D  ES+
Sbjct  361  NDLLKQRKTANSSMVQMWR--DKRESI  385



>ref|XP_008789210.1| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
[Phoenix dactylifera]
Length=93

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            MNTSEELKFVK+IAE TGV+LDPVYSGKA YGM+KDM+ NP+KW+GRK+LFIHTGGLLGL
Sbjct  1    MNTSEELKFVKDIAEATGVVLDPVYSGKATYGMLKDMSANPEKWKGRKVLFIHTGGLLGL  60

Query  329  FDKSEEMASLVGNWRKMDIHESVPRRDGTGKMF  231
            +DK+E+M S+VG WR+M+I ES+PR+DG GKMF
Sbjct  61   YDKAEQMTSMVGKWRRMEIDESIPRKDGAGKMF  93



>ref|XP_011667662.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
Length=264

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 130/213 (61%), Gaps = 21/213 (10%)
 Frame = -3

Query  845  RKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSW  666
            +K Y +P GGSN +G WGYIE  RE+  Q       ++F DIV+A GS G++ GL+I ++
Sbjct  53   KKAYRLPFGGSNEVGVWGYIECFRELMGQ----GLLERFTDIVIAAGSSGSVTGLAIANY  108

Query  665  LSGLKAKVHALCVCDDPEYFYEY------VQGLLDGLNAGISSHDIVSIQN-AKGLGYAM  507
            L+G K K+H    C D  +FY+         GL D    G+ + DI+ I++   G+GYA+
Sbjct  109  LTGSKLKIHGFAACKDQMFFYDLGDKTLQSLGLQDADGTGVKAVDIMHIRDEVVGIGYAV  168

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
            NTSEEL+ ++++A  TG+++DPVYSGKA Y ++K M E P  ++G++ILFIHTGG+  LF
Sbjct  169  NTSEELECIEQVAMNTGILVDPVYSGKATYHLLKLMNEKPGTFKGKQILFIHTGGVFDLF  228

Query  326  D--------KSEEMASLVGNWRKMDIHESVPRR  252
                     K     + V +W  MD+ + VP +
Sbjct  229  SGAVGSRLTKKGHKENKVYDW--MDLSDKVPDK  259



>gb|KDO27924.1| hypothetical protein SPRG_07198, partial [Saprolegnia parasitica 
CBS 223.65]
Length=390

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 136/206 (66%), Gaps = 18/206 (9%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GRKPY IPVGGSN +GTWGYIE+I E+E Q+Q    +    D+  ACGSGG+ AG+
Sbjct  179  LRAQGRKPYGIPVGGSNGVGTWGYIESIEEMEHQIQH--LKLGVTDVAFACGSGGSAAGI  236

Query  680  SIGSWL-------SGL----KAKVHALCVCDDPEYFYEYVQGLL---DGLNAG-ISSHDI  546
              G++L       S L    K  VH+  VCD P YFY+Y+   +    GL +G   S D 
Sbjct  237  GAGAFLYAKHHPSSALQFHTKPPVHSYIVCDSPTYFYDYIDTKILPHMGLASGSFGSRDF  296

Query  545  VSIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRK  366
            + + NA G+GYA++T +EL ++  +A  TGV+LDPVYSGKA Y ++KD+  +P+K+ G+ 
Sbjct  297  LQMTNAMGVGYALSTQDELAYISRVARDTGVLLDPVYSGKALYLLVKDLQSHPEKFAGKT  356

Query  365  ILFIHTGGLLGLFDKSEEM-ASLVGN  291
            ILF+HTGG+ GLFDK+ E+ A+ +G 
Sbjct  357  ILFVHTGGMFGLFDKASELDAAAIGT  382



>ref|XP_006823418.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Saccoglossus kowalevskii]
Length=398

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 133/207 (64%), Gaps = 21/207 (10%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQ--LQDTAFEQKFDDIVVACGSGGTIAGLSI  675
            G K Y + VGGS   G +GYIE  RE+ +Q  L+D      FDD+V   GSGGT AGL+I
Sbjct  194  GGKSYPMEVGGSTITGLFGYIEGFRELMRQNVLED------FDDLVFTIGSGGTAAGLAI  247

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLD--GLNAGISSHDIVS-IQNAKGLGYAMN  504
            G++L+G K K HA  VCD+  YF+ +V   L   GL+  + S DI+  I+ AKG GY ++
Sbjct  248  GNYLTGSKLKCHAFAVCDNSTYFHGHVNATLAAAGLSQQVKSEDILDVIEGAKGRGYGLS  307

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            T EEL+F+ +++ TTG+++DPVY+GKA   +++++  NP +++G++ILF+HTGGL GLFD
Sbjct  308  TDEELEFILKVSTTTGIMIDPVYTGKATKALVEELNNNPSRFKGKRILFVHTGGLFGLFD  367

Query  323  --------KSEEMASLVGNWRKMDIHE  267
                    K+    + V NW  MD  E
Sbjct  368  GRINNLLKKTGSPTNRVYNW--MDSEE  392



>ref|XP_002184089.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44267.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=327

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 120/193 (62%), Gaps = 23/193 (12%)
 Frame = -3

Query  839  PYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLS  660
            PY IPVGGSN++GTWGYI A+ E+  QLQD       D IV ACGSGGT AG+S+G  L+
Sbjct  134  PYSIPVGGSNAIGTWGYINAVDELMSQLQDINL--PLDYIVFACGSGGTAAGISLGVALA  191

Query  659  GLKA-----------KVHALCVCDDPEYFYEYVQGLLD-----GLNAGISSHDIV----S  540
              +A           KV A+ VCDDP+YFY +V  + D      L+ G+S+   V    +
Sbjct  192  -FQALSRQSAALTIPKVMAVGVCDDPDYFYHHVASIADQMGLQNLSGGMSTEAFVRQNMN  250

Query  539  IQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKIL  360
            +   KG GYA++T EEL+F    A  TG++LDPVYSGKA +  ++ M E+P  +  + IL
Sbjct  251  VLQGKGCGYAISTPEELEFAAHFARDTGIVLDPVYSGKALFAFVRLMEEDPACFRDKNIL  310

Query  359  FIHTGGLLGLFDK  321
            F HTGG LGL+DK
Sbjct  311  FWHTGGALGLYDK  323



>ref|XP_011399663.1| Putative 1-aminocyclopropane-1-carboxylate deaminase, partial 
[Auxenochlorella protothecoides]
 gb|KFM26725.1| Putative 1-aminocyclopropane-1-carboxylate deaminase, partial 
[Auxenochlorella protothecoides]
Length=399

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 124/218 (57%), Gaps = 41/218 (19%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G  PYVIPVGGSN LGTWGY+  + E+  Q  D        DIV+ACGSG T AG+++G
Sbjct  169  QGANPYVIPVGGSNGLGTWGYLSFVEELRGQAADLGLT----DIVLACGSGSTAAGIALG  224

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGL-----NAGISSHDIVS-----------  540
            S L+GL  +VH   VCD  +YFY ++  LLD +       G  + D++            
Sbjct  225  SHLAGLGVRVHGYAVCDSEDYFYAFIDDLLDQVAPAEARGGAGARDLIRCLLGCGPCPPT  284

Query  539  ---------------IQNAKGLGYAMNTSEELKFVKEIAETTG------VILDPVYSGKA  423
                           I  AKG+GY ++T EEL  V + A+ TG      +ILDPVY+ KA
Sbjct  285  FTLVPPPLPARPSCRIAEAKGVGYGISTDEELATVLDAAQATGEAPWEGIILDPVYTCKA  344

Query  422  AYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEM  309
             +G + D+  +P  W  R++LF+HTGGLLG++DK+E++
Sbjct  345  LHGWLADVAADPAAWAQRRVLFVHTGGLLGMYDKAEQL  382



>ref|XP_782004.3| PREDICTED: putative D-cysteine desulfhydrase 1, mitochondrial 
isoform X1 [Strongylocentrotus purpuratus]
Length=378

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (66%), Gaps = 12/182 (7%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G+K Y IP+GGSN +G WGYI+   E+ +Q       ++F DIVVA GS G++ GL+IG+
Sbjct  169  GKKCYSIPLGGSNCVGVWGYIDCFNELMKQ----GLHERFTDIVVASGSTGSVTGLAIGN  224

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGL-------NAGISSHDIVSI-QNAKGLGY  513
             L+G K KVH + V  D  YF+E    +L  L       ++G+ + DI+ I +  KG+GY
Sbjct  225  HLTGNKVKVHGMAVISDAAYFHEEADAILRDLGLQASDGSSGVKAADIMDIVEGVKGIGY  284

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
             ++T EEL+ ++E+A TTG+++DP Y+GKA Y  MK M ENP ++ G+KILFIHTGG   
Sbjct  285  GLSTPEELECIQEVATTTGILVDPCYTGKATYHTMKLMRENPDRFIGKKILFIHTGGWFD  344

Query  332  LF  327
            LF
Sbjct  345  LF  346



>ref|XP_001637312.1| predicted protein [Nematostella vectensis]
 gb|EDO45249.1| predicted protein [Nematostella vectensis]
Length=364

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 125/181 (69%), Gaps = 6/181 (3%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G+ PYVIP+GGSN +G +GYI A  E+ +Q        +FDD+V+  GS GT AG+
Sbjct  159  LRQQGKSPYVIPLGGSNEIGLFGYITAFHELTKQ----NVLDEFDDMVMCVGSSGTAAGI  214

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSI-QNAKGLGYAM  507
            +IG++L+G K K HA+ VCDD  +FY+ V   L  +    + + DI+ I +  KG GYA+
Sbjct  215  AIGNYLTGNKLKCHAVNVCDDAAFFYKCVNEELVSVGLTDVHAEDILDIIEGYKGKGYAV  274

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
            +T+EEL+ +  I+ TTG++LDPVY+ K+  GM+ +M  NP +++G+++L+IHTGG+ GLF
Sbjct  275  STTEELEDIVRISSTTGIMLDPVYTIKSVRGMLAEMKNNPSRFKGKRVLYIHTGGVFGLF  334

Query  326  D  324
            D
Sbjct  335  D  335



>ref|XP_002505216.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66474.1| predicted protein [Micromonas sp. RCC299]
Length=360

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 136/201 (68%), Gaps = 13/201 (6%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG++PYV+PVGGSN++GTWGY++A+ E+  Q+ +      F DIV+ACGSGGT AG+
Sbjct  162  LEREGKRPYVVPVGGSNAIGTWGYVDAMAELAAQMGED-HPHPFTDIVLACGSGGTAAGV  220

Query  680  SIGSWLSG--LKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAM  507
            ++G+ L     +  V A  VCD P+YFYEYV G+L  + A +   DI     AKG GYAM
Sbjct  221  ALGAALCPELRRPNVWAYGVCDTPKYFYEYVGGILRDMGAPVK--DI-----AKGAGYAM  273

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
             T EEL     IA  TGV+LDPVYSGKAA+G++++M  +P  W+GR++LF+HTGG LG++
Sbjct  274  ATEEELATTAAIARATGVLLDPVYSGKAAHGLIREMARDPGAWQGRRVLFVHTGGALGVY  333

Query  326  DKSEEMASLV---GNWRKMDI  273
            DK  ++  ++      R+ D+
Sbjct  334  DKLAQLQPIMEATAPSRRFDV  354



>gb|EKC20722.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Crassostrea 
gigas]
Length=2239

 Score =   173 bits (438),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 83/177 (47%), Positives = 118/177 (67%), Gaps = 8/177 (5%)
 Frame = -3

Query  848   GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
             G + Y+IPVGGSN++G +G++    +I+  + D        DIVV CGSGGT AGL I +
Sbjct  2042  GEESYLIPVGGSNTIGVFGFLTVFDDIQSSISDIT------DIVVTCGSGGTAAGLCIAN  2095

Query  668   WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSI-QNAKGLGYAMNTSE  495
              L+G K KVHA+ VCDD +YF+++V   L  L    + S +I+ I +  KG GY ++T +
Sbjct  2096  HLTGSKVKVHAVIVCDDAKYFHDHVNETLTELGLTDVRSEEILDIIEGYKGRGYGLSTQD  2155

Query  494   ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
             EL+F+  I  TTGV+LDP Y+GKA  G++ ++  NP +++G KILFIHTGG  GLFD
Sbjct  2156  ELEFIMNIGATTGVVLDPTYTGKAVRGLVSELNNNPSRFKGNKILFIHTGGTYGLFD  2212



>ref|XP_008604210.1| hypothetical protein SDRG_00508 [Saprolegnia diclina VS20]
 gb|EQC42787.1| hypothetical protein SDRG_00508 [Saprolegnia diclina VS20]
Length=377

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 130/199 (65%), Gaps = 17/199 (9%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GRKPY IPVGGSN +GTWGYIE+I E+E Q+Q    +    D+  ACGSGG+ AG+
Sbjct  166  LRAQGRKPYGIPVGGSNGVGTWGYIESIEEMEHQIQH--LKLGVTDVAFACGSGGSAAGI  223

Query  680  SIGSWL-------SGL----KAKVHALCVCDDPEYFYEYVQGLL---DGLNAG-ISSHDI  546
              G++L       S L    K  VH+  VCD P YFY+Y+   +    GL +G   S D 
Sbjct  224  GAGAFLYAKHHPSSALQFHTKPPVHSYIVCDSPTYFYDYIDTKILPHMGLASGSFGSRDF  283

Query  545  VSIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRK  366
            + + NA G+GYA++T +EL ++  +A  TGV+LDPVYSGKA Y ++KD+   P+K+ G+ 
Sbjct  284  LQMTNAMGVGYALSTQDELAYISRVARDTGVLLDPVYSGKALYLLVKDLQSQPEKFAGKS  343

Query  365  ILFIHTGGLLGLFDKSEEM  309
            ILF+HTGG+ GL+DK  E+
Sbjct  344  ILFVHTGGMFGLYDKVSEL  362



>ref|XP_787534.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
 ref|XP_011664376.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
Length=384

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 130/213 (61%), Gaps = 21/213 (10%)
 Frame = -3

Query  845  RKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSW  666
            +K Y +P GGSN +G WGYIE  RE+  Q        +F DIV+A GS G++ GL+I ++
Sbjct  173  KKAYRLPFGGSNEVGVWGYIECFRELMGQ----GLLDRFTDIVIAAGSSGSVTGLAIANY  228

Query  665  LSGLKAKVHALCVCDDPEYFYEY------VQGLLDGLNAGISSHDIVSIQN-AKGLGYAM  507
            L+G K K+H    C D  +FY+         GL D   AG+ + DI+ I++   G+GYA+
Sbjct  229  LTGSKLKIHGFAACKDQMFFYDLGDKTLQSLGLQDADGAGVKAVDIMHIRDEVVGIGYAV  288

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
            NTSEEL+ ++++A  TG+++DPVYSGKA Y ++K M E P  ++G++ILFIHTGG+  LF
Sbjct  289  NTSEELECIEQVAMNTGILVDPVYSGKATYHLLKLMNEKPGTFKGKQILFIHTGGVFDLF  348

Query  326  D--------KSEEMASLVGNWRKMDIHESVPRR  252
                     K     + V +W  MD+ + VP +
Sbjct  349  SGAVGSRLTKKGHKENKVYDW--MDLSDKVPDK  379



>ref|XP_008877014.1| hypothetical protein H310_11927 [Aphanomyces invadans]
 gb|ETV94252.1| hypothetical protein H310_11927 [Aphanomyces invadans]
Length=411

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 127/198 (64%), Gaps = 23/198 (12%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +GRKPY IPVGGSN LGTWGY+E+I E+E Q +D        D+  ACGSGG+ AGL +G
Sbjct  197  QGRKPYGIPVGGSNGLGTWGYLESIEEMEHQFKD--LNITVTDVAFACGSGGSAAGLGVG  254

Query  671  SWL-------SGLK------AKVHALCVCDDPEYFYEYVQGLL--------DGLNAGISS  555
            ++L       S L+        VHA  VCD P+YFY++V   +           +   S+
Sbjct  255  AYLYAQTHQDSSLQFNRLASPPVHAYIVCDSPKYFYDHVDNKILPEMGFKVAAADRSFSA  314

Query  554  HDIVSIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWE  375
             D + + +A+G GYA +T +EL ++ ++A  TGV+LDPVYSGKA Y ++KD+ ++P K+ 
Sbjct  315  KDCLQMTDAQGAGYATSTKDELVYISQVARETGVLLDPVYSGKALYMLVKDLQDHPDKFA  374

Query  374  GRKILFIHTGGLLGLFDK  321
            G+ ILFIHTGG+ GL+DK
Sbjct  375  GKSILFIHTGGMFGLYDK  392



>ref|XP_004342345.1| Dcysteine desulfhydrase [Acanthamoeba castellanii str. Neff]
 gb|ELR20235.1| Dcysteine desulfhydrase [Acanthamoeba castellanii str. Neff]
Length=651

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 138/202 (68%), Gaps = 10/202 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG+KPY+IPVGGSN LG+WGY++A  E+  Q++D   E  FDDI+   GSGGT  GL
Sbjct  449  LEQEGKKPYLIPVGGSNELGSWGYMQATEELCHQMKDLNIE--FDDIITTIGSGGTTGGL  506

Query  680  SIGSWLSGLKA--KVHALCVCDDPEYFYEYVQGLLDGLNAG--ISSHDIVSIQNAK-GLG  516
            ++G  LSGL A  K+HA C CDD EYFY  +  L+  L  G    + D+VS+ +   GLG
Sbjct  507  ALGVALSGLSARTKLHAFCACDDDEYFYREIDQLITNLGLGDRFKARDLVSVNDKYVGLG  566

Query  515  YAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLL  336
            Y+++  EEL+ + ++A+ TGV++DP Y+GKA YG++ ++  +P+KW+G+K+LF+HTGGL 
Sbjct  567  YSISQKEELELIIKVAQHTGVVVDPTYTGKALYGLIHEIKADPEKWKGKKVLFLHTGGLY  626

Query  335  GLFDKSEEMASLVGNWRKMDIH  270
             ++ + ++++ L     K  IH
Sbjct  627  DIYSRLDQLSPLFA---KSQIH  645



>ref|XP_009053466.1| hypothetical protein LOTGIDRAFT_175080 [Lottia gigantea]
 gb|ESO95839.1| hypothetical protein LOTGIDRAFT_175080 [Lottia gigantea]
Length=383

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 127/191 (66%), Gaps = 20/191 (10%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
             G K Y+IPVGGSN LG +GYIE  RE+ +Q       +KFDDIV ACGSG T++G+++ 
Sbjct  171  RGEKSYIIPVGGSNELGIFGYIEVFREMIEQ----ESLEKFDDIVCACGSGTTLSGMAVA  226

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGL--LDGLNAGISSHDIVSIQNA-KGLGYAMNT  501
            ++L+G K K+H + VCD  +YF++    +  L GL + + S DIV+I +  KG GY ++T
Sbjct  227  NYLTGSKLKIHGITVCDSKKYFHDDNNEIFPLIGLKS-VQSEDIVNIIDGFKGQGYGLST  285

Query  500  SEEL------------KFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILF  357
             EEL             F+ E+   TG++LDPVY+GKAA+G+++ + + P+ ++GR+ILF
Sbjct  286  EEELGTIDRTYRDLSVDFLTEVGSKTGIMLDPVYTGKAAFGLVQLLEQLPEMFKGRRILF  345

Query  356  IHTGGLLGLFD  324
            IHTGG+ GL D
Sbjct  346  IHTGGIFGLAD  356



>ref|XP_796433.2| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
 ref|XP_011666977.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial [Strongylocentrotus 
purpuratus]
Length=379

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 114/185 (62%), Gaps = 10/185 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   G+K Y IP GG+N +G WGYI    E+  Q     FE  + DIV+A GSGG++ GL
Sbjct  166  LKTSGKKAYQIPFGGTNEIGVWGYIACFHELMGQ---GLFESNYTDIVIAGGSGGSVMGL  222

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLL--DGLNA-----GISSHDIVSIQNAKG  522
             I ++L+G K K+H +  C   EYF++    +L   GL A     G+ + DIV      G
Sbjct  223  GIANYLTGSKLKIHGMAACLTKEYFHDEGDKILRAHGLQAEDGSTGVKTADIVHFAEVVG  282

Query  521  LGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGG  342
            +GY MNT EE++ +++IA  TG+ +DPVYS KA Y ++K M E+P   +G+K+LFIHTGG
Sbjct  283  IGYGMNTPEEMECIEKIATKTGIFVDPVYSSKAVYNLIKMMNESPDTLKGKKVLFIHTGG  342

Query  341  LLGLF  327
            +  LF
Sbjct  343  VFDLF  347



>gb|ELT93489.1| hypothetical protein CAPTEDRAFT_123695 [Capitella teleta]
Length=362

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 111/170 (65%), Gaps = 6/170 (4%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G   Y++ VGGS+ +G +GY+EA  E+EQQ         FDDIV ACGSGGT  GL++ +
Sbjct  172  GEDSYLMEVGGSSDVGFYGYVEAFHELEQQ----GVLDSFDDIVFACGSGGTAEGLAVAN  227

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN-AGISSHDIVSI-QNAKGLGYAMNTSE  495
             L+G K +VH + VCDD  YF+ +   LL  +    I S DI++I + AKGLGY ++   
Sbjct  228  HLTGSKLRVHGVAVCDDAIYFHNHCNTLLAQVGLTDIRSEDILNIIEGAKGLGYGLSQQP  287

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTG  345
            EL FV EIA +TG++LDPVY+GKA  G +  +  N   ++G++IL+IHTG
Sbjct  288  ELDFVSEIAMSTGIVLDPVYTGKAVLGFLNQLKANSSVFKGKRILYIHTG  337



>ref|XP_002288615.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94051.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=412

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 114/193 (59%), Gaps = 14/193 (7%)
 Frame = -3

Query  845  RKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSW  666
            + PY IPVGGSN+LG+WGYI  + E+  Q+   + E   D +V A GSGGT AG+ +G  
Sbjct  192  QNPYAIPVGGSNALGSWGYINGVDELMAQMSSISSECTLDHVVFASGSGGTAAGIVLGLA  251

Query  665  LS-----GLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISS--------HDIVSIQNAK  525
            L+         KVHA+ VCD P YFY  +  + DG+   + S         + V +   K
Sbjct  252  LAHEHNGKTPPKVHAVGVCDSPSYFYNTITTMADGMGISLDSDTTTEQFVRNSVIVHQGK  311

Query  524  GLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTE-NPKKWEGRKILFIHT  348
            G GYA +T EEL F+   +  TG+ LDPVYSGKA Y  +K + E +P+ +  + ILF HT
Sbjct  312  GQGYASSTDEELDFILLFSLETGISLDPVYSGKALYHFLKKVVEDDPEAYRDKSILFWHT  371

Query  347  GGLLGLFDKSEEM  309
            GG LG++DK +++
Sbjct  372  GGALGIYDKGDDL  384



>gb|EJK45891.1| hypothetical protein THAOC_35476 [Thalassiosira oceanica]
Length=419

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 119/205 (58%), Gaps = 27/205 (13%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQ-----DTAFEQKFDDIVVACGSGGTIAG  684
            G  P  IPVGGSN+LGTWGYI A+ E+  QL+     D+ F   F  +V A GSGGT AG
Sbjct  185  GFNPNAIPVGGSNALGTWGYISAVEELMHQLETIQSDDSDF--NFGHVVFATGSGGTAAG  242

Query  683  LSIG-SWLSGLKAK----------VHALCVCDDPEYFYEYVQGLLDGLNAGISSHD----  549
            +++G S   G  A            H + VCD P+YFY  +  + D +     SH     
Sbjct  243  IALGLSLAHGADAHPAAEGKEAPTCHGIGVCDSPDYFYTTIASIADAMGLKKMSHSSTED  302

Query  548  ----IVSIQNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMM-KDMTENPK  384
                I+ + + KG GYA+++ EEL+F+ + A  TG+ LDPVYSGKA Y  M K + E P+
Sbjct  303  FIRSIIKVHHGKGRGYAVSSDEELRFISQFAVDTGICLDPVYSGKALYHFMTKVLEEEPE  362

Query  383  KWEGRKILFIHTGGLLGLFDKSEEM  309
            K+ G+KILF HTGG LG ++K  ++
Sbjct  363  KYRGQKILFWHTGGALGTYEKGNDL  387



>ref|XP_002735695.1| PREDICTED: probable 1-aminocyclopropane-1-carboxylate deaminase-like 
[Saccoglossus kowalevskii]
Length=340

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 116/177 (66%), Gaps = 8/177 (5%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G +PYVIPVGGS+  G +GY+    E+ QQ       +K+ DIV+ CG+  T   ++I +
Sbjct  131  GDEPYVIPVGGSSYPGLFGYVNCFAEMMQQ----GVLEKYTDIVITCGTAVTTGAIAISN  186

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLD--GLNAGISSHDIVS-IQNAKGLGYAMNTS  498
            +L+G K ++H+  +     + Y YVQ  +D  GL+ G+ + D+VS   +  G GY  NT 
Sbjct  187  YLTGSKLRIHSFSIKRPLSFIYGYVQECIDLAGLD-GVKAEDLVSACVDYIGEGYGKNTE  245

Query  497  EELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
            +EL F++  A+TTG++LDPVY+GKAA G +++M  NP +++G+K+LF+H+GG+  ++
Sbjct  246  QELDFIRNAADTTGIVLDPVYTGKAARGAVEEMKNNPGRFKGKKVLFLHSGGVFSIY  302



>ref|WP_011989078.1| D-cysteine desulfhydrase [Clostridium kluyveri]
 gb|EDK32563.1| Predicted pyridoxal-phosphate dependent deaminase [Clostridium 
kluyveri DSM 555]
 dbj|BAH05497.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
Length=329

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = -3

Query  854  HEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
            ++G KPY+IP G SN +G +GY +A++EI   LQ+   +  FD IV+A GSGGT +GL +
Sbjct  143  NKGLKPYIIPEGASNGIGGFGYYKAVQEI--MLQEREMKVHFDGIVIATGSGGTYSGLLL  200

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG------LNAGISSHDIVSIQNAKGLGY  513
            GS +    AK++ + VC + +YF + +  +L        +N   S  +I  I    G GY
Sbjct  201  GSRILNYDAKIYGVNVCQNEKYFKDRIYEILHDSMKYIDVNLNFSKDEINIIDGYVGRGY  260

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            A++  EEL+F+KE+AE  G+ILDPVY+GKA YG+ +++ +  K  + + +LFIHTGG+ G
Sbjct  261  ALSREEELEFIKELAELEGIILDPVYTGKAMYGLTQEIKKG-KFSKYKNLLFIHTGGIFG  319

Query  332  LFDKSEEM  309
            +F +  + 
Sbjct  320  IFPQKSQF  327



>ref|WP_017417108.1| hypothetical protein [Clostridium tunisiense]
Length=329

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 9/185 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G KPY+IP G SN +GT+GY  A+ EI  Q +D      FD I+VA GSGGT AGL + 
Sbjct  144  QGFKPYIIPEGASNGIGTFGYFNAMEEILNQEKDMNIH--FDKIIVAVGSGGTHAGLLLS  201

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGLGYA  510
              + G   +++ + VCD+ +YF   +  +LD       ++   +  +I  I    G GYA
Sbjct  202  KKILGFHGEIYGINVCDNEDYFKNRIHNILDESINYLNIDLNFNLDEIHIIDGYVGRGYA  261

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            ++T E L+F+  IA+  G+ILDPVY+GKA YG+ K++ +   K +   ILFIHTGGL GL
Sbjct  262  LSTPETLEFILHIAQLEGLILDPVYTGKAMYGLSKEIKKGTFKKD-ENILFIHTGGLFGL  320

Query  329  FDKSE  315
            + + +
Sbjct  321  YPQRD  325



>ref|XP_001630447.1| predicted protein [Nematostella vectensis]
 gb|EDO38384.1| predicted protein [Nematostella vectensis]
Length=370

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 119/179 (66%), Gaps = 8/179 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EG+  Y+IPVGGS  +  + Y+    E+  Q       +++ D+V+  GSGGT +G++I 
Sbjct  169  EGKSVYIIPVGGSCYVAMFAYMMTFNELINQ----GVLEEYTDVVMTTGSGGTASGMAIA  224

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD--GLNAGISSHDIVSIQNA-KGLGYAMNT  501
            ++L+G K KVH + V    E  ++++Q  LD  GLN  +++ DI+ I +  KGLGY ++T
Sbjct  225  NYLTGSKLKVHCVSVRRSIENLHQHIQEDLDQAGLNH-VNAADIIDIMDEHKGLGYGIST  283

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
             EEL+ V EI  TTG+ +DPVY+ K+  GM+ +M +NP +++G+K+L++HTGG+ GLF+
Sbjct  284  QEELEHVIEIGCTTGITVDPVYTVKSVRGMLAEMRDNPSRFKGKKVLYMHTGGMFGLFE  342



>ref|WP_005982040.1| D-cysteine desulfhydrase [Fusobacterium ulcerans]
 gb|EFS25271.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Fusobacterium ulcerans ATCC 49185]
Length=328

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 111/184 (60%), Gaps = 9/184 (5%)
 Frame = -3

Query  842  KPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWL  663
            K Y+IP G SN +GT+GY++ ++EIE+Q ++      FD I+ A GSGGT  GL +G+ L
Sbjct  146  KAYIIPEGASNGIGTFGYLKCMKEIEEQEKELGI--TFDTILSAVGSGGTYGGLFLGNKL  203

Query  662  SGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGLGYAMNT  501
             GL+ KV  + VCDD E+F   V+ ++D      G     S  ++  I    G GYA++ 
Sbjct  204  FGLEKKVVGVNVCDDAEFFKNKVKNIVDESLEYLGEKLEFSKDEMCIIDGYVGRGYALSR  263

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDK  321
             EEL+F+ ++    G+ILDPVY+GK  YG   ++ +   K + + ILFIHTGG  GLF K
Sbjct  264  PEELEFIAKLGREEGIILDPVYTGKTMYGFYNEVKKGNLK-DCKNILFIHTGGFFGLFPK  322

Query  320  SEEM  309
             EE 
Sbjct  323  QEEF  326



>ref|WP_029482059.1| cysteine desulfhydrase [Clostridiales bacterium VE202-18]
Length=325

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 112/185 (61%), Gaps = 7/185 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G KPY+IP+G SN +GT GY+EA  EI +Q  + A + +FD I+ A GSGGT AGL IG
Sbjct  143  KGYKPYIIPMGASNGIGTLGYVEAFTEILKQ--EEAMKVEFDTIINAVGSGGTYAGLYIG  200

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG----LNAGISSHDIVSIQNAKGLGYAMN  504
            + L+  K ++    VCDD EYF + +  ++       +  I +  I  I    G GYA++
Sbjct  201  NELNRTKKQIIGFNVCDDKEYFIKEITKIIKEAQVYFDQEIKTERIKIIDGYVGQGYALS  260

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
             SEEL  +  +A+   V+LDPVY+GKA YG++ ++ E     +   ILF+HTGG+ GLF 
Sbjct  261  RSEELDAIASLAKLEAVVLDPVYTGKAYYGLINEL-EKGTFVDSENILFMHTGGIFGLFP  319

Query  323  KSEEM  309
            K  + 
Sbjct  320  KQSQF  324



>ref|WP_008792520.1| D-cysteine desulfhydrase [Coprobacillus sp. 8_2_54BFAA]
 gb|EHQ45671.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Coprobacillus sp. 8_2_54BFAA]
Length=325

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 112/185 (61%), Gaps = 7/185 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G KPY+IP+G SN +GT GY+EA  EI +Q  + A + +FD I+ A GSGGT AGL IG
Sbjct  143  KGYKPYIIPMGASNGIGTLGYVEAFTEILKQ--EEAMKVEFDTIINAVGSGGTYAGLYIG  200

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG----LNAGISSHDIVSIQNAKGLGYAMN  504
            + L+  K ++    VCDD EYF + +  ++       +  I +  I  I    G GYA++
Sbjct  201  NELNRTKKQIIGFNVCDDKEYFIKEITKIIKEAQVYFDQEIKTERIKIIDGYVGQGYALS  260

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
             SEEL  +  +A+   V+LDPVY+GKA YG++ ++ E     +   ILF+HTGG+ GLF 
Sbjct  261  RSEELDAIASLAKLEAVVLDPVYTGKAYYGLINEL-EKGTFVDSENILFMHTGGIFGLFP  319

Query  323  KSEEM  309
            K  + 
Sbjct  320  KQSQF  324



>ref|XP_001630448.1| predicted protein [Nematostella vectensis]
 gb|EDO38385.1| predicted protein [Nematostella vectensis]
Length=370

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 119/179 (66%), Gaps = 8/179 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EG+  Y+IP GGS  +  + Y+    E+  Q       +++ D+V+  GSGGT +G++I 
Sbjct  169  EGKSVYIIPAGGSCYVAMFAYMMTFNELINQ----GVLEEYTDVVMTTGSGGTASGMAIA  224

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD--GLNAGISSHDIVSIQNA-KGLGYAMNT  501
            ++L+G K KVH + V +  E  ++++Q  LD  GLN  +++ DI+ I +  KGLGY ++T
Sbjct  225  NYLTGSKLKVHCVNVRNSIENLHQHIQEDLDQAGLNH-VNAADIIDIMDGHKGLGYGIST  283

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
             EEL+ V EI  TTG+ +DPVY+ K+  GM+ +M +NP +++G+K+L++HTGG+ GLF+
Sbjct  284  QEELEHVIEIGCTTGITVDPVYTVKSVRGMLAEMRDNPSRFKGKKVLYMHTGGMFGLFE  342



>ref|WP_008697125.1| D-cysteine desulfhydrase [Fusobacterium ulcerans]
 gb|EHO81487.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Fusobacterium ulcerans 12-1B]
Length=326

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EG K Y+IP G SN +G+ GY  A+ EI++Q ++     KFD IV A GSGGT AGL +G
Sbjct  140  EGHKAYIIPEGASNGIGSLGYYSAMEEIKEQEKELGI--KFDRIVAAVGSGGTYAGLCMG  197

Query  671  S--WLSGLKAKVHALCVCDDPEYF-------YEYVQGLLDGLNAGISSHDIVSIQNAKGL  519
            +  + +G K K+    VCDD E+F        E  Q  LD  +  + + D+  I    G+
Sbjct  198  NAEFFNGEK-KITGFNVCDDAEFFKKRSEEIIEEAQKYLDK-SIVVKAEDMDIIDGYVGI  255

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYA +  EEL+F+++ A+  GVI DPVY+GKA YGMM ++ E     +G  +LFIHTGGL
Sbjct  256  GYAQSRPEELEFIQKTAKKEGVIFDPVYTGKAMYGMMNEI-EKGTFAKGENVLFIHTGGL  314

Query  338  LGLFDKSEEM  309
             G+F K ++ 
Sbjct  315  FGIFSKRDQF  324



>ref|WP_009300429.1| MULTISPECIES: D-cysteine desulfhydrase [Coprobacillus]
 gb|EHM90699.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Coprobacillus sp. 3_3_56FAA]
 emb|CCZ36153.1| d-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Coprobacillus sp. CAG:183]
Length=325

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 112/185 (61%), Gaps = 7/185 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G KPY+IP+G SN +GT GY+EA  EI +Q  + A + +FD I+ A GSGGT AGL IG
Sbjct  143  KGYKPYIIPMGASNGIGTLGYVEAFTEILKQ--EEAMKVEFDTIIDAVGSGGTYAGLYIG  200

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG----LNAGISSHDIVSIQNAKGLGYAMN  504
            + L+  K ++    VCDD EYF + +  ++       +  I +  I  I    G GYA++
Sbjct  201  NELNRTKKQIIGFNVCDDKEYFIKEITKIIKEAQVYFDQEIKTERIKIIDGYVGQGYALS  260

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
             SEEL  +  +A+   V+LDPVY+GKA YG++ ++ E     +   ILF+HTGG+ GLF 
Sbjct  261  RSEELDAIASLAKLEAVVLDPVYTGKAYYGLINEL-EKGTFVDSENILFMHTGGIFGLFP  319

Query  323  KSEEM  309
            K  + 
Sbjct  320  KQSQF  324



>ref|WP_005978024.1| D-cysteine desulfhydrase [Fusobacterium ulcerans]
 gb|EFS26431.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Fusobacterium ulcerans ATCC 49185]
Length=326

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EG K Y+IP G SN +G+ GY  A+ EI++Q ++     KFD IV A GSGGT AGL +G
Sbjct  140  EGHKAYIIPEGASNGIGSLGYYSAMEEIKEQEKELGI--KFDRIVAAVGSGGTYAGLCMG  197

Query  671  S--WLSGLKAKVHALCVCDDPEYF-------YEYVQGLLDGLNAGISSHDIVSIQNAKGL  519
            +  + +G K K+    VCDD E+F        E  Q  LD  +  + + D+  I    G+
Sbjct  198  NAEFFNGEK-KITGFNVCDDAEFFKKRSEEIIEEAQKYLDK-SIIVKAEDMDIIDGYVGI  255

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYA +  EEL+F+++ A+  GVI DPVY+GKA YGMM ++ E     +G  +LFIHTGGL
Sbjct  256  GYAQSRPEELEFIQKTAKKEGVIFDPVYTGKAMYGMMNEI-EKGTFAKGENVLFIHTGGL  314

Query  338  LGLFDKSEEM  309
             G+F K ++ 
Sbjct  315  FGIFSKRDQF  324



>ref|WP_003535429.1| D-cysteine desulfhydrase [Erysipelatoclostridium ramosum]
 gb|EDS19743.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Erysipelatoclostridium ramosum DSM 1402]
Length=325

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 7/185 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G KPY+IP+G SN +GT GY+EA  EI +Q  + A + +FD I+ A GSGGT AGL IG
Sbjct  143  KGYKPYIIPMGASNGIGTLGYVEAFTEILKQ--EEAMKVEFDTIIDAVGSGGTYAGLYIG  200

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG----LNAGISSHDIVSIQNAKGLGYAMN  504
            + L+  K ++    +CDD EYF + +  ++       +  I +  I  I    G GYA++
Sbjct  201  NELNRTKKQIIGFNICDDKEYFIKEITKIIKEAQVYFDQEIKTERIKIIDGYVGQGYALS  260

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
             SEEL  +  +A+   V+LDPVY+GKA YG++ ++ E     +   ILF+HTGG+ GLF 
Sbjct  261  RSEELDAIASLAKLEAVVLDPVYTGKAYYGLINEL-EKGTFVDSENILFMHTGGIFGLFP  319

Query  323  KSEEM  309
            K  + 
Sbjct  320  KQSQF  324



>ref|WP_005950565.1| D-cysteine desulfhydrase [Fusobacterium varium]
 gb|EES63871.1| putative D-cysteine desulfhydrase [Fusobacterium varium ATCC 
27725]
Length=326

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 115/189 (61%), Gaps = 14/189 (7%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G K Y+IP G SN +G+ GY  A++EI++Q ++     KFD IV A GSGGT AGL +G+
Sbjct  141  GHKAYIIPEGASNGIGSLGYYSAMKEIKEQEKELGI--KFDRIVAAVGSGGTYAGLCMGN  198

Query  668  --WLSGLKAKVHALCVCDDPEYF-------YEYVQGLLDGLNAGISSHDIVSIQNAKGLG  516
              + +G K K+    VCDD E+F        E  Q  LD  +  I + ++  I    G+G
Sbjct  199  AEFFNGEK-KITGFNVCDDAEFFKKRSEEIIEEAQKYLDK-SIIIKAEEMDIIDGYVGIG  256

Query  515  YAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLL  336
            YA +  EEL+F+++ A+  GVI DPVY+GKA YGMM ++ +   K +G  +LFIHTGGL 
Sbjct  257  YAQSRDEELEFIQKTAKKEGVIFDPVYTGKAMYGMMNEIEKGTFK-KGENVLFIHTGGLF  315

Query  335  GLFDKSEEM  309
            G+F K  + 
Sbjct  316  GIFSKRNQF  324



>ref|WP_013624170.1| D-cysteine desulfhydrase [Syntrophobotulus glycolicus]
 gb|ADY55299.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Syntrophobotulus glycolicus DSM 8271]
Length=332

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 111/187 (59%), Gaps = 11/187 (6%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GR+PY+IP G SN +G++GY  A+ EI +Q ++      FD IV+A GSGGT +GL
Sbjct  141  LEEQGRRPYIIPEGASNGIGSFGYYTAMAEIVRQEKELGVH--FDRIVIAAGSGGTYSGL  198

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGL  519
             + S   G   +++ + VCDD EYF   +  ++        ++   S  +I  I    G 
Sbjct  199  FLASKTLGYTGQIYGINVCDDAEYFKNQIDKIVRESMQYINVDLQFSKDEIHMIDGYVGQ  258

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTE-NPKKWEGRKILFIHTGG  342
            GYA++  EE+ F+ E A   G+ILDPVY+GKA YG+ +++ + N K  E   ILFIHTGG
Sbjct  259  GYALSRPEEMHFIHEFARLEGIILDPVYTGKAMYGLAEEIKKGNFKTCE--NILFIHTGG  316

Query  341  LLGLFDK  321
              GLF K
Sbjct  317  AFGLFPK  323



>ref|WP_023050567.1| hypothetical protein [Cetobacterium somerae]
 gb|ERT69060.1| hypothetical protein HMPREF0202_01027 [Cetobacterium somerae 
ATCC BAA-474]
Length=330

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 119/194 (61%), Gaps = 14/194 (7%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GRK Y+IP G SN +G+ GYI  ++E+ +  + +  + KFD +VVA GSGGT AG+
Sbjct  137  LEKDGRKGYIIPEGASNGVGSLGYINFVKEVLEFEEKS--DTKFDTVVVAVGSGGTYAGI  194

Query  680  SIGS--WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK------  525
             +G+  +L G K +V    VCD  E+F E V+ +++     ++  D+  + +        
Sbjct  195  HMGNDIYLDG-KRRVVGFNVCDTAEFFKEKVKEIIEESKEYLNKKDLEKVNSENMDIIDG  253

Query  524  --GLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIH  351
              G GYA++T EEL F+ ++A+  GVILDPVY+GKA +G+ K++ +   K   + ILF+H
Sbjct  254  YVGDGYALSTQEELNFIWDLAKKEGVILDPVYTGKAMFGLHKEIKKGSFK-NSKNILFVH  312

Query  350  TGGLLGLFDKSEEM  309
            TGGL GLF K  + 
Sbjct  313  TGGLFGLFPKKNQF  326



>ref|WP_008825528.1| D-cysteine desulfhydrase [Haloplasma contractile]
 gb|ERJ11002.1| D-cysteine desulfhydrase protein [Haloplasma contractile SSD-17B]
Length=332

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 112/187 (60%), Gaps = 9/187 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG +PY+IP GGS  +GT+GY+ A+ EI++Q ++      FD IV+A GSGGT +GL
Sbjct  141  LEKEGHRPYIIPEGGSMGIGTFGYVNAMLEIQEQEKELGVH--FDAIVLAVGSGGTYSGL  198

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG------LNAGISSHDIVSIQNAKGL  519
             + + L    + V+ + VCDD  YF   +  +L        +    S ++I  +    G 
Sbjct  199  FLANKLLKRDSTVYGINVCDDACYFKNQIANVLKDSFQYVDVELEFSKNEINILDGYVGE  258

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYA++  EEL+F++ +A+  GVILDPVY+GKA YG++ ++         + ILFIHTGGL
Sbjct  259  GYAVSRPEELRFIRYLAKLEGVILDPVYTGKAMYGLVNEIKSGNLNHH-KNILFIHTGGL  317

Query  338  LGLFDKS  318
             GLF K 
Sbjct  318  FGLFPKK  324



>ref|WP_011971727.1| D-cysteine desulfhydrase [Alkaliphilus metalliredigens]
 gb|ABR46819.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Alkaliphilus metalliredigens QYMF]
Length=327

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 112/188 (60%), Gaps = 11/188 (6%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K Y++P G SN +GT+GY +A+ EI +Q  +   + KFD IV A GSGGT AGL   
Sbjct  143  QGHKAYILPEGASNGIGTFGYYQAMEEILEQ--EAELDVKFDAIVTAVGSGGTYAGLFYA  200

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGLGYA  510
            + L   +AK++ + VCDD ++F   VQ L+                DI  I    G GYA
Sbjct  201  NKLRKNEAKIYGINVCDDADHFKNRVQELVHESIQYTKRPIHFKKEDIHMIDGYVGEGYA  260

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEG-RKILFIHTGGLLG  333
             +  EEL F+ + A+  G+ILDPVY+GKA YG+++++ +    + G + ILFIHTGGL G
Sbjct  261  QSRQEELTFILDFAKLEGIILDPVYTGKAMYGLVEEIKKGS--FNGFKNILFIHTGGLYG  318

Query  332  LFDKSEEM  309
            LF K  ++
Sbjct  319  LFPKGNQL  326



>ref|WP_007087484.1| D-cysteine desulfhydrase [Bacillus bataviensis]
 gb|EKN64837.1| D-cysteine desulfhydrase [Bacillus bataviensis LMG 21833]
Length=324

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 109/191 (57%), Gaps = 9/191 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G KPY+IPVG SN++G+ GY  AI EI +Q  +      +D +V+A GSGGT AGL
Sbjct  133  LKSQGHKPYLIPVGASNAVGSLGYAAAIEEITEQ--ENKLGIHYDTVVIAVGSGGTYAGL  190

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLL------DGLNAGISSHDIVSIQNAKGL  519
               +   G K K+H   V +  + F E +  +L      DGL A     DI+      G 
Sbjct  191  WYANQKQGAKRKIHGFAVDNSADTFVETITEILKEMYLNDGLAAPEEYKDILINDQYIGT  250

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYA +T EEL F+ + +   G +LDPVY+GKA YGM+ ++ +   K +   ILFIHTGG+
Sbjct  251  GYAKSTHEELAFIMKTSREHGFLLDPVYTGKAFYGMVSEIQKGHFK-DANNILFIHTGGI  309

Query  338  LGLFDKSEEMA  306
            LG   K  EMA
Sbjct  310  LGWTHKQREMA  320



>ref|WP_009298784.1| D-cysteine desulfhydrase [Clostridium sp. 7_3_54FAA]
 gb|EHF03773.1| hypothetical protein HMPREF1020_04314 [Clostridium sp. 7_3_54FAA]
Length=333

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 110/190 (58%), Gaps = 11/190 (6%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GRK Y+IP G SN +GT+GY+  ++EI +Q ++      FD IV A GSGGT AG+ + +
Sbjct  145  GRKAYIIPEGASNGIGTFGYLACMQEIMEQERELGV--TFDTIVDAVGSGGTFAGVCLAN  202

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA------GISSHDIVSIQNAKGLGYAM  507
             L GL  +V  + VCDD  +F + V  +++   A       I   ++  I    G GYA+
Sbjct  203  RLYGLNKRVVGINVCDDAPFFRQRVSEIVEEAGAYLEEPVAIRPEEVEIIDGYVGRGYAL  262

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRK-ILFIHTGGLLGL  330
            +  EEL F+++ A   GV+LDPVY+GK  YG  +++ +    + G K +LF+HTGGL GL
Sbjct  263  SRQEELNFIRDFARMEGVLLDPVYTGKCMYGFTQEVKKG--SFAGSKNVLFLHTGGLFGL  320

Query  329  FDKSEEMASL  300
            F   E    L
Sbjct  321  FPARELFTGL  330



>ref|WP_003503279.1| D-cysteine desulfhydrase [[Clostridium] symbiosum]
 gb|EGA92513.1| D-cysteine desulfhydrase [ [[Clostridium] symbiosum WAL-14163]
 gb|EGB17447.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [ [[Clostridium] symbiosum WAL-14673]
Length=333

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 110/190 (58%), Gaps = 11/190 (6%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GRK Y+IP G SN +GT+GY+  ++EI +Q ++      FD IV A GSGGT AG+ + +
Sbjct  145  GRKAYIIPEGASNGIGTFGYLACMQEIMEQERELGV--TFDTIVDAVGSGGTFAGVCLAN  202

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA------GISSHDIVSIQNAKGLGYAM  507
             L GL  +V  + VCDD  +F + V  +++   A       I   ++  I    G GYA+
Sbjct  203  RLYGLNKRVVGINVCDDAPFFRQRVSEIVEEAGAYLEEPVAIRPEEVEIIDGYVGRGYAL  262

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRK-ILFIHTGGLLGL  330
            +  EEL F+++ A   GV+LDPVY+GK  YG  +++ +    + G K +LF+HTGGL GL
Sbjct  263  SRQEELNFIRDFARMEGVLLDPVYTGKCMYGFTQEVKKG--SFAGSKNVLFLHTGGLFGL  320

Query  329  FDKSEEMASL  300
            F   E    L
Sbjct  321  FPARELFTGL  330



>ref|WP_022425163.1| d-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Catenibacterium sp. CAG:290]
 emb|CDE28731.1| d-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Catenibacterium sp. CAG:290]
Length=325

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 114/191 (60%), Gaps = 8/191 (4%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            +L +G KPY+IP+G SN +GT GYI+A  EI +  + T     FD I+ A GSGGT  GL
Sbjct  137  VLDKGDKPYIIPMGASNGIGTLGYIDAFDEILEYEKKTGI--VFDTIIDAVGSGGTYTGL  194

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVS-----IQNAKGLG  516
             +G+ L      +  + VCDD ++F + +  ++D     +   D+       I    G G
Sbjct  195  YLGNELRQAHKDIVGINVCDDADFFIKEINSIIDDTLPHLDVKDVERSHIHIIDGYVGRG  254

Query  515  YAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLL  336
            Y+++  EEL+ + +++  +G+ILDPVY+GKA YG++ ++ E       + ILF+HTGG+ 
Sbjct  255  YSLSRKEELEAISDLSRHSGIILDPVYTGKAYYGLIHEL-EKGTFDHAKNILFMHTGGIY  313

Query  335  GLFDKSEEMAS  303
            GLF KS+E+ S
Sbjct  314  GLFSKSKEIIS  324



>ref|WP_021642770.1| putative D-cysteine desulfhydrase [[Clostridium] symbiosum]
 gb|ERI77381.1| putative D-cysteine desulfhydrase [ [[Clostridium] symbiosum 
ATCC 14940]
Length=333

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 109/189 (58%), Gaps = 11/189 (6%)
 Frame = -3

Query  845  RKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSW  666
            RK Y+IP G SN +GT+GY+  ++EI +Q ++      FD IV A GSGGT AG+ + + 
Sbjct  146  RKAYIIPEGASNGIGTFGYLACMQEIMEQERELGV--TFDTIVDAVGSGGTFAGVCLANR  203

Query  665  LSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA------GISSHDIVSIQNAKGLGYAMN  504
            L GL  +V  + VCDD  +F + V  +++   A       I   ++  I    G GYA++
Sbjct  204  LYGLNKRVVGINVCDDAPFFRQRVSEIVEEAGAYLEEPVAIRPEEVEIIDGYVGRGYALS  263

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRK-ILFIHTGGLLGLF  327
              EEL F+++ A   GV+LDPVY+GK  YG  +++ +    + G K +LF+HTGGL GLF
Sbjct  264  RQEELNFIRDFARMEGVLLDPVYTGKCMYGFTQEVKKG--SFAGSKNVLFLHTGGLFGLF  321

Query  326  DKSEEMASL  300
               E    L
Sbjct  322  PARELFTGL  330



>gb|EKD31727.1| Pyridoxal phosphate-dependent enzyme [uncultured bacterium]
Length=244

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 108/188 (57%), Gaps = 9/188 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +GRK Y+IP G SN LG+ GY  A+ EI +Q +++     F+ +VV  GSGGT +GL I 
Sbjct  58   KGRKCYIIPEGASNGLGSMGYYGAMEEICEQERESGI--NFEIVVVPVGSGGTYSGLCIA  115

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGL------LDGLNAGISSHDIVSIQNAKGLGYA  510
            +    L  +V    VCDD  YF   +  +      + G +  +S  DI       G+GYA
Sbjct  116  NKALKLNKRVIGFAVCDDSPYFTNRIDKINHEAERIIGKDWDLSFSDIEINDKYVGIGYA  175

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            ++  EEL F+ EIA    ++LDPVY+GKA YG+  ++ E  +  +G  ILFIHTGGL GL
Sbjct  176  ISRPEELTFISEIASREALVLDPVYTGKAMYGLYNEIIEG-RIAKGSTILFIHTGGLFGL  234

Query  329  FDKSEEMA  306
            F K  + +
Sbjct  235  FPKQNQFS  242



>ref|XP_001748624.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86511.1| predicted protein [Monosiga brevicollis MX1]
Length=395

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 106/185 (57%), Gaps = 6/185 (3%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +GR+ Y IPVGGSN +G WGY++A   ++ Q            IV++ GSGGT AGL++ 
Sbjct  205  QGRRTYHIPVGGSNRVGLWGYLDAWDHLDAQCG----AADITHIVLSTGSGGTAAGLALA  260

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSI-QNAKGLGYAMNTSE  495
            +WL+G + ++ A+ VCD+ +YFY +VQ  LD       + D+++I +  KG GY   + E
Sbjct  261  NWLTGRRYRIWAVAVCDNADYFYNHVQETLDEFGVTAQARDLLTIVEGYKGEGYGQFSDE  320

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSE  315
             L  ++ +   TGVILDP Y+ K   G+   +  +P  +      FIHTGG+ GL D   
Sbjct  321  HLAMIRAVGARTGVILDPTYTCKGVLGLQALVNAHP-DFANVNTCFIHTGGVYGLLDGRV  379

Query  314  EMASL  300
             + SL
Sbjct  380  HIDSL  384



>ref|WP_007232100.1| D-cysteine desulfhydrase [gamma proteobacterium HTCC2207]
 gb|EAS47451.1| D-cysteine desulfhydrase [gamma proteobacterium HTCC2207]
Length=330

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 103/187 (55%), Gaps = 9/187 (5%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GRK Y IP GGSN  G WGYI A  E+ Q  Q  A       IV A GS GT AGL +G 
Sbjct  144  GRKAYAIPTGGSNGTGMWGYIAAAEELSQDFQRHAISPA--AIVHATGSAGTQAGLMLGC  201

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK------GLGYAM  507
             L  +  +V A  VCD+ EYF   V+G L+   +  S    +S   A       G  Y +
Sbjct  202  QLHQINTQVKAYAVCDNAEYFTRKVRGDLEQWQSHYSPQTDISGLVADTSDEYIGPAYGV  261

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENP-KKWEGRKILFIHTGGLLGL  330
               E  + +KE+A   G++LDPVY+GKA +GM++D+ +    +W+G  I+F+HTGGL GL
Sbjct  262  AGEEVFECIKEVAALEGILLDPVYTGKAFFGMIEDIKKGKFSQWDGDDIVFVHTGGLFGL  321

Query  329  FDKSEEM  309
            F +   +
Sbjct  322  FAQQHRL  328



>ref|XP_005783691.1| hypothetical protein EMIHUDRAFT_418319 [Emiliania huxleyi CCMP1516]
 gb|EOD31262.1| hypothetical protein EMIHUDRAFT_418319 [Emiliania huxleyi CCMP1516]
Length=409

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 104/176 (59%), Gaps = 5/176 (3%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GR PY++PVGG+  LGTWGY+ A      +   T F+   D IV A GSGGT AGL
Sbjct  172  LRRQGRVPYIVPVGGTTPLGTWGYLSAAAAAAAEEAAT-FD-PIDHIVFAVGSGGTAAGL  229

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAG---ISSHDIVSIQNAKGLGYA  510
            ++GS L+GL+ ++H + V   PE+FY+ +   +  L+ G     + ++++I    G GY 
Sbjct  230  ALGSHLAGLRPQLHGVAVHHSPEHFYDLIDAEVSELSGGSFEACAREMLAIYPGAGAGYG  289

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGG  342
            + T E + F  E A  +GV+LD  YSGKA Y   +     P+++ G+ ILF HTGG
Sbjct  290  VATPELMAFCAETARQSGVLLDHTYSGKALYYFAQAARAQPERFRGKHILFWHTGG  345



>ref|WP_027623144.1| cysteine desulfhydrase [Clostridium lundense]
Length=329

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 110/186 (59%), Gaps = 13/186 (7%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G K Y+IP G SN +G +GY +A+ EI +Q ++     KFD IV+A GSGGT AGL
Sbjct  141  LDKKGHKAYIIPEGSSNGIGAFGYFKAMEEIFEQEKEMGI--KFDAIVLAVGSGGTYAGL  198

Query  680  SIGSWLSGLKAKVHALCVCDDPEYF--------YEYVQGLLDGLNAGISSHDIVSIQNAK  525
               +      AKV+ + VCDD +YF        YE  Q   + +       +I  I    
Sbjct  199  FYANKYYKNNAKVYGINVCDDEKYFKNAINNILYESFQYTKESIE--FFKDEINIIDGYV  256

Query  524  GLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTG  345
            G GYA++  EE+ F+ E+A+  GVILDPVY+GKA YG+++++ +   K E   ILFIHTG
Sbjct  257  GKGYALSRPEEITFIHELAKLEGVILDPVYTGKAMYGLVEEIKKGNFK-EHNNILFIHTG  315

Query  344  GLLGLF  327
            GL GLF
Sbjct  316  GLFGLF  321



>ref|XP_005787529.1| hypothetical protein EMIHUDRAFT_429282 [Emiliania huxleyi CCMP1516]
 gb|EOD35100.1| hypothetical protein EMIHUDRAFT_429282 [Emiliania huxleyi CCMP1516]
Length=408

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 103/176 (59%), Gaps = 6/176 (3%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GR PY++PVGG+  LGTWGY+ A        +   F+   D IV A GSGGT AGL
Sbjct  172  LRRQGRVPYIVPVGGTTPLGTWGYLSA--AAAAAEEAATFD-PIDHIVFAVGSGGTAAGL  228

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAG---ISSHDIVSIQNAKGLGYA  510
            ++GS L+GL+ ++H + V   PE+FY+ V   +  L+ G     + ++++I    G GY 
Sbjct  229  ALGSHLAGLRPQLHGVAVHHSPEHFYDLVDAEVSELSGGSFEACAREMLAIYPGAGAGYG  288

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGG  342
            + T E + F  E A  +GV+LD  YSGKA Y   +     P+++ G+ ILF HTGG
Sbjct  289  VATPELMAFCAETARQSGVLLDHTYSGKALYYFAQAARAQPERFRGKHILFWHTGG  344



>ref|WP_035134048.1| cysteine desulfhydrase [Clostridium sulfidigenes]
 gb|KEZ85667.1| cysteine desulfhydrase [Clostridium sulfidigenes]
Length=335

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 109/185 (59%), Gaps = 9/185 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G   Y+IP G SN +GT+GY  A++EI +Q Q+      FD +++  GSGGT AG  + 
Sbjct  150  KGYTSYIIPEGASNVIGTFGYYNAMKEIIEQEQELGVH--FDKVILPVGSGGTYAGTFLA  207

Query  671  SWLSGLKAKVHALCVCDDPEYF----YEYVQGLLDGLNAGI--SSHDIVSIQNAKGLGYA  510
            + +   K  +  + VCDD EYF    YE VQ  +  +N  +  S  +I  I    G GYA
Sbjct  208  NKILENKCDILGVNVCDDSEYFKNRIYEIVQDTMKYINIDLELSKDEIRIIDGYVGKGYA  267

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            ++  EE+ F+KE A+  G+ILDPVY+GKA YG+ +++ +N        ILFIHTGG  G+
Sbjct  268  LSREEEINFIKEFAKLEGIILDPVYTGKAMYGLSEEI-KNGNFKNDENILFIHTGGAFGI  326

Query  329  FDKSE  315
            F + E
Sbjct  327  FPQKE  331



>gb|ABD80923.1| Pyridoxal phosphate-dependent deaminase [Saccharophagus degradans 
2-40]
Length=336

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 110/194 (57%), Gaps = 16/194 (8%)
 Frame = -3

Query  854  HEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
             +GRK + IP G S+ +G WGYI+A  E+E QL +       D +V A GSGGT AGLS+
Sbjct  147  QQGRKAWCIPTGASDEIGIWGYIDAFAELEAQLAERDINP--DLVVCATGSGGTQAGLSL  204

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQ-----NA  528
            G+ + G KAKV  + VCD   YF    +  +       G  AGIS+     +Q       
Sbjct  205  GAHILGSKAKVVGMAVCDSEAYFERKAKQDITLWQQKYGQAAGISAQQATQVQINTIDKY  264

Query  527  KGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRK-ILFIH  351
             G GYA    E L+ ++ +A T GV+LDPVY+GKA YG+++++     +W   K I+F+H
Sbjct  265  IGPGYAKAYPELLERIRWLAATEGVVLDPVYTGKAFYGLVQEIKSG--RWANMKDIVFVH  322

Query  350  TGGLLGLFDKSEEM  309
            TGG+ GLF   +E 
Sbjct  323  TGGIFGLFPYRDEF  336



>ref|WP_041324464.1| cysteine desulfhydrase [Saccharophagus degradans]
Length=334

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 110/194 (57%), Gaps = 16/194 (8%)
 Frame = -3

Query  854  HEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
             +GRK + IP G S+ +G WGYI+A  E+E QL +       D +V A GSGGT AGLS+
Sbjct  145  QQGRKAWCIPTGASDEIGIWGYIDAFAELEAQLAERDINP--DLVVCATGSGGTQAGLSL  202

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQ-----NA  528
            G+ + G KAKV  + VCD   YF    +  +       G  AGIS+     +Q       
Sbjct  203  GAHILGSKAKVVGMAVCDSEAYFERKAKQDITLWQQKYGQAAGISAQQATQVQINTIDKY  262

Query  527  KGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRK-ILFIH  351
             G GYA    E L+ ++ +A T GV+LDPVY+GKA YG+++++     +W   K I+F+H
Sbjct  263  IGPGYAKAYPELLERIRWLAATEGVVLDPVYTGKAFYGLVQEIKSG--RWANMKDIVFVH  320

Query  350  TGGLLGLFDKSEEM  309
            TGG+ GLF   +E 
Sbjct  321  TGGIFGLFPYRDEF  334



>ref|XP_003383708.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Amphimedon 
queenslandica]
Length=373

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 109/181 (60%), Gaps = 12/181 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIRE-IEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
            +G+KPYVI +G ++ +G WGYIEA +E I+Q L D      FDDIVV  G+GGT  G+ +
Sbjct  173  KGKKPYVIELGAASPVGCWGYIEAFKEMIDQGLFD-----NFDDIVVCLGAGGTACGIGV  227

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLN------AGISSHDIVSIQNAKGLGY  513
             ++L+G K K+H + +         ++   L  L         I + +++ + +  GLGY
Sbjct  228  ANYLTGSKLKIHGISIGMAAVQLSLHMDEELSALGLKHPDGRTIKTAELMDLADEPGLGY  287

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            ++ T  ELK + E++ +TG++LD  ++ K    MM+ M E P K++G +ILFIHTGGL G
Sbjct  288  SLTTESELKLLTEVSSSTGIVLDTTFTLKTYQHMMRMMKETPDKFKGNRILFIHTGGLYG  347

Query  332  L  330
            L
Sbjct  348  L  348



>ref|WP_045432621.1| hypothetical protein [bacterium UASB270]
 dbj|GAK57834.1| predicted pyridoxal-phosphate dependent deaminase [bacterium 
UASB270]
Length=332

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 111/189 (59%), Gaps = 9/189 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K  V+P+G SN+LG+ GY+ A +E+  Q QD A     D IV A GSGGT+AGL +G
Sbjct  144  QGHKALVVPMGASNALGSLGYVAATQEMMSQFQDMALTP--DYIVAAIGSGGTLAGLILG  201

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGLGYA  510
              L GL +++  + VCD+  YF++ +  ++        ++  +   D   I    G GY+
Sbjct  202  KKLFGLSSQIIGVNVCDNAAYFHQEIAHIVREFCERYQVDVKVEPKDYRIIDGYVGAGYS  261

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            ++  +E +F+ ++A T G++LD  Y+GKA YG+ +++ +   K +G  ILFIHTGGL  L
Sbjct  262  LSRPQEREFIVQVARTEGIVLDTAYTGKALYGLTQEIQKGTFK-QGEMILFIHTGGLYAL  320

Query  329  FDKSEEMAS  303
            F    E  +
Sbjct  321  FANPTEFVA  329



>ref|WP_045670987.1| cysteine desulfhydrase [Paenibacillus beijingensis]
 gb|AJY75558.1| cysteine desulfhydrase [Paenibacillus beijingensis]
Length=331

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 108/187 (58%), Gaps = 9/187 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G KPY+IP G SN +G++GY  A+REI +Q ++      FD IVVA GSGGT AGL + 
Sbjct  144  QGYKPYIIPEGASNGIGSFGYYTALREIVEQEKELGVH--FDAIVVAVGSGGTYAGLLLA  201

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGL------NAGISSHDIVSIQNAKGLGYA  510
            S     KA +  + VCDD  YF   +  +L         +   +  D   I    G GY 
Sbjct  202  SKTLHYKADIIGINVCDDEYYFRHVIDSILQDSGRYLQEDIAYAKQDFHIIDGYVGQGYG  261

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            +++ E  +F+ + A+  GVILDPVY+GKA +G+++++ +  +  +   ILFIHTGGL GL
Sbjct  262  ISSPEVRQFIFDFAKLEGVILDPVYTGKALFGLVEEIKKG-RFNDLHNILFIHTGGLFGL  320

Query  329  FDKSEEM  309
            F +  E 
Sbjct  321  FPQKHEF  327



>ref|WP_038051708.1| cysteine desulfhydrase [Thermotoga sp. Mc24]
 gb|KHC93303.1| D-cysteine desulfhydrase [Thermotoga sp. Mc24]
Length=312

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 112/182 (62%), Gaps = 13/182 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K YVIP GGSNSLG +GY  A+ E++ QL      + FD IV A GSGGTIAGLS G
Sbjct  136  KGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLN----LESFDAIVCAVGSGGTIAGLSAG  191

Query  671  SWLSGLKAKVHALCVC-DDPEYFYEYVQGLLDGLNA---GISSHDIVSIQNAKGLGYAMN  504
                G +  V  + V   + +YF E V+ ++ G+      ++      + + +G GYA+ 
Sbjct  192  VSFLGCRVPVVGVNVTTKNSDYFVEKVKRIISGMEEYGLRVNEPAFEVVDDYRGPGYAIP  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            +SE+++ +K++A   G+ILDPVY+ KA  GM+ +M +N     G+ +LFIHTGG+ GLF 
Sbjct  252  SSEDVEILKKVASIEGIILDPVYTAKAFRGMV-EMFKN----SGKNVLFIHTGGIFGLFA  306

Query  323  KS  318
            +S
Sbjct  307  QS  308



>ref|WP_012830343.1| D-cysteine desulfhydrase [Haliangium ochraceum]
 gb|ACY17751.1| pyridoxal phosphate-dependent enzyme, D- cysteine desulfhydrase 
family [Haliangium ochraceum DSM 14365]
Length=337

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 119/197 (60%), Gaps = 12/197 (6%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   GR PY+IP GGSN +G+WGY+ AI E+ + L   A   K   IV ACGSGGT AGL
Sbjct  144  LRSAGRTPYIIPEGGSNEIGSWGYVAAIEELAEAL--VALPPKPTTIVYACGSGGTGAGL  201

Query  680  SIGSWLSGLKA---KVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNA  528
             +G+ L GL     ++  + VC+D +YF   +  +        G+ AGI S DI  +   
Sbjct  202  LLGARLFGLDRQGLRLSGVNVCNDRDYFVSAISAICAAFDERFGVAAGIESGDIDIVDGY  261

Query  527  KGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHT  348
             G GY  +  EEL  ++E+A   GV+LDPVY+GKA YGM +++  +  ++ G +++F+HT
Sbjct  262  VGAGYGQSRPEELAALRELARREGVVLDPVYTGKAFYGMCQELARDRARF-GERVIFLHT  320

Query  347  GGLLGLFDKSEEMASLV  297
            GG+ GL  ++E +A ++
Sbjct  321  GGIFGLLAQAEALAEVL  337



>ref|XP_001619528.1| hypothetical protein NEMVEDRAFT_v1g42395 [Nematostella vectensis]
 gb|EDO27428.1| predicted protein, partial [Nematostella vectensis]
Length=269

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 113/180 (63%), Gaps = 15/180 (8%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G+ PYVIP+GGSN +G +GYI A  E+ +Q        +FDD+V+  GS GT AG+
Sbjct  97   LRQQGKSPYVIPLGGSNEIGLFGYITAFHELTKQ----NVLDEFDDMVMCVGSSGTAAGI  152

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGIS-------SHDIVSI-QNAK  525
            +IG++L+G K     +    D     ++ + +L   N  +S       + DI+ I +  K
Sbjct  153  AIGNYLTGNKLSDEGVGKSWD---LTQHNRLVLQRQNCLVSVGLTDVHAEDILDIIEGYK  209

Query  524  GLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTG  345
            G GYA++T+EEL+ +  I+ TTG++LDPVY+ K+  GM+ +M  NP +++G+++L+IHTG
Sbjct  210  GKGYAVSTTEELEDIVRISSTTGIMLDPVYTIKSVRGMLAEMKNNPSRFKGKRVLYIHTG  269



>ref|WP_020209703.1| hypothetical protein [Gilvimarinus chinensis]
Length=332

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 107/190 (56%), Gaps = 10/190 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ EGR+PY+IP G S+ +G WGY++A +E+    Q    E     +V A GSGGT+AGL
Sbjct  142  LVREGRRPYIIPTGASDEVGLWGYVKAAQELANDFQSEGLESPL--VVCAAGSGGTLAGL  199

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGL-----NAGISSHDIVSIQNAK-GL  519
            + G      +A+V  + VCD   YF   V+  + G      ++G+S  D   + +   G 
Sbjct  200  AAGLAHYCPQARVLGVAVCDSAAYFRARVKEDIAGAMKRYSDSGLSVPDNYWVNDQYIGP  259

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYA+        +  IA  TGVILDPVY+GKA YGM+ D+ E   +     I+F+HTGG+
Sbjct  260  GYALGYRSLYDCIARIAANTGVILDPVYTGKAFYGML-DLLEK-SQLRQSDIVFVHTGGI  317

Query  338  LGLFDKSEEM  309
             G+F + E M
Sbjct  318  FGVFPEREAM  327



>ref|WP_041523161.1| cysteine desulfhydrase [Gilvimarinus agarilyticus]
Length=332

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 104/188 (55%), Gaps = 10/188 (5%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GR PYVIP G S+ +G WGYI A  E+  Q  +    +    +V A GSGGT+AGL+ G 
Sbjct  146  GRTPYVIPTGASDGVGVWGYIAAAEELAGQFAERGITEPL--VVCATGSGGTLAGLAAGL  203

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK------GLGYAM  507
             L    A+V  + VCDD +YFY  V+  L+      S  +I   +N +      G GYA 
Sbjct  204  NLFCPGAQVLGVAVCDDADYFYRRVREDLNACRKRYSQVNIPEPENYRVVEDYIGPGYAQ  263

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
               E  + +  +A  +GV+LDPVY+ KA YGM+K++         R ++F+HTGG+ G++
Sbjct  264  GYPEVFETIATVACGSGVVLDPVYTAKAFYGMLKELRLG--HVTARDLVFVHTGGIFGVY  321

Query  326  DKSEEMAS  303
             +   +AS
Sbjct  322  PERAALAS  329



>ref|WP_040193666.1| cysteine desulfhydrase [Clostridium sp. CL-6]
Length=328

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 107/185 (58%), Gaps = 9/185 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K Y+IP G SN +G +GY + + EI+ Q ++      FD IV+A GSGGT AGL + 
Sbjct  143  KGDKAYIIPEGASNYIGNFGYFKCMEEIKSQEEELGI--VFDTIVIAVGSGGTYAGLQLA  200

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGLGYA  510
            + +  L  K+  + VCD  ++F + +  ++       GL+  +   +I  I    G GYA
Sbjct  201  NKVLNLNKKILGVNVCDTADFFKDRIYEIMGDSKEYLGLDVELHREEINIIDGYVGRGYA  260

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            ++  EE++F+K  A T G+ILDPVY+GK  YG+  ++ E   +  G  +LFIHTGGL G 
Sbjct  261  LSRPEEIEFIKHFARTEGIILDPVYTGKGLYGLSSELKEGNLENLG-NVLFIHTGGLYGA  319

Query  329  FDKSE  315
            F   E
Sbjct  320  FPVRE  324



>ref|WP_021282477.1| hypothetical protein [Clostridium sp. BL8]
 gb|EQB89061.1| hypothetical protein M918_03220 [Clostridium sp. BL8]
Length=329

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 109/189 (58%), Gaps = 15/189 (8%)
 Frame = -3

Query  854  HEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
            ++G KPY+IP G SN +GT+GY  A++EI  Q ++      FD I+VA GSGGT AGL +
Sbjct  143  NKGYKPYIIPEGASNGIGTFGYFNAMKEIISQEKELGLH--FDKIIVAVGSGGTHAGLLL  200

Query  674  GSWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGLGY  513
               +     ++    VCDD EYF   +  +L+           IS  +I  I    G GY
Sbjct  201  SQKILNHNCEIIGFNVCDDEEYFKNRIYNILEESKSIFKTETNISKKEIHIIDGYVGQGY  260

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDM---TENPKKWEGRKILFIHTGG  342
             + + E L F+ ++A+  G+ILDPVY+GKA +G+ +++   T N K+     ILFIHTGG
Sbjct  261  GLCSPENLAFIMDLAKLEGLILDPVYTGKAMFGLAQEIRKGTFNKKE----NILFIHTGG  316

Query  341  LLGLFDKSE  315
            + GL+ + +
Sbjct  317  VFGLYPQKD  325



>ref|WP_008193862.1| MULTISPECIES: D-cysteine desulfhydrase [Thermotoga]
 gb|EJX26216.1| D-cysteine desulfhydrase [Thermotoga sp. EMP]
 gb|AIY86280.1| D-cysteine desulfhydrase [Thermotoga sp. 2812B]
Length=312

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 13/182 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K YVIP GGSNSLG +GY  A+ E++ QL      + FD IV A GSGGTIAGLS G
Sbjct  136  KGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLN----LESFDAIVCAVGSGGTIAGLSAG  191

Query  671  SWLSGLKAKVHALCVC-DDPEYFYEYVQGLLDGLNA-GISSHDIV--SIQNAKGLGYAMN  504
                G    V  + V   + +YF   V+ ++ G+   G+  ++ V   + + +G GYA+ 
Sbjct  192  ISFLGYHVPVVGVNVTTKNSDYFVRKVKRIISGMEEYGLRINETVFEVVDDYRGPGYAIP  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            +SE+++ +KE A   G+ILDPVY+ KA  GM+ +M  N     G+ +LFIHTGG+ GLF 
Sbjct  252  SSEDVEILKEAASIEGIILDPVYTAKAFRGMI-EMFRN----SGKNVLFIHTGGIFGLFA  306

Query  323  KS  318
            +S
Sbjct  307  QS  308



>ref|WP_004082912.1| MULTISPECIES: D-cysteine desulfhydrase [Thermotoga]
 ref|NP_228040.1| D-cysteine desulfhydrase [Thermotoga maritima MSB8]
 sp|Q9WY68.1|1A1D_THEMA RecName: Full=Putative 1-aminocyclopropane-1-carboxylate deaminase; 
Short=ACC deaminase [Thermotoga maritima MSB8]
 gb|AAD35317.1|AE001707_4 1-aminocyclopropane-1-carboxylate deaminase, putative [Thermotoga 
maritima MSB8]
 gb|AGL49149.1| pyridoxal phosphate-dependent deaminase, putative [Thermotoga 
maritima MSB8]
 gb|AHD18011.1| D-cysteine desulfhydrase [Thermotoga maritima MSB8]
Length=312

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 113/186 (61%), Gaps = 13/186 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K YVIP GGSNSLG +GY  A+ E++ QL      + FD IV A GSGGTIAGLS G
Sbjct  136  KGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLN----LESFDAIVCAVGSGGTIAGLSAG  191

Query  671  -SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA-GISSHDIV--SIQNAKGLGYAMN  504
             S+L      V       + +YF   V+ ++ G+   G+  ++ V   + + +G GYA+ 
Sbjct  192  ISFLEYHVPVVGVNVTTKNSDYFVGKVKRIISGMEEYGLRVNETVFEVVDDYRGPGYAIP  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            +SE+++ +KE+A   G+ILDPVY+ KA  GM+ +M  N +K     +LFIHTGG+ GLF 
Sbjct  252  SSEDVEILKEVASIEGIILDPVYTAKAFRGMI-EMFRNSEK----NVLFIHTGGIFGLFA  306

Query  323  KSEEMA  306
            +S  + 
Sbjct  307  QSRRLV  312



>ref|WP_036860353.1| cysteine desulfhydrase [Porticoccus hydrocarbonoclasticus]
Length=338

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 112/187 (60%), Gaps = 9/187 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
             GRKPYVIP G S+ +G WGY+ ++ E+  Q ++   E K D IV A GSGGT AGL++G
Sbjct  142  RGRKPYVIPTGASDGIGIWGYLHSVSELACQFRE--LEIKPDAIVCATGSGGTQAGLTLG  199

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYV-QGLLDGLNAGISSHDI--VSIQ-NAK--GLGYA  510
              LS L   V    VCDD  YF+  + + + D      +S D+  V+IQ N +  G GY 
Sbjct  200  CHLSQLDIPVVGFAVCDDAAYFHNKIREDISDWTRRYGTSVDMTQVAIQVNDRYIGPGYG  259

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
               +E    ++ +A   G+ILDPVY+GKA YG+++++     + +   I+FIHTGGL GL
Sbjct  260  RARAEVFSTIRHMASLEGLILDPVYTGKAFYGLVEEIKAGVFQ-DASDIVFIHTGGLFGL  318

Query  329  FDKSEEM  309
            + + +E+
Sbjct  319  YAQRDEL  325



>ref|WP_005586944.1| putative 1-aminocyclopropane-1-carboxylate deaminase [Clostridium 
ultunense]
 emb|CCQ96738.1| putative 1-aminocyclopropane-1-carboxylate deaminase [Clostridium 
ultunense Esp]
Length=325

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 105/182 (58%), Gaps = 9/182 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG K Y+IP G SN +G+ GY+  + EI  Q ++   E  FD IVV  GSGGT AGL
Sbjct  137  LEKEGHKAYIIPEGASNGIGSLGYVNTMDEILGQEEELGIE--FDAIVVTVGSGGTYAGL  194

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLL------DGLNAGISSHDIVSIQNAKGL  519
              G+ ++   A ++   +CD  EYF   V  LL       G    I   +I  I    GL
Sbjct  195  YYGNHVNDNSAIIYGFNICDTKEYFQNIVINLLVEIATYTGKKIIIQKDEINIIDGYPGL  254

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYA++  EE++F+   A+  G+ILDPVY+GKA YG++ ++ +  +  + + ILFIHTGGL
Sbjct  255  GYALSRPEEIEFIHYFAKLEGIILDPVYTGKAMYGLVNEIKKG-RFDKHQNILFIHTGGL  313

Query  338  LG  333
             G
Sbjct  314  FG  315



>gb|KJB39184.1| hypothetical protein B456_007G002100 [Gossypium raimondii]
Length=294

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REIE+QLQ  +   KFDDIVVACGSGGTIAGL
Sbjct  222  LLKEGRRPYVIPVGGSNSLGTWGYIEAMREIEEQLQIRSNRVKFDDIVVACGSGGTIAGL  281

Query  680  SIGSWLSGLKAKV  642
            S+GSWL  LKAK 
Sbjct  282  SLGSWLGALKAKT  294



>ref|WP_038033348.1| MULTISPECIES: cysteine desulfhydrase [Thermotoga]
 gb|KHC91112.1| D-cysteine desulfhydrase [Thermotoga sp. TBGT1765]
 gb|KHC92025.1| D-cysteine desulfhydrase [Thermotoga sp. TBGT1766]
 gb|KHC96680.1| D-cysteine desulfhydrase [Thermotoga sp. Xyl54]
 gb|AIY88035.1| D-cysteine desulfhydrase [Thermotoga sp. Cell2]
Length=312

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 13/182 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K YVIP GGSNSLG +GY  A+ E++ QL      + FD IV A GSGGTIAGLS G
Sbjct  136  KGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLN----LESFDAIVCAVGSGGTIAGLSAG  191

Query  671  -SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA-GISSHDIV--SIQNAKGLGYAMN  504
             S+L      V       + +YF   V+ ++ G+   G+  ++ V   + + +G GYA+ 
Sbjct  192  ISFLEYHVPVVGVNVTTKNSDYFVGKVKRIISGMEKYGLRVNETVFEVVDDYRGPGYAIP  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            +SE+++ +KE+A    +ILDPVY+ KA  GM+ +M  N     G+ +LFIHTGG+ GLF 
Sbjct  252  SSEDVEILKEVASIESIILDPVYTAKAFRGMI-EMFRN----SGKNVLFIHTGGIFGLFA  306

Query  323  KS  318
            +S
Sbjct  307  QS  308



>ref|WP_019470022.1| hypothetical protein [Staphylococcus sp. AL1]
Length=327

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 111/193 (58%), Gaps = 5/193 (3%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L ++ + P++IP G S+ +GT GYI A  EI +Q  +      FD I VA GSGGT AGL
Sbjct  134  LENKNKTPFMIPTGASDWIGTHGYINAFEEIIEQ--EAELGCHFDSINVAVGSGGTYAGL  191

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMN  504
              G     L  K+    V +    F   VQ ++  L+  I + D ++I ++  GLGYA  
Sbjct  192  WFGKHSHNLHTKIIGYAVNESAAAFKNKVQTIIKQLDESIDTFDTITINDSYIGLGYAQA  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            T EEL F  +IA+  G++LDP Y+GKA  GM+K++ E  K  + + ILFIHTGGL G  +
Sbjct  252  TDEELAFYIDIAQQEGIVLDPTYTGKAFRGMVKEIQEG-KYDDQQTILFIHTGGLQGYTE  310

Query  323  KSE-EMASLVGNW  288
            ++   +  L+ N+
Sbjct  311  ETRTRIQRLLPNF  323



>ref|WP_011943303.1| MULTISPECIES: D-cysteine desulfhydrase [Thermotoga]
 ref|YP_001244295.1| D-cysteine desulfhydrase [Thermotoga petrophila RKU-1]
 gb|ABQ46719.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Thermotoga petrophila RKU-1]
 gb|ACB09076.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Thermotoga sp. RQ2]
 gb|ADA66947.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Thermotoga naphthophila RKU-10]
Length=312

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 13/182 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K YVIP GGSNSLG +GY  A+ E++ QL      + FD IV A GSGGTIAGLS G
Sbjct  136  KGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLN----LESFDAIVCAVGSGGTIAGLSAG  191

Query  671  -SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA-GISSHDIV--SIQNAKGLGYAMN  504
             S+L      V       + +YF   V+ ++ G+   G+  ++ V   + + +G GYA+ 
Sbjct  192  ISFLEYHVPVVGVNVTTKNSDYFVGKVKRIISGMEEHGLKINETVFKVVDDYRGPGYAIP  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            +SE+++ +KE+A    +ILDPVY+ KA  GM+ +M  N     G+ +LFIHTGG+ GLF 
Sbjct  252  SSEDVEILKEVASIESIILDPVYTAKAFRGMI-EMFRN----SGKNVLFIHTGGIFGLFA  306

Query  323  KS  318
            +S
Sbjct  307  QS  308



>ref|WP_040029759.1| cysteine desulfhydrase [Staphylococcus cohnii]
Length=327

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 111/193 (58%), Gaps = 5/193 (3%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L ++ + P++IP G S+ +GT GYI A  EI +Q  +      FD I VA GSGGT AGL
Sbjct  134  LENKNKTPFMIPTGASDWIGTHGYINAFEEIIEQ--EAELGCHFDSINVAVGSGGTYAGL  191

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMN  504
              G     L  K+    V +    F   VQ ++  L+  I + D ++I ++  GLGYA  
Sbjct  192  WFGKHSHNLPTKIIGYAVNESAAAFKNKVQTIIKQLDESIDTFDTITINDSYIGLGYAQA  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            T EEL F  +IA+  G++LDP Y+GKA  GM+K++ E  K  + + ILFIHTGGL G  +
Sbjct  252  TDEELAFYIDIAQQEGIVLDPTYTGKAFRGMVKEIQEG-KYDDQQTILFIHTGGLQGYTE  310

Query  323  KSE-EMASLVGNW  288
            ++   +  L+ N+
Sbjct  311  ETRTRIQRLLPNF  323



>ref|XP_007037067.1| D-cysteine desulfhydrase isoform 2 [Theobroma cacao]
 gb|EOY21568.1| D-cysteine desulfhydrase isoform 2 [Theobroma cacao]
Length=305

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGR+PYVIPVGGSNSLGTWGYIEA+REIEQQLQ  +   KFDDIVVACGSGGTIAGL
Sbjct  216  LLKEGRRPYVIPVGGSNSLGTWGYIEAMREIEQQLQIRSNGVKFDDIVVACGSGGTIAGL  275

Query  680  SIGSWLSGLKAK  645
            S+GSWL  LKAK
Sbjct  276  SLGSWLGELKAK  287



>ref|WP_015595624.1| D-cysteine desulfhydrase [Bacillus sp. 1NLA3E]
 gb|AGK55582.1| D-cysteine desulfhydrase [Bacillus sp. 1NLA3E]
Length=326

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 106/190 (56%), Gaps = 9/190 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+  G +PYVIP+GGSN +G  GY++A  EI  Q Q+      FD IVV  GSGGT AGL
Sbjct  135  LIDSGHRPYVIPMGGSNGIGAQGYVDAYYEILHQEQELGL--VFDTIVVTNGSGGTYAGL  192

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSH------DIVSIQNAKGL  519
            S  +  S     +  + V +  E     +  +L  +N    +H      +I  I    GL
Sbjct  193  SYANKESHQNKTIIGMSVLNQSEEAVHDILHVLTDMNQYRDNHFCFSTSEINIIDRYIGL  252

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GY  +  +ELKF+++ A+  G+ILDPVY+GKA YG+  ++ +N    E + ILFIHTGG+
Sbjct  253  GYGKSQLDELKFIEKFAQEEGLILDPVYTGKAMYGLYNEL-KNGNFQESQNILFIHTGGI  311

Query  338  LGLFDKSEEM  309
             G  D+   M
Sbjct  312  FGWTDEKINM  321



>ref|WP_041870641.1| hypothetical protein [Latescibacteria bacterium SCGC AAA257-K07]
Length=333

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 116/199 (58%), Gaps = 10/199 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG+K Y+IPVGGSN +G++GYI    EI +Q ++     KFD ++ ACGSGGT  GL
Sbjct  139  LEREGQKAYIIPVGGSNEMGSFGYIRCAEEIVRQEEEIGI--KFDAVICACGSGGTHEGL  196

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG------LNAGISSHDIVSIQNAKGL  519
             +G  +  L A + +  V + PE+F + +  ++D       +N    S +I       G 
Sbjct  197  FLGKKIFCLDADIISYNVGETPEFFKKKIPKIVDNVINNFDINIEYDSLEIDVRGGYAGP  256

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
             Y ++T   L+ +K+IA   G+IL+P+Y+ KA +G++ ++ +   K  G  ILFIHTGG+
Sbjct  257  AYGISTDGCLQTIKDIATLEGLILEPIYTAKAMHGLIDEIKKGIYK-PGLNILFIHTGGI  315

Query  338  LGLFDKSEEMASLVGNWRK  282
             GLF +  E+    GN+++
Sbjct  316  FGLFPRRGELFG-QGNFKQ  333



>ref|WP_028828759.1| cysteine desulfhydrase [Proteocatella sphenisci]
Length=343

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 110/197 (56%), Gaps = 22/197 (11%)
 Frame = -3

Query  836  YVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWLSG  657
            Y+IP G SN +G +GYI A++EI+ Q ++     KFD IV   GS GT AGL +GS L  
Sbjct  148  YIIPEGASNGIGLFGYINAMKEIKTQEEELGM--KFDAIVSCVGSAGTYAGLVVGSKLYN  205

Query  656  LKAKVHALCVCDDPEYF----YEYVQ---GLLDGLNAGI---SSHDIVSIQNAKGLGYAM  507
            +K  V    + D    F    +EY++     L+G++  I   +  +++      G GYA+
Sbjct  206  MKCDVIGFNIADTAPNFQKRSFEYIKECCNYLEGISPEILEITEENLIITDGYAGKGYAL  265

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTE--------NPKK--WEGRKILF  357
            N S + +F+KE A   G+ LDPVY+GK   GM+ ++ +        NP     + + ILF
Sbjct  266  NVSADFEFIKEFARLEGIFLDPVYTGKTLKGMVSEIAKSNFGLEPNNPMADFSQYQNILF  325

Query  356  IHTGGLLGLFDKSEEMA  306
            IHTGGL GLF K+ EM+
Sbjct  326  IHTGGLYGLFPKAGEMS  342



>ref|WP_008695708.1| D-cysteine desulfhydrase [Fusobacterium ulcerans]
 gb|EHO83956.1| D-cysteine desulfhydrase family pyridoxal phosphate-dependent 
enzyme [Fusobacterium ulcerans 12-1B]
Length=301

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 105/180 (58%), Gaps = 24/180 (13%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G K Y+IP G SN +GT+GY++ ++EIE+Q ++      FD I+ A GSGGT  GL +G+
Sbjct  144  GHKAYIIPEGASNGIGTFGYLKCMKEIEEQEKELGI--TFDTILSAVGSGGTYGGLFLGN  201

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAKGLGYAMNTSEEL  489
             L GL+ KV  + VCDD E+F   V+ ++D              ++ + LG      E+L
Sbjct  202  KLFGLEKKVVGVNVCDDAEFFKNKVKNIVD--------------ESLEYLG------EKL  241

Query  488  KFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSEEM  309
            +F K +    G+ILDPVY+GK  YG   ++ +   K + + ILFIHTGG  GLF K EE 
Sbjct  242  EFSK-LGREEGIILDPVYTGKTMYGFYNEVKKGNLK-DCKNILFIHTGGFFGLFPKQEEF  299



>emb|CBY09114.1| unnamed protein product [Oikopleura dioica]
Length=222

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 101/184 (55%), Gaps = 7/184 (4%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   G+K YVIP GGSNS+  W YI A  E+  Q        +  DIVV  GSGGT   L
Sbjct  20   LAESGKKAYVIPRGGSNSVAAWSYIAAWEEMMNQ----PLFAEITDIVVVSGSGGTGVDL  75

Query  680  SIGSWL--SGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYA  510
            ++ ++   S  K ++H   +      FY +    L  L   ++  D++ + ++  G GYA
Sbjct  76   ALANYYERSKSKKRIHGFRIWGTNADFYHHANETLKNLKLDLNIEDLIHVTDSYVGNGYA  135

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
                E  + +  ++ETTG+ LD VY+GK  YG+ +++  NP ++ G KILFIHTGGL G+
Sbjct  136  ETWPELKELILNVSETTGIFLDTVYTGKVVYGIREELKLNPGRFAGDKILFIHTGGLFGV  195

Query  329  FDKS  318
             D S
Sbjct  196  TDGS  199



>ref|WP_026573864.1| cysteine desulfhydrase [Bacillus sp. UNC438CL73TsuS30]
Length=332

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 108/191 (57%), Gaps = 11/191 (6%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   G  PYVIP+GGSN +G  GY+EA  EI QQ Q+      FD IVV  GSGGT AGL
Sbjct  141  LTDTGHNPYVIPMGGSNGIGALGYVEAFYEILQQEQELGI--VFDTIVVTNGSGGTYAGL  198

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA------GISSHDIVSIQNAKGL  519
              G+  S     +  + V +  E     +  +L+ +N         S+ +I  I    GL
Sbjct  199  LYGNKESNQNKTIIGMSVLNQREQAVHDLLHILEDMNQYRDHHLRFSAEEINIIDRYIGL  258

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEG-RKILFIHTGG  342
            GY  +  +EL+F+++ A+  G+ILDPVY+GK+ YG+  ++ +   K +G + ILFIHTGG
Sbjct  259  GYGKSQLDELRFIEKFAQEEGIILDPVYTGKSMYGLYNELKDG--KLQGSQNILFIHTGG  316

Query  341  LLGLFDKSEEM  309
            + G  D+  +M
Sbjct  317  IFGWTDEKIKM  327



>emb|CBY35070.1| unnamed protein product [Oikopleura dioica]
Length=363

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 102/184 (55%), Gaps = 7/184 (4%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   G+K YVIP GGSNS+  W YI A  E+  Q        +  DIVV  GSGGT   L
Sbjct  161  LAESGKKAYVIPRGGSNSVAAWSYIAAWEEMMNQ----PLFAEITDIVVVSGSGGTGVDL  216

Query  680  SIGSWL--SGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYA  510
            ++ ++   S  K ++H   +      FY +    L  L   ++  D++ + ++  G GYA
Sbjct  217  ALANYYERSKSKKRIHGFRIWGTNADFYHHANETLKNLKLDLNIEDLIHVTDSYVGNGYA  276

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
                E  + +  ++ETTG+ LD VY+GKA YG+ +++  NP ++ G KILFIHTGGL G+
Sbjct  277  ETWPELKELILNVSETTGIFLDTVYTGKAVYGIREELKLNPGRFAGDKILFIHTGGLFGV  336

Query  329  FDKS  318
             D S
Sbjct  337  TDGS  340



>ref|WP_045518945.1| cysteine desulfhydrase [Bacillus niacini]
Length=326

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 105/190 (55%), Gaps = 9/190 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   G  PYVIP+GGS+ LG  GY++A  EI +Q +    E  FD IVV  GSGGT AGL
Sbjct  135  LTESGHNPYVIPMGGSDGLGALGYVDAYYEILRQEEQLGIE--FDTIVVTDGSGGTYAGL  192

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA------GISSHDIVSIQNAKGL  519
              G+  +     +  + V +  E     +  +L+ +N         S  +I  I    GL
Sbjct  193  LYGNKEANKNKTIIGMSVLNQMEQAVRDILHVLEDMNQYGDNLFRFSDKEINIIDRYIGL  252

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GY  +  +ELKF++  A   G+ILDPVY+GK+ YG+ +++ +N    E + ILFIHTGG+
Sbjct  253  GYGKSQLDELKFMERFAREEGIILDPVYTGKSMYGLYREL-KNGNLQESQNILFIHTGGM  311

Query  338  LGLFDKSEEM  309
             G  D+  +M
Sbjct  312  FGWTDEKIKM  321



>ref|WP_025641883.1| cysteine desulfhydrase [Clostridium ultunense]
Length=324

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 107/182 (59%), Gaps = 9/182 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG K Y+IP G SN +G+ GY+  + EI +Q ++     KFD ++V  GSGGT AGL
Sbjct  137  LEKEGHKAYIIPEGASNGIGSLGYVNTMEEILEQEEELGI--KFDAVIVTVGSGGTYAGL  194

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLL------DGLNAGISSHDIVSIQNAKGL  519
              G+ ++   A ++   +CD  E+F   V  LL       G N  +   +I  I    GL
Sbjct  195  YYGNHVNENSAIIYGFNICDTKEHFQNIVINLLAEIATYTGKNITVQRDEINIIDGYPGL  254

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GYA++  EE++F+   A+  G+ILDPVY+GKA YG++ ++ +  +  + + ILFIHTGGL
Sbjct  255  GYALSRPEEIEFIHYFAKREGIILDPVYTGKAMYGLVNEIKKG-RFDKHQNILFIHTGGL  313

Query  338  LG  333
             G
Sbjct  314  FG  315



>ref|WP_042740341.1| cysteine desulfhydrase [Staphylococcus gallinarum]
 gb|KIR10062.1| cysteine desulfhydrase [Staphylococcus gallinarum]
Length=324

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 105/185 (57%), Gaps = 6/185 (3%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG+ P +IPVG S+ +GT GYI A  EI +Q Q       FD I VA GSGGT AGL
Sbjct  134  LKSEGKHPLIIPVGASDWIGTHGYINAYEEILKQQQTMNIH--FDSINVAVGSGGTYAGL  191

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMN  504
              G+ +   + KV    V      F + V+ ++  ++  ++S D ++I +   GLGY   
Sbjct  192  WYGNNVHNEQTKVIGYAVDQSAPAFTDKVKEIIHDIDKSVTSFDSININDHYIGLGYGQA  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTE-NPKKWEGRKILFIHTGGLLGLF  327
            T EEL F  EIA+  G+I DP Y+GKA  G++ ++ + N    E   ILFIHTGGL G  
Sbjct  252  TDEELAFYVEIAQQEGIIFDPTYTGKAFRGLISEIKQGNYNNQE--HILFIHTGGLQGYT  309

Query  326  DKSEE  312
            +++ +
Sbjct  310  EETRQ  314



>ref|XP_003383705.1| PREDICTED: bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate 
deaminase, mitochondrial-like [Amphimedon 
queenslandica]
Length=374

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 106/187 (57%), Gaps = 17/187 (9%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L+ +G  P ++ +GG+N  G WGYIEA     Q++ D    + FDDIV+  G+GGT  G+
Sbjct  171  LIVKGHLPCIVELGGANPTGAWGYIEAF----QEMIDQGILENFDDIVMCAGTGGTALGI  226

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLL-----DGLNAGISSHDIVSIQNAKGLG  516
             + S+L+G K KVHA+C           +   L     +G++  +   DIV +     + 
Sbjct  227  GLASYLTGSKLKVHAVCTKAPSTVVATNINKELSKIKKEGMDNHLQCSDIVDL-----ID  281

Query  515  YAMNTS---EELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTG  345
               +TS   E+L F+ +++  TG+ILD  ++ K    M+ +M  NP+++ G++ILF+HTG
Sbjct  282  LHTDTSIKKEDLDFLTQVSTKTGIILDTTFTLKTVICMLHEMKYNPERFRGQRILFMHTG  341

Query  344  GLLGLFD  324
            GL GL D
Sbjct  342  GLFGLCD  348



>gb|EPS62545.1| hypothetical protein M569_12243, partial [Genlisea aurea]
Length=238

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            LL EGRKPYVIPVGGSNSLGTWGYIEAIREI++Q++      KFDDIVVACGSGGTIAGL
Sbjct  166  LLSEGRKPYVIPVGGSNSLGTWGYIEAIREIDEQVRKFGEGLKFDDIVVACGSGGTIAGL  225

Query  680  SIGSWLSGLKAKV  642
            S+GSWLS   AKV
Sbjct  226  SLGSWLSKSGAKV  238



>ref|WP_035488452.1| cysteine desulfhydrase [Gammaproteobacteria bacterium MOLA455]
 gb|ETN92326.1| L-cysteate sulfo-lyase [Gammaproteobacteria bacterium MOLA455]
Length=330

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 98/187 (52%), Gaps = 9/187 (5%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GRK Y+IP GGSN  G WGYI A  E+ +     A   +   IV A GS GT AGL +G 
Sbjct  144  GRKAYLIPTGGSNGTGMWGYIAAAEELSEDFALNAIMPQ--TIVHATGSAGTQAGLMLGC  201

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVS------IQNAKGLGYAM  507
             L  +  +V A  VCD+  YF   V+  L+   +  S    +S        +  G  Y +
Sbjct  202  QLHQINTRVKAYAVCDNAAYFTRKVRDDLEQWQSQYSPETDISRLIADTCDDYVGPAYGV  261

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENP-KKWEGRKILFIHTGGLLGL  330
               E    +K++A   G++LDPVY+GKA +GMM+D+ +       G  I+F+HTGGL GL
Sbjct  262  ADQEVFDCIKQVAALEGILLDPVYTGKAFFGMMEDIKKGKFSHQPGGDIVFLHTGGLFGL  321

Query  329  FDKSEEM  309
            F +   +
Sbjct  322  FAQHHHL  328



>ref|WP_022545791.1| hypothetical protein [Bacteroidales bacterium CF]
 gb|AGY53719.1| Putative 1-aminocyclopropane-1-carboxylate deaminase [Bacteroidales 
bacterium CF]
Length=325

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 100/184 (54%), Gaps = 9/184 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G K ++IP G S  +G  GY   + EI   +Q+      F+ IVVA GSGGT AGL + 
Sbjct  140  KGHKAFIIPEGASFGIGVLGYYSCLEEI--AIQEKQMGVTFNTIVVATGSGGTFAGLYLA  197

Query  671  SWLSGLKAKVHALCVCDDPEYF----YEYVQGLLD--GLNAGISSHDIVSIQNAKGLGYA  510
            +       ++  + VCDD EYF    Y   +  L+  G +  I   D+       G+GYA
Sbjct  198  NKFHKYGKRIIGMAVCDDVEYFRNISYNISKDALEHIGESIDIEKEDMEINDRHVGIGYA  257

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            ++  +EL F+ + A   GVILDPVY+GKA  G+  ++ +   K  G  +LFIHTGGL GL
Sbjct  258  ISKKDELDFITDFARKEGVILDPVYTGKAMKGLYSEIMDKTIKNPG-NVLFIHTGGLFGL  316

Query  329  FDKS  318
            F K 
Sbjct  317  FPKQ  320



>ref|WP_035525771.1| cysteine desulfhydrase [Haliea salexigens]
Length=338

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 105/191 (55%), Gaps = 12/191 (6%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
             G+K  VIP GGS+ LG WGYI A  E+ + L     E     +V A GSGGT AGL++G
Sbjct  147  RGKKALVIPTGGSDGLGIWGYIAACEELREDLARADIESAH--LVTATGSGGTQAGLTLG  204

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYV-------QGLLDGLNAGISSHDIVSIQNAKGLGY  513
            + L  L   V  + VCDD  YF   V       +    G  A   +  +  I    G GY
Sbjct  205  TTLHALPLTVWGVNVCDDEAYFLNKVATDVADWRSRFPGQPAATVTPRV--IDGYVGAGY  262

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
             + + E L+ + ++A   GV+LDPVY+GKA +G++K++    +  + R I+F+H+GG+ G
Sbjct  263  GVASPEVLRVIADLAALEGVLLDPVYTGKAFHGLVKELPTG-RFDDQRDIVFLHSGGVFG  321

Query  332  LFDKSEEMASL  300
            +F ++++   L
Sbjct  322  VFPQADQFGFL  332



>ref|WP_016565713.1| putative pyridoxal-phosphate-dependent enzyme [Clostridium sp. 
CAG:226]
 emb|CCX50187.1| putative pyridoxal-phosphate-dependent enzyme [Clostridium sp. 
CAG:226]
Length=323

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 101/180 (56%), Gaps = 12/180 (7%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQ--KFDDIVVACGSGGTIAGLSI  675
            G  PY++PVGGS  LGT GY++  REI  +    A EQ  K + IV   GSGGT+AGL +
Sbjct  142  GHNPYLVPVGGSVPLGTVGYVDCAREIFAE----ALEQDIKINRIVSTAGSGGTLAGLVL  197

Query  674  GSWLSGLKAKVHALCVCDDP--EYFYEYVQGLLD--GLNAGISSHDIVSIQNAKGLGYAM  507
            G+ L G   KV  + VCDDP  E   E V G  +  G +  +   DI  I    G GYA 
Sbjct  198  GAMLYGDGCKVTGVAVCDDPFEEITAELVNGAAEILGADVHVEPKDI-DILRYYGAGYAQ  256

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
             + E L+ +  +A+  G+ILDPVY+GKA  G+M  +    K  E   +LF+H+GG   LF
Sbjct  257  PSKEGLEAITLMAQQEGLILDPVYTGKAFAGLMH-LIRTGKIGENETVLFLHSGGTASLF  315



>dbj|GAL63705.1| pyridoxal phosphate-dependent deaminase putative [Algibacter 
lectus]
Length=326

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 114/191 (60%), Gaps = 14/191 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EG+K YV+P GGSN LG +G+++A++E+++QL  T    K D I  A  SGGT AGL +G
Sbjct  138  EGKKVYVVPYGGSNLLGAYGFVDAVKELKEQL--TEMNLKMDYIFFASSSGGTQAGLRLG  195

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYV-QGLLDGLNAGISSHDI---VSIQNAKGL-----  519
              L  +  K+  + + D   Y Y+ + + +L+ L  G  S  I    SI +A+ +     
Sbjct  196  IDLFEVDTKLMPISI-DKIGYEYKTLAEAVLELLKEGQKSLRIKKTYSIDDARLIHGYDS  254

Query  518  -GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGG  342
             GY + TS E   +KE+AE  G++LDPVYSG+A YGM+ D  ++ K  +G  ILF HTGG
Sbjct  255  KGYGVVTSNEKSAIKELAENEGILLDPVYSGRAFYGML-DHIKSQKIEKGANILFWHTGG  313

Query  341  LLGLFDKSEEM  309
            L   F  SEE+
Sbjct  314  LPANFYYSEEL  324



>ref|WP_042505529.1| cysteine desulfhydrase [Algibacter lectus]
Length=332

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 114/191 (60%), Gaps = 14/191 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EG+K YV+P GGSN LG +G+++A++E+++QL  T    K D I  A  SGGT AGL +G
Sbjct  144  EGKKVYVVPYGGSNLLGAYGFVDAVKELKEQL--TEMNLKMDYIFFASSSGGTQAGLRLG  201

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYV-QGLLDGLNAGISSHDI---VSIQNAKGL-----  519
              L  +  K+  + + D   Y Y+ + + +L+ L  G  S  I    SI +A+ +     
Sbjct  202  IDLFEVDTKLMPISI-DKIGYEYKTLAEAVLELLKEGQKSLRIKKTYSIDDARLIHGYDS  260

Query  518  -GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGG  342
             GY + TS E   +KE+AE  G++LDPVYSG+A YGM+ D  ++ K  +G  ILF HTGG
Sbjct  261  KGYGVVTSNEKSAIKELAENEGILLDPVYSGRAFYGML-DHIKSQKIEKGANILFWHTGG  319

Query  341  LLGLFDKSEEM  309
            L   F  SEE+
Sbjct  320  LPANFYYSEEL  330



>ref|WP_040802912.1| cysteine desulfhydrase [gamma proteobacterium BDW918]
Length=339

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 102/187 (55%), Gaps = 9/187 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
             GRK ++IP G S+++G WGY++A  E+++  Q    + K   I+ A GSGGT AGL++G
Sbjct  151  SGRKAFIIPTGASDAIGVWGYVQACAELQEDFQRHGIDPKH--IICATGSGGTQAGLTVG  208

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDG----LNAGIS--SHDIVSIQNAKGLGYA  510
                G+ A+V  + VCDD  +F   V   L         GI      ++ I    G GYA
Sbjct  209  VAAYGIDAQVWGVNVCDDEAWFVNKVNSDLQSWERRYQTGIDLDCLSVMVIDGYVGPGYA  268

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
                E  + + ++A T G++LDPVY+GKA +GM+  + +      G  I+F+HTGG+ GL
Sbjct  269  QADDEIYRCIADVAATEGLVLDPVYTGKAFFGMLDQLQKGLFGSTG-DIVFVHTGGVYGL  327

Query  329  FDKSEEM  309
            F +    
Sbjct  328  FPQRSHF  334



>ref|WP_041083355.1| cysteine desulfhydrase [Thermotoga profunda]
Length=340

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 103/188 (55%), Gaps = 16/188 (9%)
 Frame = -3

Query  854  HEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSI  675
             +G K Y IP GGSNSLG  GY+ A  EI  Q+       +FD I  A GSGGT AGL  
Sbjct  160  RKGLKVYTIPEGGSNSLGAMGYVYAAAEIISQVD----LDEFDAIYCAVGSGGTYAGLIA  215

Query  674  GSWLSGLKAKVHALCVCDDP-----EYFYEYVQGLLD-GLNAGISSHDIVSIQNAKGLGY  513
            G    G K KV  + V         E   + V+G+ D G++  I   +I  I +  G  Y
Sbjct  216  GLRYMGYKTKVIGINVTKTSSQRFVEKIEQIVKGMKDFGIDVRIEKKEIEIIDDFSGPAY  275

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            A+ T  +L ++K +A   G+ILDPVY+ K   GM+    E  KK  G+KILFIHTGGL G
Sbjct  276  AIPTESDLDYIKHVASNEGIILDPVYTAKTFRGMI----ETSKK--GQKILFIHTGGLFG  329

Query  332  LFDKSEEM  309
            LF ++++ 
Sbjct  330  LFAQADKF  337



>ref|WP_017723753.1| hypothetical protein [Staphylococcus xylosus]
Length=327

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 99/177 (56%), Gaps = 4/177 (2%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +G + + IP G S  +G+ GYI A  EI +Q  +   + +FD I +A GSGGT AGL
Sbjct  134  LEKQGERTFAIPAGASGWIGSHGYINAFNEIVEQ--EKEMDVQFDSINLAVGSGGTYAGL  191

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQ-NAKGLGYAMN  504
              G+   GL   +    V      F   +  +L  L+  ISS D++SI  N  GLGY   
Sbjct  192  WYGNIKDGLNKNIMGFAVTQSAHEFKTKIIEILTHLDDSISSFDMISINDNYIGLGYGQA  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            T EEL+F  +IA+  G+ILDP Y+GKA  G+++++       +   ILFIHTGGL G
Sbjct  252  TDEELQFYIDIAQQEGIILDPTYTGKAFRGLVEEIKAGSYDNQ-NNILFIHTGGLQG  307



>gb|EIF44157.1| D-cysteine desulfhydrase [gamma proteobacterium BDW918]
Length=347

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 102/186 (55%), Gaps = 9/186 (5%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GRK ++IP G S+++G WGY++A  E+++  Q    + K   I+ A GSGGT AGL++G 
Sbjct  160  GRKAFIIPTGASDAIGVWGYVQACAELQEDFQRHGIDPKH--IICATGSGGTQAGLTVGV  217

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDG----LNAGIS--SHDIVSIQNAKGLGYAM  507
               G+ A+V  + VCDD  +F   V   L         GI      ++ I    G GYA 
Sbjct  218  AAYGIDAQVWGVNVCDDEAWFVNKVNSDLQSWERRYQTGIDLDCLSVMVIDGYVGPGYAQ  277

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
               E  + + ++A T G++LDPVY+GKA +GM+  + +      G  I+F+HTGG+ GLF
Sbjct  278  ADDEIYRCIADVAATEGLVLDPVYTGKAFFGMLDQLQKGLFGSTG-DIVFVHTGGVYGLF  336

Query  326  DKSEEM  309
             +    
Sbjct  337  PQRSHF  342



>ref|WP_006929754.1| Pyridoxal-5'-phosphate-dependent protein beta subunit [Caldithrix 
abyssi]
 gb|EHO42416.1| Pyridoxal-5'-phosphate-dependent protein beta subunit [Caldithrix 
abyssi DSM 13497]
Length=315

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 96/178 (54%), Gaps = 14/178 (8%)
 Frame = -3

Query  842  KPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGSWL  663
            K YVIP GGSN+LG WGY++A  EI QQL +       D IV   GS GT AGL    WL
Sbjct  140  KTYVIPEGGSNALGAWGYVKAFDEITQQLPEA------DAIVAPTGSIGTHAGLLFARWL  193

Query  662  SGLKAKVHALCVCDDPEYFYEYVQGL-LD-----GLNAGISSHDIVSIQNAKGLGYAMNT  501
                 ++ ++ VCD  ++F + +  L LD          I   DI  +    G GY   T
Sbjct  194  KKHPCQIVSINVCDTADFFRQKLLHLALDFKLQFAPQMTIYEDDIHIVDGFVGTGYGQVT  253

Query  500  SEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
              E+  +KE+A+  G +LDPVY+ KA  G+  +M     K  G KI+F+HTGG+ GLF
Sbjct  254  EREISKIKEVAQKYGFLLDPVYTVKAWMGL--EMLLKEGKLPGEKIVFLHTGGIFGLF  309



>gb|EHQ57260.1| 1-aminocyclopropane-1-carboxylate deaminase [gamma proteobacterium 
HIMB55]
Length=325

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 100/192 (52%), Gaps = 7/192 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
             G K   IP+GGS+++G WGYI A+ E+ + ++          IV A GSGGT AGL+ G
Sbjct  135  RGEKALTIPIGGSDAMGIWGYIAAVEELAEDMKRNDLSSA--AIVHATGSGGTQAGLNAG  192

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAG---ISSHDIVSIQNAK--GLGYAM  507
              L  + A V +  VCDD  YF    Q     L A    + S  I ++ N K  G GY  
Sbjct  193  VLLHEVNADVISYAVCDDEAYFNAKAQEDWSNLRARRPELPSAPIKTLTNDKYIGPGYGK  252

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
               E    + E+A+  G+ LDPVY+GKA YG++ D+           I+F+HTGG+ G+F
Sbjct  253  AGEEIFDALAELAQLEGITLDPVYTGKAFYGLITDLASGAFASHASDIIFMHTGGVFGIF  312

Query  326  DKSEEMASLVGN  291
              +  + + +G 
Sbjct  313  PHASAVEAALGR  324



>ref|WP_040801727.1| cysteine desulfhydrase [gamma proteobacterium HIMB55]
Length=334

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 100/192 (52%), Gaps = 7/192 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
             G K   IP+GGS+++G WGYI A+ E+ + ++          IV A GSGGT AGL+ G
Sbjct  144  RGEKALTIPIGGSDAMGIWGYIAAVEELAEDMKRNDLSSA--AIVHATGSGGTQAGLNAG  201

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAG---ISSHDIVSIQNAK--GLGYAM  507
              L  + A V +  VCDD  YF    Q     L A    + S  I ++ N K  G GY  
Sbjct  202  VLLHEVNADVISYAVCDDEAYFNAKAQEDWSNLRARRPELPSAPIKTLTNDKYIGPGYGK  261

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
               E    + E+A+  G+ LDPVY+GKA YG++ D+           I+F+HTGG+ G+F
Sbjct  262  AGEEIFDALAELAQLEGITLDPVYTGKAFYGLITDLASGAFASHASDIIFMHTGGVFGIF  321

Query  326  DKSEEMASLVGN  291
              +  + + +G 
Sbjct  322  PHASAVEAALGR  333



>emb|CEF17799.1| D-cysteine desulfhydrase [Staphylococcus xylosus]
Length=329

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 100/174 (57%), Gaps = 4/174 (2%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G++ + IP G S+ +G+ GYI A  EI +Q  +T  + +FD I +A GSGGT AGL  G
Sbjct  137  QGKRTFAIPTGASDWIGSHGYINAFNEIVEQ--ETDMDVQFDSINLAVGSGGTYAGLWYG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
            + +  L   +    V      F   +  +L  L+  I+S D +SI +   GLGY   T E
Sbjct  195  NIIHDLNKNITGFAVTQSAYEFKTKIIDILTHLDDSIASFDTISINDDYIGLGYGQATDE  254

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            EL+F  +IA+  G+ILDP Y+GKA  G+++++       +   ILFIHTGGL G
Sbjct  255  ELQFYIDIAQQEGIILDPTYTGKAFRGLVEEIKAGSYDNQ-NNILFIHTGGLQG  307



>ref|WP_013362190.1| D-cysteine desulfhydrase [[Clostridium] sticklandii]
 emb|CBH22098.1| D-cysteine desulfhydrase [ [[Clostridium] sticklandii]
Length=329

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 99/182 (54%), Gaps = 9/182 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  +GRK YV+P+G SN +G +GY  A+ EI +Q +       FD IV   GS GT AGL
Sbjct  139  LESKGRKGYVLPIGASNGIGGFGYFYAMNEILEQEKTLGIH--FDAIVTTVGSAGTFAGL  196

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLL------DGLNAGISSHDIVSIQNAKGL  519
               + L    A V+ + +  D EYF    + ++       G N  +S  +I  I    G 
Sbjct  197  LYANTLVKNDAVVYGINISADREYFAGETKKIIAEMNEYTGENISLSYDEISIIDGYAGR  256

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GY ++T EE+ F+K IA   GV LDPVY+GKA YG+  ++ +       + ILFIHTGG+
Sbjct  257  GYGLSTKEEIDFIKYIASLEGVALDPVYTGKAFYGLYNEIKKGNLSNH-KNILFIHTGGI  315

Query  338  LG  333
             G
Sbjct  316  FG  317



>ref|WP_037258113.1| 1-aminocyclopropane-1-carboxylate deaminase [Rhodococcus rhodnii]
Length=335

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 105/194 (54%), Gaps = 12/194 (6%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            EGRK   IPVGGSN++G  GY+ A  E+  QL +       D IVVA GS GT AGL++G
Sbjct  149  EGRKTATIPVGGSNAVGVLGYVAAAEELHGQLSE------IDRIVVAVGSAGTAAGLALG  202

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD--GLNAGISSHDIVSIQNAK---GLGYAM  507
              L G    + A CV    E     ++ L+D  G   G+ + D+  ++ +    G GY +
Sbjct  203  IHLLGWPVLLDARCVSHTAEESRADIRRLVDETGQLLGVGTGDLAHLRVSDDFVGPGYGI  262

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
             T E  + ++  A T G+ LDPVYSGKAA G++ D+       +   + F+HTGGL GLF
Sbjct  263  PTDEMWQALRLFARTEGITLDPVYSGKAAAGLVADVRSGAIGPD-ETVAFMHTGGLPGLF  321

Query  326  DKSEEMASLVGNWR  285
              + E+  L  N R
Sbjct  322  AYAPELVRLSENLR  335



>ref|WP_041446158.1| hypothetical protein, partial [Thermovirga lienii]
Length=324

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 105/185 (57%), Gaps = 13/185 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G  PY++P+G SN+LG  GY+E   EI   +Q      +FD +V+ CGS GT+AGL+ G
Sbjct  145  KGLNPYIVPLGASNALGALGYVETAAEIA--MQAGELNVRFDHVVLPCGSAGTLAGLATG  202

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGL--------LDGLNAGISSHDIVSIQNAKGLG  516
                  K ++  + V  + ++  + V  L        L  LN  + +  +  + +  G G
Sbjct  203  FSHLESKTQIWGISVSFEKQWIKDKVSELTQEIKKFFLPQLNTPLENFHV--LDSYIGEG  260

Query  515  YAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLL  336
            Y   T ++LK + EIA   G++LDPVY+GKA +G+ +++     K +G K+LF+HTGG+ 
Sbjct  261  YGKTTPQQLKMIHEIASMEGIVLDPVYTGKAFWGLKEEIQRGTFK-KGHKVLFLHTGGIF  319

Query  335  GLFDK  321
            GLF +
Sbjct  320  GLFAR  324



>gb|AER67420.1| D-cysteine desulfhydrase [Thermovirga lienii DSM 17291]
Length=345

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 105/185 (57%), Gaps = 13/185 (7%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G  PY++P+G SN+LG  GY+E   EI   +Q      +FD +V+ CGS GT+AGL+ G
Sbjct  145  KGLNPYIVPLGASNALGALGYVETAAEIA--MQAGELNVRFDHVVLPCGSAGTLAGLATG  202

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGL--------LDGLNAGISSHDIVSIQNAKGLG  516
                  K ++  + V  + ++  + V  L        L  LN  + +  +  + +  G G
Sbjct  203  FSHLESKTQIWGISVSFEKQWIKDKVSELTQEIKKFFLPQLNTPLENFHV--LDSYIGEG  260

Query  515  YAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLL  336
            Y   T ++LK + EIA   G++LDPVY+GKA +G+ +++     K +G K+LF+HTGG+ 
Sbjct  261  YGKTTPQQLKMIHEIASMEGIVLDPVYTGKAFWGLKEEIQRGTFK-KGHKVLFLHTGGIF  319

Query  335  GLFDK  321
            GLF +
Sbjct  320  GLFAR  324



>ref|WP_028398585.1| cysteine desulfhydrase [Bacillus sp. FJAT-14578]
Length=326

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 103/190 (54%), Gaps = 9/190 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   G KPYVIP+GGSN  G  GY+EA  EI +Q +       FD IVVA GSGGT AGL
Sbjct  135  LTDSGHKPYVIPMGGSNGTGALGYLEAYYEILRQEEQLGM--VFDTIVVANGSGGTYAGL  192

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA------GISSHDIVSIQNAKGL  519
              G+        +  + V +  E     +  +L+ +N           ++I  I    GL
Sbjct  193  LYGNKECNKDKTIIGISVLNQKEQAVHDILHVLEDMNQYRADPYSFKDNEINIIDRYIGL  252

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GY  +  +ELKF+++ A+  G+ILDP Y+GK+ YG+  ++ +N    + + +LFIHTGG+
Sbjct  253  GYGKSQLDELKFIEKFAQEEGIILDPAYTGKSMYGLYHEL-KNGNLQDSQNLLFIHTGGI  311

Query  338  LGLFDKSEEM  309
             G  D+   M
Sbjct  312  FGWTDEKINM  321



>ref|WP_002470882.1| D-cysteine desulfhydrase [Staphylococcus pettenkoferi]
 gb|EHM72659.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [Staphylococcus pettenkoferi VCU012]
Length=322

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 99/177 (56%), Gaps = 4/177 (2%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG++P ++PVG S+ +GT GY+ A +EI +Q        KFD I VA GSGGT AGL
Sbjct  134  LQEEGKRPLIVPVGASDWIGTHGYVNAYKEILKQEHQLGI--KFDVINVAVGSGGTYAGL  191

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMN  504
              G+       ++    V  D E F E V+ L+  L+  ++    + I +   G GY   
Sbjct  192  WYGNHHYQSNKQIVGYAVDADRETFTEKVKDLVKDLDKSVTDFKTIDINDHYVGQGYGQA  251

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
              EEL+F  +IA+  G++LD  Y+GKA  GM+ ++ EN    +   ILFIHTGGL G
Sbjct  252  MDEELRFYIDIAQKEGLVLDSTYTGKAFRGMLTEL-ENGTFDDAENILFIHTGGLQG  307



>ref|WP_029378211.1| cysteine desulfhydrase [Staphylococcus xylosus]
Length=327

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 99/174 (57%), Gaps = 4/174 (2%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G++ + IP G S+ +G+ GYI A  EI +Q  +T  + +FD I +A GSGGT AGL  G
Sbjct  137  QGKRTFAIPTGASDWIGSHGYINAFNEIVEQ--ETDMDVQFDSINLAVGSGGTYAGLWYG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
            +    L   +    V      F   +  +L  L+  I+S D +SI +   GLGY   T E
Sbjct  195  NISHDLNKNITGFAVTQSAYEFKTKIIDILTHLDDSIASFDTISINDDYIGLGYGQATDE  254

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            EL+F  +IA+  G+ILDP Y+GKA  G+++++       +   ILFIHTGGL G
Sbjct  255  ELQFYIDIAQQEGIILDPTYTGKAFRGLVEEIKAGSYDNQ-NNILFIHTGGLQG  307



>ref|WP_038679163.1| cysteine desulfhydrase [Staphylococcus xylosus]
 gb|AID02386.1| cysteine desulfhydrase [Staphylococcus xylosus]
Length=329

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 99/174 (57%), Gaps = 4/174 (2%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G++ + IP G S+ +G+ GYI A  EI +Q  +T  + +FD I +A GSGGT AGL  G
Sbjct  137  QGKRTFAIPTGASDWIGSHGYINAFNEIVEQ--ETDMDVQFDSINLAVGSGGTYAGLWYG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
            +    L   +    V      F   +  +L  L+  I+S D +SI +   GLGY   T E
Sbjct  195  NISHDLNKNITGFAVTQSAYEFKTKIIDILTHLDDSIASFDTISINDDYIGLGYGQATDE  254

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            EL+F  +IA+  G+ILDP Y+GKA  G+++++       +   ILFIHTGGL G
Sbjct  255  ELQFYIDIAQQEGIILDPTYTGKAFRGLVEEIKAGSYDNQ-NNILFIHTGGLQG  307



>ref|WP_012238709.1| D-cysteine desulfhydrase [Sorangium cellulosum]
 emb|CAN96244.1| yedO [Sorangium cellulosum So ce56]
Length=329

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 112/187 (60%), Gaps = 9/187 (5%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQ-DTAFEQKFDDIVVACGSGGTIAGLSIG  672
            G +PYVIP GGSN LG  GY+ A+ EI +QL    A  + FD IV ACGSGGT AG ++G
Sbjct  143  GGRPYVIPEGGSNGLGALGYVRAMEEIRKQLDLGLAGGKPFDVIVHACGSGGTAAGTALG  202

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNA-----GISSHDIVSIQNAKGLGYAM  507
            +    +  +V ++ VC+D   F   V G++D   A     G  +H ++   +AKG  Y +
Sbjct  203  AARYEVAGEVRSMAVCEDRATFARIVVGIMDDARALEPRLGSPAHLVID-DSAKGPAYGV  261

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
            +T E+   + ++A  +G++LDPVY+GKA  G+  D+ E   +  G+++LF+HTGGL GL 
Sbjct  262  STPEQRARILQVARLSGLVLDPVYTGKAFSGLW-DLAER-GELSGKRVLFLHTGGLPGLL  319

Query  326  DKSEEMA  306
             +    A
Sbjct  320  AQGATFA  326



>ref|WP_007227684.1| D-cysteine desulfhydrase [marine gamma proteobacterium HTCC2148]
 gb|EEB79648.1| pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase 
family [marine gamma proteobacterium HTCC2148]
Length=333

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 100/187 (53%), Gaps = 16/187 (9%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +GRK   IP GGS+ +G WGY+ A  E+   +Q    EQ    +V A GSGGT AGL++G
Sbjct  149  QGRKALAIPTGGSDGIGVWGYLSAAAELANDMQLAGIEQAH--VVCASGSGGTQAGLTLG  206

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLL--------DGLNAGISSHDIVSIQNAKGLG  516
            + L  +   V  + VCDD  YF   V   +         G NA I +     I    G G
Sbjct  207  AALHRMPVSVWGVNVCDDEHYFLNKVADDVADWRSRYPGGPNAEIETR---VIDGYVGAG  263

Query  515  YAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEG-RKILFIHTGGL  339
            Y     E  + + E+    G++LDPVY+GKA  GM+ ++     +++G R I+FIHTGG+
Sbjct  264  YGKAGPEVFELIAELGRLEGILLDPVYTGKAFSGMLAEIEAG--RFDGYRDIVFIHTGGV  321

Query  338  LGLFDKS  318
             GLF +S
Sbjct  322  FGLFPQS  328



>ref|WP_034264832.1| hypothetical protein, partial [Aminiphilus circumscriptus]
Length=327

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 99/182 (54%), Gaps = 10/182 (5%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G + Y+IP+G SN LG  GY++A+ E+  Q+   A   +   +V A GSGGT+AGL  G
Sbjct  146  QGTRAYIIPLGASNPLGCLGYVDAVTEMIPQM--AALPSRPRHLVTAVGSGGTLAGLVAG  203

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAG-------ISSHDIVSIQNAKGLGY  513
              L  L  ++ A+ V    +   + VQ LL+GL          +    +  + +  G GY
Sbjct  204  VLLHKLPWRITAISVAYPRQQVLDTVQNLLEGLRRSDFPDLGTLPRETLTVLDDYLGEGY  263

Query  512  AMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
               T E+L+F+   A T   +LDPVY+GKA YG+ +++    +  +   +LF+HTGG  G
Sbjct  264  GTTTPEQLRFIATAAATEEQLLDPVYTGKAFYGLSREIAAG-RFPKDEPVLFLHTGGAFG  322

Query  332  LF  327
            LF
Sbjct  323  LF  324



>ref|WP_042362002.1| cysteine desulfhydrase [Staphylococcus xylosus]
 gb|AID41801.1| 1-aminocyclopropane-1-carboxylate deaminase [Staphylococcus xylosus]
Length=329

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 99/174 (57%), Gaps = 4/174 (2%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G++ + +P G S+ +G+ GYI A  EI +Q  +T  + +FD I +A GSGGT AGL  G
Sbjct  137  QGKRTFAVPTGASDWIGSHGYINAFNEIVEQ--ETDMDVQFDSINLAVGSGGTYAGLWYG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
            +    L   +    V      F   +  +L  L+  I+S D +SI +   GLGY   T E
Sbjct  195  NISHDLNKNITGFAVTQSAYEFKTKIIDILTHLDDSIASFDTISINDDYIGLGYGQATDE  254

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            EL+F  +IA+  G+ILDP Y+GKA  G+++++       +   ILFIHTGGL G
Sbjct  255  ELQFYIDIAQQEGIILDPTYTGKAFRGLVEEIKAGSYDNQ-NNILFIHTGGLQG  307



>ref|WP_041079351.1| cysteine desulfhydrase [Staphylococcus saprophyticus]
 gb|KIJ87959.1| cysteine desulfhydrase [Staphylococcus saprophyticus]
Length=329

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 109/194 (56%), Gaps = 6/194 (3%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G+ P++IPVG S+ +GT GY+ A  EI +Q QD   +  FD I VA GSGGT AGL  G
Sbjct  137  QGKTPFLIPVGASDWIGTHGYVNAYNEIIKQ-QD-ELKVHFDSINVAVGSGGTYAGLWYG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
              ++    ++    V  +   F   V  ++  L+  I S++ ++I +A  GLGY   T E
Sbjct  195  QMINCETTQIIGYAVDQNAHAFKNKVIEIIKQLDETIQSYETITINDAYIGLGYGKATDE  254

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSE  315
            EL+F  +IA+  G+ILDP Y+GKA  G++ ++       +   ILFIHTGGL G     E
Sbjct  255  ELQFYIDIAQKEGIILDPTYTGKAFRGLVHEIKSGAYDNQDN-ILFIHTGGLQGY--TQE  311

Query  314  EMASLVGNWRKMDI  273
            +   L     K+D+
Sbjct  312  KRLRLQTMLHKIDL  325



>ref|WP_044244732.1| cysteine desulfhydrase [Chondromyces apiculatus]
 gb|EYF04101.1| 1-aminocyclopropane-1-carboxylate deaminase [Chondromyces apiculatus 
DSM 436]
Length=332

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 111/186 (60%), Gaps = 7/186 (4%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQ-DTAFEQKFDDIVVACGSGGTIAGLSIG  672
            G KPYVIP GGSN LG  GY+ A+ E+ +QL    A  + FD IV ACGSGGT AGL++G
Sbjct  143  GGKPYVIPEGGSNGLGALGYVRAMEEVRRQLDLGLASGKPFDVIVHACGSGGTAAGLALG  202

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLD---GLNAGISSHDIVSI-QNAKGLGYAMN  504
            +    +  +V  + VCDD   F   + G++D    L   + S   + + + A+G  YA+ 
Sbjct  203  AAHYEVAEEVRTMVVCDDAPTFERIIAGIVDEARALEPALGSPATLRVDERARGPAYAVA  262

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            T E+ + + E A   G+ LDPVY+GKA  G+  +M E   +  G+++LF+HTGGL GL  
Sbjct  263  TPEQRRRIVEAARLGGLALDPVYTGKAFSGLW-EMAER-GELAGKRVLFLHTGGLPGLLV  320

Query  323  KSEEMA  306
            +++  A
Sbjct  321  QADAFA  326



>ref|WP_039069285.1| cysteine desulfhydrase [Staphylococcus xylosus]
Length=329

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 100/174 (57%), Gaps = 4/174 (2%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G+ P+ IPVG S+ +GT GYI A  E+ +Q  D   +  FD I +A GSGGT AGL  G
Sbjct  137  QGKHPFTIPVGASDWIGTHGYINAFDEVVEQESDMNVQ--FDSINLAVGSGGTYAGLWYG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
            +    L   +    V    + F   +  +L+ L+  I+S++ + I +   GLGY   T E
Sbjct  195  NISHDLNKNIIGFAVDQSTDAFKTKIIEILNHLDDNIASYETLFINDDYIGLGYGQATDE  254

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            EL+F  +IA+  G+ILDP Y+GKA  G+++++       +   ILFIHTGGL G
Sbjct  255  ELQFYIDIAQQEGIILDPTYTGKAFRGLVEEIKAGNYD-DQNNILFIHTGGLQG  307



>ref|WP_009019997.1| D-cysteine desulfhydrase [Luminiphilus syltensis]
 gb|EED35251.1| D-cysteine desulfhydrase [Luminiphilus syltensis NOR5-1B]
Length=337

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 97/192 (51%), Gaps = 8/192 (4%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            G KP VIP GGS+ LG WGYI  + E+               +V A GSGGT AGL  GS
Sbjct  148  GLKPLVIPTGGSDGLGAWGYIAGVEELAADFAQQGLVNPL--LVTATGSGGTQAGLIAGS  205

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGIS-----SHDIVSIQNAKGLGYAMN  504
             L  L  ++  + VCDD +YF   V   +  L          +  + +I    G GY + 
Sbjct  206  ALHDLDVRIVGMAVCDDADYFSRKVSKDIAELQQRFPDLPEFAFSVETIDRYVGEGYGIA  265

Query  503  TSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFD  324
            + E  + + E+    GV+LDPVY+ KA  G++ ++       +   I+F+HTGG+ G+F 
Sbjct  266  SEEVYRLIAELGALEGVVLDPVYAAKAFLGLITEVASGSFD-DHSDIVFLHTGGVFGVFP  324

Query  323  KSEEMASLVGNW  288
             +E+++S    W
Sbjct  325  HAEKLSSAHNGW  336



>ref|WP_005540296.1| hypothetical protein [Johnsonella ignava]
 gb|EHI55922.1| hypothetical protein HMPREF9333_00965 [Johnsonella ignava ATCC 
51276]
Length=356

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 108/217 (50%), Gaps = 36/217 (17%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
             G+  Y+IP+G SN++G +GY+EAIREI  Q ++      FD IV   GS GT AGL +G
Sbjct  142  NGQNGYIIPMGASNAIGMFGYMEAIREILSQEKELGIH--FDAIVDTVGSTGTFAGLVLG  199

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGL--------------NAGISSHDIVSIQ  534
            + +      +    V ++  YF E     +                 + GI   D   I 
Sbjct  200  NVIYNAGFDIIGFSVSEERSYFQEVTYNNIKDCCKYISNENYTHTPQSLGIKKEDFNIID  259

Query  533  NAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMT----ENP-------  387
              +G GY +N+ ++ K +K +A   G+ +DPVY+GKA  GM+ ++     +NP       
Sbjct  260  LYRGEGYGINSPDDFKLIKHLASKEGIFIDPVYTGKAFKGMLSEIRHSQLKNPVGSDIPK  319

Query  386  -------KKWEGRKILFIHTGGLLGLFDKSEEMASLV  297
                    K+E   ILFIHTGGL GLF K+ E+A  +
Sbjct  320  DGIHADFSKYEN--ILFIHTGGLFGLFPKAAEIADCI  354



>ref|WP_015046098.1| D-cysteine desulfhydrase [Simiduia agarivorans]
 gb|AFU97925.1| D-cysteine desulfhydrase [Simiduia agarivorans SA1 = DSM 21679]
Length=354

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 105/197 (53%), Gaps = 18/197 (9%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G + Y IP GGSN  G WGYI    E+  Q            IV A GSGGT AGL++G
Sbjct  151  QGLRAYGIPTGGSNGTGLWGYIAGTEELHGQCVSQGLVPS--HIVTATGSGGTQAGLTLG  208

Query  671  SWLSGLKAKVHALCVCDD------------PEYFYEYVQGLLDGLN-AGISSHDI--VSI  537
            S L+GL  KV  + VCDD             E+F ++       L  AG+S  D+  +++
Sbjct  209  SALTGLGCKVLGMAVCDDAAWFNRKVAEDMAEWFQQFTPLAERNLEVAGVSLSDLQAITL  268

Query  536  QNAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILF  357
             N  G  YA+   +  + ++  A   G++LDPVY+GKA +G+++++     +   R ++F
Sbjct  269  DNYVGPAYAVADPDVFETIQLAASLEGLVLDPVYTGKAFHGLLQELRAGSLR-HARDVVF  327

Query  356  IHTGGLLGLFDKSEEMA  306
            +HTGG+ G+F +  + A
Sbjct  328  VHTGGIFGVFPQRAQFA  344



>ref|WP_011302317.1| D-cysteine desulfhydrase [Staphylococcus saprophyticus]
 dbj|BAE17483.1| putative 1-aminocyclopropane-1-carboxylate deaminase [Staphylococcus 
saprophyticus subsp. saprophyticus ATCC 15305]
Length=328

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 101/174 (58%), Gaps = 4/174 (2%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G+ P++IPVG S+ +GT GY+ A  EI +Q QD   +  FD I VA GSGGT AGL  G
Sbjct  136  QGKTPFLIPVGASDWIGTHGYVNAYNEIIKQ-QD-ELKVHFDSINVAVGSGGTYAGLWYG  193

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
              ++    ++    V      F   V  ++  L+  I S++ ++I +A  GLGY   T E
Sbjct  194  QMINCETTQIIGYAVDQSAHTFKNKVIEIIKQLDETIQSYETITINDAYIGLGYGKATDE  253

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLG  333
            EL+F  +IA+  G+ILDP Y+GKA  G++ ++       +   ILFIHTGGL G
Sbjct  254  ELQFYIDIAQKEGIILDPTYTGKAFRGLVHEIKSGAYDNQDN-ILFIHTGGLQG  306



>ref|WP_002482297.1| D-cysteine desulfhydrase [Staphylococcus saprophyticus]
 gb|EHY93353.1| D-cysteine desulfhydrase [Staphylococcus saprophyticus subsp. 
saprophyticus KACC 16562]
Length=329

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 108/194 (56%), Gaps = 6/194 (3%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +G+ P++IPVG S+ +GT GY+ A  EI +Q QD   +  FD I VA GSGGT AGL  G
Sbjct  137  QGKTPFLIPVGASDWIGTHGYVNAYNEIIKQ-QD-ELKVHFDSINVAVGSGGTYAGLWYG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK-GLGYAMNTSE  495
              ++    ++    V      F   V  ++  L+  I S++ ++I +A  GLGY   T E
Sbjct  195  QMINCETTQIIGYAVDQSAHAFKNKVIEIIKQLDETIQSYETITINDAYIGLGYGKATDE  254

Query  494  ELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLFDKSE  315
            EL+F  +IA+  G+ILDP Y+GKA  G++ ++       +   ILFIHTGGL G     E
Sbjct  255  ELQFYIDIAQKEGIILDPTYTGKAFRGLVHEIKSGAYDNQDN-ILFIHTGGLQGY--TQE  311

Query  314  EMASLVGNWRKMDI  273
            +   L     K+D+
Sbjct  312  KRLRLQTMLHKIDL  325



>gb|EAW41951.1| D-cysteine desulfhydrase [marine gamma proteobacterium HTCC2080]
Length=331

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 104/188 (55%), Gaps = 8/188 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +GR P +IP GGSN LG WGY+    E+   +   A +     IV A GSGGT AGL++G
Sbjct  137  QGRHPLIIPTGGSNGLGIWGYVSGAEELVADM--AAADITNATIVTATGSGGTQAGLTLG  194

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDI-VSIQNAK-GLGYAM  507
              L      V    VCDD +YF + V   +    G+ + ++  +I ++  +A  G GY  
Sbjct  195  MALFQPDCSVWGFAVCDDEQYFTDKVSADICEAQGMWSALACENIQINTNDAHVGPGYGR  254

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
             T    + +  +A   G+ILDPVY+GKA +G+ +++ +     E   I+F+HTGG+ G+F
Sbjct  255  ATEPVYERIAALASLEGIILDPVYTGKAFHGLCEELAQGAFP-EATDIIFVHTGGIYGIF  313

Query  326  DKSEEMAS  303
               +++A+
Sbjct  314  PHGQQLAA  321



>ref|WP_034600917.1| cysteine desulfhydrase [Clostridiisalibacter paucivorans]
Length=331

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 110/192 (57%), Gaps = 13/192 (7%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L  EG + Y+IP G SN +G +GY  A+ EI  Q ++     KFD IV   GSG T  G+
Sbjct  142  LKKEGLRGYIIPEGASNGIGNFGYYNALLEILDQQKE--MNVKFDMIVCPVGSGATYGGM  199

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLDGLNAGISSHDIVSIQNAK--------  525
             + + L+    +++ + V  D ++F + +  +L    +   + D + I   +        
Sbjct  200  FLANKLNNTDCEIYGVNVSGDAKHFKDAISNILK--ESFTYTDDEIIINKEEINIIDGYV  257

Query  524  GLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTG  345
            G GYA++  EEL+F+  +A+  GVILDPVY+GKA YG+++++ +  +  + + ILFIHTG
Sbjct  258  GGGYAISRPEELEFIYSLAKLEGVILDPVYTGKAMYGLVQEIKKG-RFTDKKNILFIHTG  316

Query  344  GLLGLFDKSEEM  309
            GL GLF K E M
Sbjct  317  GLFGLFPKKELM  328



>ref|WP_045859980.1| cysteine desulfhydrase [Alteromonadaceae bacterium Bs12]
Length=338

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 107/195 (55%), Gaps = 20/195 (10%)
 Frame = -3

Query  848  GRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIGS  669
            GRK Y+IP+G S+ +G WGY+ A +E+    ++++   K D IVVA GSGGT AGL++G 
Sbjct  146  GRKAYIIPMGASDEVGLWGYLNAAQELLADFENSSV--KPDAIVVATGSGGTQAGLTLGF  203

Query  668  WLSGLKAKVHALCVCDDPEYFYEYVQGLLD----------GLNAGISSH-----DIVSIQ  534
             L      V  + VCD   YF E V+  LD            NA + S      ++ ++ 
Sbjct  204  HLCHSNVPVFGVAVCDSEAYFLEKVR--LDVRRWGKRWGAQFNASLISELPDSLNVHTLD  261

Query  533  NAKGLGYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFI  354
               G GYA       + ++ +A   GV+LDPVY+GKA YG++ ++ +       + I+F+
Sbjct  262  GYIGPGYARGYKALYETIQWLAREEGVVLDPVYTGKAFYGLINEIKQGVFH-SMKNIVFV  320

Query  353  HTGGLLGLFDKSEEM  309
            HTGG+ GLF   +E+
Sbjct  321  HTGGVFGLFPHKDEL  335



>ref|WP_040811353.1| cysteine desulfhydrase [marine gamma proteobacterium HTCC2080]
Length=340

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 104/188 (55%), Gaps = 8/188 (4%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +GR P +IP GGSN LG WGY+    E+   +   A +     IV A GSGGT AGL++G
Sbjct  146  QGRHPLIIPTGGSNGLGIWGYVSGAEELVADM--AAADITNATIVTATGSGGTQAGLTLG  203

Query  671  SWLSGLKAKVHALCVCDDPEYFYEYVQGLL---DGLNAGISSHDI-VSIQNAK-GLGYAM  507
              L      V    VCDD +YF + V   +    G+ + ++  +I ++  +A  G GY  
Sbjct  204  MALFQPDCSVWGFAVCDDEQYFTDKVSADICEAQGMWSALACENIQINTNDAHVGPGYGR  263

Query  506  NTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGLF  327
             T    + +  +A   G+ILDPVY+GKA +G+ +++ +     E   I+F+HTGG+ G+F
Sbjct  264  ATEPVYERIAALASLEGIILDPVYTGKAFHGLCEELAQGAFP-EATDIIFVHTGGIYGIF  322

Query  326  DKSEEMAS  303
               +++A+
Sbjct  323  PHGQQLAA  330



>ref|WP_041076635.1| cysteine desulfhydrase [Thermotoga caldifontis]
Length=341

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 102/190 (54%), Gaps = 16/190 (8%)
 Frame = -3

Query  851  EGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGLSIG  672
            +GRK Y+IP GGSN+LG  GY+ A+ E+  Q+  +    + D I  A GSGGT AGL  G
Sbjct  162  QGRKVYIIPEGGSNALGALGYVWAVAEMTNQIDLS----QIDAIYCAVGSGGTYAGLLAG  217

Query  671  SWLSGLKAKVHALCVCD-DPEYFYEYVQGLLD-----GLNAGISSHDIVSIQNAKGLGYA  510
                G +  V  + V   + +YF E V  ++D     G+   +   DI    +  G  YA
Sbjct  218  LRFLGYETPVIGINVTKREAKYFVEKVLKIVDELAEYGIRVNVKPEDIKITDDFSGPAYA  277

Query  509  MNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGLLGL  330
            + T  +++ +K  A T G++LDPVY+ KA  GM++          G+K+LF+HTGG  GL
Sbjct  278  VPTEADVECIKITASTEGIVLDPVYTSKAFRGMLQT------SRRGQKVLFVHTGGTFGL  331

Query  329  FDKSEEMASL  300
            F ++     L
Sbjct  332  FAQAHRFMEL  341



>ref|WP_020677022.1| hypothetical protein [Geopsychrobacter electrodiphilus]
Length=330

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 99/188 (53%), Gaps = 9/188 (5%)
 Frame = -3

Query  860  LLHEGRKPYVIPVGGSNSLGTWGYIEAIREIEQQLQDTAFEQKFDDIVVACGSGGTIAGL  681
            L   GRKPY+IPVGGSN +G+ GY+    EI  Q+  T    + D IV A GS GT AGL
Sbjct  144  LAEAGRKPYLIPVGGSNEVGSLGYVRCAHEILAQI--TTQNIQVDQIVHASGSAGTQAGL  201

Query  680  SIGSWLSGLKAKVHALCVCDDPEYFYEYVQGLLD------GLNAGISSHDIVSIQNAKGL  519
              G   +G    V  + V  D E     VQ LL+      GL+  +++  +V+     G 
Sbjct  202  LAGLIAAGADIPVLGIAVSRDTEAQQALVQALLEKTLQYLGLDPALATGRVVADGGYFGE  261

Query  518  GYAMNTSEELKFVKEIAETTGVILDPVYSGKAAYGMMKDMTENPKKWEGRKILFIHTGGL  339
            GY + T   L+ VK  A   G++LDPVY+GK   G++ D   +     G+ ILF+HTGG 
Sbjct  262  GYGITTPATLEAVKMCARVEGILLDPVYTGKGMAGLI-DKCRSGVFSSGQNILFLHTGGS  320

Query  338  LGLFDKSE  315
             GLF   E
Sbjct  321  PGLFAYRE  328



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1908683925587