BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12345

Length=1027
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628102.1|  PREDICTED: probable receptor-like serine/thr...    273   9e-81   Nicotiana tomentosiformis
ref|XP_009788830.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    271   2e-80   Nicotiana sylvestris
ref|XP_006345367.1|  PREDICTED: probable receptor-like protein ki...    266   7e-79   Solanum tuberosum [potatoes]
ref|XP_010320789.1|  PREDICTED: receptor-like cytosolic serine/th...    264   8e-79   Solanum lycopersicum
ref|XP_004229167.1|  PREDICTED: probable receptor-like serine/thr...    264   5e-78   Solanum lycopersicum
ref|XP_011091800.1|  PREDICTED: proline-rich receptor-like protei...    259   2e-76   Sesamum indicum [beniseed]
emb|CDP16448.1|  unnamed protein product                                245   8e-71   Coffea canephora [robusta coffee]
ref|XP_011088213.1|  PREDICTED: probable receptor-like serine/thr...    240   3e-69   
gb|EYU38253.1|  hypothetical protein MIMGU_mgv1a002401mg                240   4e-69   Erythranthe guttata [common monkey flower]
gb|EYU42966.1|  hypothetical protein MIMGU_mgv1a002423mg                232   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_011649434.1|  PREDICTED: probable receptor-like serine/thr...    232   7e-66   Cucumis sativus [cucumbers]
ref|XP_008460873.1|  PREDICTED: probable LRR receptor-like serine...    232   8e-66   Cucumis melo [Oriental melon]
ref|XP_007048485.1|  Kinase protein with adenine nucleotide alpha...    230   4e-65   
ref|XP_010087185.1|  Proline-rich receptor-like protein kinase PERK1    229   9e-65   Morus notabilis
ref|XP_010027607.1|  PREDICTED: proline-rich receptor-like protei...    226   7e-64   Eucalyptus grandis [rose gum]
gb|KCW54153.1|  hypothetical protein EUGRSUZ_I00126                     226   9e-64   Eucalyptus grandis [rose gum]
ref|XP_002310531.2|  hypothetical protein POPTR_0007s04490g             226   1e-63   
emb|CBI37518.3|  unnamed protein product                                225   2e-63   Vitis vinifera
emb|CAN81737.1|  hypothetical protein VITISV_043580                     225   2e-63   Vitis vinifera
ref|XP_002264653.2|  PREDICTED: probable receptor protein kinase ...    226   3e-63   
ref|XP_004289287.1|  PREDICTED: probable receptor-like serine/thr...    223   8e-63   Fragaria vesca subsp. vesca
ref|XP_012092538.1|  PREDICTED: proline-rich receptor-like protei...    223   9e-63   Jatropha curcas
ref|XP_009355844.1|  PREDICTED: tyrosine-protein kinase Lck-like        224   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_012092537.1|  PREDICTED: proline-rich receptor-like protei...    223   1e-62   Jatropha curcas
ref|XP_011022896.1|  PREDICTED: probable leucine-rich repeat rece...    223   1e-62   Populus euphratica
ref|XP_008367819.1|  PREDICTED: uncharacterized protein LOC103431442    223   2e-62   
ref|XP_007019225.1|  Kinase protein with adenine nucleotide alpha...    223   3e-62   
ref|XP_006434294.1|  hypothetical protein CICLE_v10000358mg             220   3e-62   
gb|KDO80471.1|  hypothetical protein CISIN_1g004174mg                   220   4e-62   Citrus sinensis [apfelsine]
gb|KDO80468.1|  hypothetical protein CISIN_1g004174mg                   221   8e-62   Citrus sinensis [apfelsine]
gb|KDO80469.1|  hypothetical protein CISIN_1g004174mg                   221   1e-61   Citrus sinensis [apfelsine]
gb|KDO80470.1|  hypothetical protein CISIN_1g004174mg                   221   1e-61   Citrus sinensis [apfelsine]
ref|XP_002520305.1|  ATP binding protein, putative                      221   1e-61   Ricinus communis
ref|XP_006434295.1|  hypothetical protein CICLE_v10000358mg             221   1e-61   Citrus clementina [clementine]
ref|XP_011031141.1|  PREDICTED: probable LIM domain-containing se...    220   1e-61   Populus euphratica
ref|XP_011011404.1|  PREDICTED: probable LIM domain-containing se...    220   2e-61   Populus euphratica
ref|XP_011011405.1|  PREDICTED: putative leucine-rich repeat rece...    220   2e-61   Populus euphratica
ref|XP_011031140.1|  PREDICTED: probable LIM domain-containing se...    220   2e-61   Populus euphratica
ref|XP_011011403.1|  PREDICTED: putative leucine-rich repeat rece...    220   2e-61   Populus euphratica
ref|XP_011031139.1|  PREDICTED: probable LRR receptor-like serine...    220   2e-61   Populus euphratica
ref|XP_011011402.1|  PREDICTED: putative leucine-rich repeat rece...    220   2e-61   Populus euphratica
ref|XP_011031142.1|  PREDICTED: probable LIM domain-containing se...    220   2e-61   Populus euphratica
ref|XP_002307046.2|  hypothetical protein POPTR_0005s06800g             220   2e-61   
ref|XP_006472861.1|  PREDICTED: probable L-type lectin-domain con...    220   2e-61   Citrus sinensis [apfelsine]
gb|KDP32865.1|  hypothetical protein JCGZ_12157                         220   3e-61   Jatropha curcas
ref|XP_012078327.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    219   4e-61   
ref|XP_008227546.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    219   6e-61   
ref|XP_007214539.1|  hypothetical protein PRUPE_ppa002094mg             218   7e-61   
gb|KHN05157.1|  Receptor-like cytosolic serine/threonine-protein ...    218   1e-60   Glycine soja [wild soybean]
ref|XP_004290918.1|  PREDICTED: probable receptor-like serine/thr...    218   1e-60   Fragaria vesca subsp. vesca
ref|XP_003542041.1|  PREDICTED: uncharacterized protein LOC100797280    218   1e-60   
gb|KHN31175.1|  Proline-rich receptor-like protein kinase PERK9         216   2e-60   Glycine soja [wild soybean]
ref|XP_006578781.1|  PREDICTED: proline-rich receptor-like protei...    216   2e-60   Glycine max [soybeans]
gb|EYU32494.1|  hypothetical protein MIMGU_mgv1a001977mg                216   5e-60   Erythranthe guttata [common monkey flower]
ref|XP_010093102.1|  Receptor-like cytosolic serine/threonine-pro...    216   6e-60   Morus notabilis
ref|NP_001238713.1|  protein kinase family protein                      214   6e-60   Glycine max [soybeans]
ref|XP_007137781.1|  hypothetical protein PHAVU_009G155000g             214   2e-59   Phaseolus vulgaris [French bean]
ref|XP_008219572.1|  PREDICTED: interleukin-1 receptor-associated...    215   2e-59   Prunus mume [ume]
gb|KHN38974.1|  Receptor-like cytosolic serine/threonine-protein ...    214   2e-59   Glycine soja [wild soybean]
ref|XP_006595490.1|  PREDICTED: protein kinase family protein iso...    214   2e-59   
ref|XP_007225237.1|  hypothetical protein PRUPE_ppa001811mg             214   2e-59   Prunus persica
ref|XP_004502543.1|  PREDICTED: uncharacterized protein LOC101504509    213   5e-59   Cicer arietinum [garbanzo]
ref|XP_010674424.1|  PREDICTED: probable receptor-like serine/thr...    213   8e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN44298.1|  Putative receptor-like serine/threonine-protein k...    212   1e-58   Glycine soja [wild soybean]
gb|KHG01419.1|  Putative proline-rich receptor-like protein kinas...    212   2e-58   Gossypium arboreum [tree cotton]
emb|CBI18962.3|  unnamed protein product                                212   2e-58   Vitis vinifera
gb|KJB80638.1|  hypothetical protein B456_013G108200                    212   2e-58   Gossypium raimondii
ref|XP_003526871.1|  PREDICTED: proline-rich receptor-like protei...    211   2e-58   Glycine max [soybeans]
gb|KJB80639.1|  hypothetical protein B456_013G108200                    212   2e-58   Gossypium raimondii
ref|XP_004498354.1|  PREDICTED: uncharacterized protein LOC101490391    211   2e-58   Cicer arietinum [garbanzo]
gb|KHN09628.1|  Proline-rich receptor-like protein kinase PERK9         211   2e-58   Glycine soja [wild soybean]
ref|XP_010664160.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    211   3e-58   
ref|XP_004502962.1|  PREDICTED: proline-rich receptor-like protei...    210   4e-58   Cicer arietinum [garbanzo]
gb|KHN46982.1|  Putative receptor-like serine/threonine-protein k...    210   5e-58   Glycine soja [wild soybean]
ref|XP_003526656.1|  PREDICTED: probable receptor-like serine/thr...    210   6e-58   
emb|CDX88355.1|  BnaC06g37990D                                          210   7e-58   
gb|KHG19309.1|  Proline-rich receptor-like protein kinase PERK10        209   9e-58   Gossypium arboreum [tree cotton]
ref|XP_006432125.1|  hypothetical protein CICLE_v10000480mg             208   9e-58   
gb|KEH35608.1|  adenine nucleotide alpha hydrolase-like domain ki...    208   1e-57   Medicago truncatula
ref|XP_011102142.1|  PREDICTED: probable receptor-like serine/thr...    210   1e-57   Sesamum indicum [beniseed]
ref|XP_009349910.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    209   2e-57   
gb|KFK42126.1|  hypothetical protein AALP_AA2G214300                    209   2e-57   Arabis alpina [alpine rockcress]
gb|KEH35607.1|  adenine nucleotide alpha hydrolase-like domain ki...    208   2e-57   Medicago truncatula
ref|XP_009106391.1|  PREDICTED: probable receptor-like serine/thr...    208   2e-57   Brassica rapa
gb|KEH35354.1|  adenine nucleotide alpha hydrolase-like domain ki...    209   2e-57   Medicago truncatula
ref|XP_010534448.1|  PREDICTED: probable receptor-like serine/thr...    209   2e-57   Tarenaya hassleriana [spider flower]
emb|CDX87529.1|  BnaA07g33440D                                          209   2e-57   
gb|KDO57493.1|  hypothetical protein CISIN_1g041755mg                   208   2e-57   Citrus sinensis [apfelsine]
ref|XP_009362341.1|  PREDICTED: probable receptor-like serine/thr...    209   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_006432126.1|  hypothetical protein CICLE_v10000480mg             208   3e-57   Citrus clementina [clementine]
ref|XP_006432127.1|  hypothetical protein CICLE_v10000480mg             207   3e-57   
ref|XP_010537354.1|  PREDICTED: probable receptor-like serine/thr...    207   7e-57   Tarenaya hassleriana [spider flower]
ref|XP_008441611.1|  PREDICTED: uncharacterized protein LOC103485693    207   8e-57   Cucumis melo [Oriental melon]
ref|XP_003522567.1|  PREDICTED: probable receptor-like serine/thr...    207   8e-57   
ref|XP_009354013.1|  PREDICTED: probable receptor-like serine/thr...    207   9e-57   Pyrus x bretschneideri [bai li]
ref|XP_008394166.1|  PREDICTED: interleukin-1 receptor-associated...    207   9e-57   Malus domestica [apple tree]
ref|XP_011657416.1|  PREDICTED: probable receptor-like serine/thr...    207   1e-56   Cucumis sativus [cucumbers]
ref|XP_010678918.1|  PREDICTED: probable receptor-like serine/thr...    206   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010428799.1|  PREDICTED: probable receptor-like serine/thr...    206   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009355832.1|  PREDICTED: probable receptor-like serine/thr...    205   4e-56   Pyrus x bretschneideri [bai li]
ref|XP_002516327.1|  ATP binding protein, putative                      204   5e-56   
gb|KJB48945.1|  hypothetical protein B456_008G094600                    204   6e-56   Gossypium raimondii
ref|NP_177852.2|  adenine nucleotide alpha hydrolases-domain cont...    205   7e-56   
ref|XP_007137480.1|  hypothetical protein PHAVU_009G130300g             204   8e-56   Phaseolus vulgaris [French bean]
ref|XP_010269084.1|  PREDICTED: probable receptor-like serine/thr...    204   1e-55   Nelumbo nucifera [Indian lotus]
gb|KEH40498.1|  adenine nucleotide alpha hydrolase-like domain ki...    204   1e-55   Medicago truncatula
ref|XP_010270301.1|  PREDICTED: probable receptor-like serine/thr...    203   2e-55   
ref|XP_009795415.1|  PREDICTED: probable receptor-like serine/thr...    202   5e-55   Nicotiana sylvestris
ref|XP_008805891.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-depen...    202   6e-55   
ref|XP_002302218.2|  kinase family protein                              202   8e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010471913.1|  PREDICTED: probable receptor-like serine/thr...    201   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004237363.1|  PREDICTED: probable receptor-like serine/thr...    201   1e-54   Solanum lycopersicum
ref|XP_006357335.1|  PREDICTED: inactive leucine-rich repeat rece...    201   1e-54   Solanum tuberosum [potatoes]
ref|XP_011016100.1|  PREDICTED: probable receptor-like serine/thr...    201   2e-54   Populus euphratica
ref|XP_009588636.1|  PREDICTED: probable receptor-like serine/thr...    201   2e-54   
ref|XP_006390104.1|  hypothetical protein EUTSA_v10018181mg             200   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_007161426.1|  hypothetical protein PHAVU_001G067700g             200   3e-54   Phaseolus vulgaris [French bean]
ref|XP_002306655.2|  kinase family protein                              200   3e-54   
ref|XP_009128214.1|  PREDICTED: receptor-like cytosolic serine/th...    197   2e-53   Brassica rapa
ref|XP_010527069.1|  PREDICTED: probable L-type lectin-domain con...    197   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_008783316.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    198   2e-53   
emb|CDY40878.1|  BnaCnng09690D                                          196   5e-53   Brassica napus [oilseed rape]
ref|XP_010911250.1|  PREDICTED: proline-rich receptor-like protei...    196   6e-53   
emb|CDY08194.1|  BnaA06g15320D                                          195   2e-52   Brassica napus [oilseed rape]
emb|CDY38355.1|  BnaA02g18480D                                          195   2e-52   Brassica napus [oilseed rape]
ref|XP_002889134.1|  kinase family protein                              194   6e-52   
ref|XP_010236761.1|  PREDICTED: uncharacterized protein LOC100842077    194   8e-52   Brachypodium distachyon [annual false brome]
ref|XP_010905327.1|  PREDICTED: uncharacterized protein LOC105032560    193   1e-51   Elaeis guineensis
ref|XP_010930690.1|  PREDICTED: probable receptor-like serine/thr...    192   2e-51   Elaeis guineensis
gb|KGN47686.1|  hypothetical protein Csa_6G376270                       192   2e-51   
gb|KFK44259.1|  hypothetical protein AALP_AA1G235200                    191   5e-51   Arabis alpina [alpine rockcress]
ref|XP_006416287.1|  hypothetical protein EUTSA_v10006893mg             191   5e-51   Eutrema salsugineum [saltwater cress]
ref|XP_006652004.1|  PREDICTED: serine/threonine-protein kinase p...    192   5e-51   Oryza brachyantha
gb|EMS55837.1|  Receptor-like cytosolic serine/threonine-protein ...    190   8e-51   Triticum urartu
dbj|BAK04018.1|  predicted protein                                      191   9e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC34357.1|  Putative protein kinase                                 190   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb|EAY92512.1|  hypothetical protein OsI_14251                          191   1e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001051845.1|  Os03g0839900                                       191   1e-50   
gb|AAO41118.1|  putative serine/threonine kinase                        191   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404967.1|  PREDICTED: probable receptor-like serine/thr...    190   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010498614.1|  PREDICTED: probable receptor protein kinase ...    189   2e-50   Camelina sativa [gold-of-pleasure]
emb|CDY04652.1|  BnaC05g16900D                                          189   2e-50   
ref|XP_010459867.1|  PREDICTED: probable receptor-like serine/thr...    189   2e-50   
emb|CDY31344.1|  BnaA02g33970D                                          189   2e-50   Brassica napus [oilseed rape]
ref|XP_004978901.1|  PREDICTED: L-type lectin-domain containing r...    189   3e-50   Setaria italica
ref|XP_009149675.1|  PREDICTED: receptor like protein kinase S.2-...    188   5e-50   Brassica rapa
gb|KJB48947.1|  hypothetical protein B456_008G094600                    188   5e-50   Gossypium raimondii
ref|XP_010461185.1|  PREDICTED: probable receptor-like serine/thr...    187   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010461193.1|  PREDICTED: probable receptor-like serine/thr...    187   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010461177.1|  PREDICTED: probable receptor-like serine/thr...    187   7e-50   Camelina sativa [gold-of-pleasure]
emb|CDP11935.1|  unnamed protein product                                187   8e-50   Coffea canephora [robusta coffee]
ref|XP_002893177.1|  kinase family protein                              187   9e-50   
ref|NP_201199.1|  protein kinase protein with adenine nucleotide ...    187   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781626.1|  PREDICTED: probable receptor-like serine/thr...    187   1e-49   Phoenix dactylifera
ref|XP_010444316.1|  PREDICTED: putative proline-rich receptor-li...    186   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006829313.1|  PREDICTED: probable receptor-like serine/thr...    186   2e-49   Amborella trichopoda
ref|XP_010444315.1|  PREDICTED: putative proline-rich receptor-li...    186   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010055963.1|  PREDICTED: probable receptor-like serine/thr...    186   2e-49   Eucalyptus grandis [rose gum]
gb|EMS48655.1|  Proline-rich receptor-like protein kinase PERK13        186   2e-49   Triticum urartu
ref|XP_010055962.1|  PREDICTED: probable receptor-like serine/thr...    186   2e-49   Eucalyptus grandis [rose gum]
ref|XP_009110180.1|  PREDICTED: proline-rich receptor-like protei...    186   2e-49   Brassica rapa
ref|XP_009130426.1|  PREDICTED: proline-rich receptor-like protei...    186   3e-49   Brassica rapa
ref|XP_009130425.1|  PREDICTED: proline-rich receptor-like protei...    186   3e-49   Brassica rapa
ref|XP_010484157.1|  PREDICTED: probable receptor-like protein ki...    185   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009410684.1|  PREDICTED: serine/threonine-protein kinase P...    184   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY39836.1|  BnaC02g42820D                                          184   8e-49   Brassica napus [oilseed rape]
ref|XP_002864878.1|  kinase family protein                              184   9e-49   Arabidopsis lyrata subsp. lyrata
emb|CDY38812.1|  BnaC08g19860D                                          184   9e-49   Brassica napus [oilseed rape]
dbj|BAJ97602.1|  predicted protein                                      184   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW65488.1|  putative protein kinase superfamily protein isofo...    181   2e-48   
gb|AAF87904.1|AC015447_14  Similar to protein kinases                   183   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303211.1|  hypothetical protein CARUB_v10011454mg             183   2e-48   Capsella rubella
ref|NP_173578.2|  putative protein kinase                               183   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011027696.1|  PREDICTED: probable receptor-like serine/thr...    182   4e-48   Populus euphratica
ref|XP_008679652.1|  PREDICTED: probable receptor-like protein ki...    182   6e-48   
gb|EMT07237.1|  Putative LRR receptor-like serine/threonine-prote...    185   8e-48   
ref|XP_010237868.1|  PREDICTED: putative L-type lectin-domain con...    181   9e-48   Brachypodium distachyon [annual false brome]
ref|XP_010237867.1|  PREDICTED: putative L-type lectin-domain con...    181   9e-48   Brachypodium distachyon [annual false brome]
ref|XP_010521198.1|  PREDICTED: probable receptor-like serine/thr...    181   1e-47   Tarenaya hassleriana [spider flower]
gb|EPS63840.1|  hypothetical protein M569_10941                         181   2e-47   Genlisea aurea
ref|XP_006279577.1|  hypothetical protein CARUB_v10025977mg             180   2e-47   Capsella rubella
ref|XP_004981112.1|  PREDICTED: uncharacterized protein LOC101777140    182   3e-47   
gb|KFK28085.1|  hypothetical protein AALP_AA8G470300                    179   4e-47   Arabis alpina [alpine rockcress]
ref|XP_002463556.1|  hypothetical protein SORBIDRAFT_01g001890          181   5e-47   
dbj|BAF01933.1|  hypothetical protein                                   169   5e-47   Arabidopsis thaliana [mouse-ear cress]
gb|EEC68959.1|  hypothetical protein OsI_37687                          178   9e-47   Oryza sativa Indica Group [Indian rice]
gb|ABA91867.2|  protein kinase family protein, putative, expressed      177   1e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006394226.1|  hypothetical protein EUTSA_v10003727mg             177   2e-46   Eutrema salsugineum [saltwater cress]
ref|XP_006394225.1|  hypothetical protein EUTSA_v10003727mg             177   2e-46   
ref|NP_001067422.1|  Os11g0194900                                       177   2e-46   
ref|XP_009150459.1|  PREDICTED: probable receptor-like protein ki...    177   3e-46   Brassica rapa
emb|CDY43771.1|  BnaA06g23070D                                          177   3e-46   Brassica napus [oilseed rape]
emb|CDX84466.1|  BnaC03g50340D                                          177   3e-46   
gb|EEC78249.1|  hypothetical protein OsI_17914                          177   3e-46   Oryza sativa Indica Group [Indian rice]
gb|AAX96058.1|  At5g63940                                               177   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663269.1|  PREDICTED: proline-rich receptor-like protei...    176   4e-46   
ref|XP_008644345.1|  PREDICTED: uncharacterized protein LOC103625730    176   2e-45   
gb|EMT26702.1|  hypothetical protein F775_52533                         175   2e-45   
gb|EEE52871.1|  hypothetical protein OsJ_35430                          174   4e-45   Oryza sativa Japonica Group [Japonica rice]
gb|AGW24429.1|  receptor-like cytosolic serine/threonine-protein ...    162   5e-45   Avicennia marina subsp. marina
ref|XP_004978900.1|  PREDICTED: L-type lectin-domain containing r...    173   8e-45   
ref|XP_003577000.1|  PREDICTED: probable receptor-like serine/thr...    170   8e-44   Brachypodium distachyon [annual false brome]
ref|XP_010933340.1|  PREDICTED: proline-rich receptor-like protei...    169   2e-43   
ref|XP_011046242.1|  PREDICTED: receptor-like cytosolic serine/th...    168   2e-43   Populus euphratica
ref|XP_002305520.1|  kinase family protein                              169   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010933342.1|  PREDICTED: proline-rich receptor-like protei...    169   2e-43   Elaeis guineensis
gb|EMS52526.1|  Putative proline-rich receptor-like protein kinas...    166   2e-43   Triticum urartu
ref|XP_011046218.1|  PREDICTED: probable receptor-like serine/thr...    168   3e-43   Populus euphratica
ref|XP_002313708.1|  hypothetical protein POPTR_0009s13710g             168   4e-43   
ref|XP_010028727.1|  PREDICTED: probable receptor-like serine/thr...    168   4e-43   Eucalyptus grandis [rose gum]
ref|XP_004977217.1|  PREDICTED: proline-rich receptor-like protei...    168   5e-43   Setaria italica
ref|XP_009413203.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    166   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413128.1|  PREDICTED: proline-rich receptor-like protei...    166   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007041834.1|  Kinase protein with adenine nucleotide alpha...    165   5e-42   
ref|XP_011046681.1|  PREDICTED: proline-rich receptor-like protei...    164   9e-42   Populus euphratica
ref|NP_001049518.1|  Os03g0241600                                       157   1e-41   
gb|EMT19880.1|  Putative LRR receptor-like serine/threonine-prote...    165   1e-41   
gb|ABA95941.1|  Protein kinase domain containing protein                164   1e-41   Oryza sativa Japonica Group [Japonica rice]
gb|KJB47679.1|  hypothetical protein B456_008G036300                    161   2e-41   Gossypium raimondii
ref|XP_006664395.1|  PREDICTED: probable receptor-like serine/thr...    162   5e-41   
ref|XP_009398916.1|  PREDICTED: proline-rich receptor-like protei...    161   6e-41   
ref|XP_010646860.1|  PREDICTED: proline-rich receptor-like protei...    161   7e-41   Vitis vinifera
ref|XP_002534152.1|  ATP binding protein, putative                      161   8e-41   
emb|CBI37873.3|  unnamed protein product                                161   9e-41   Vitis vinifera
ref|XP_004505816.1|  PREDICTED: proline-rich receptor-like protei...    161   9e-41   
ref|XP_010646843.1|  PREDICTED: proline-rich receptor-like protei...    161   1e-40   Vitis vinifera
ref|XP_004505819.1|  PREDICTED: proline-rich receptor-like protei...    160   1e-40   
emb|CAN73629.1|  hypothetical protein VITISV_026641                     161   1e-40   Vitis vinifera
ref|XP_008665759.1|  PREDICTED: uncharacterized protein LOC100191...    162   2e-40   Zea mays [maize]
gb|KHG24701.1|  Receptor-like cytosolic serine/threonine-protein ...    159   3e-40   Gossypium arboreum [tree cotton]
ref|XP_008813513.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   4e-40   Phoenix dactylifera
ref|XP_010496668.1|  PREDICTED: probable receptor-like serine/thr...    159   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010496669.1|  PREDICTED: receptor-like cytosolic serine/th...    159   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006283621.1|  hypothetical protein CARUB_v10004678mg             157   6e-40   Capsella rubella
ref|XP_010489258.1|  PREDICTED: probable receptor-like serine/thr...    158   1e-39   
ref|XP_002884015.1|  kinase family protein                              158   1e-39   
ref|XP_010489257.1|  PREDICTED: probable receptor-like serine/thr...    158   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008800175.1|  PREDICTED: probable receptor-like protein ki...    158   1e-39   Phoenix dactylifera
gb|KHG28516.1|  Receptor-like cytosolic serine/threonine-protein ...    158   1e-39   Gossypium arboreum [tree cotton]
ref|XP_010447006.1|  PREDICTED: pto-interacting protein 1-like          156   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010920120.1|  PREDICTED: probable receptor-like protein ki...    157   2e-39   Elaeis guineensis
emb|CDP14559.1|  unnamed protein product                                157   2e-39   Coffea canephora [robusta coffee]
ref|XP_010920119.1|  PREDICTED: probable receptor-like protein ki...    157   2e-39   Elaeis guineensis
gb|EAY89207.1|  hypothetical protein OsI_10703                          157   3e-39   Oryza sativa Indica Group [Indian rice]
gb|KCW72536.1|  hypothetical protein EUGRSUZ_E01004                     157   3e-39   Eucalyptus grandis [rose gum]
gb|ABF94898.1|  protein kinase family protein, putative, expressed      157   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010437535.1|  PREDICTED: pto-interacting protein 1-like          154   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008663832.1|  PREDICTED: G-type lectin S-receptor-like ser...    156   6e-39   Zea mays [maize]
emb|CDY71941.1|  BnaAnng39330D                                          152   6e-39   Brassica napus [oilseed rape]
gb|AFW56237.1|  putative protein kinase superfamily protein             156   6e-39   
ref|NP_001190918.1|  salt stress-related protein kinase                 154   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516178.1|  PREDICTED: probable receptor-like serine/thr...    155   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010516187.1|  PREDICTED: probable receptor-like serine/thr...    155   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003607181.1|  Wall-associated receptor kinase-like protein       155   1e-38   
ref|XP_010516196.1|  PREDICTED: probable receptor-like serine/thr...    155   1e-38   Camelina sativa [gold-of-pleasure]
gb|AES89378.2|  adenine nucleotide alpha hydrolase-like domain ki...    155   1e-38   Medicago truncatula
gb|AAD24608.1|  putative protein kinase                                 153   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131712.1|  hypothetical protein PHAVU_011G035600g             154   2e-38   Phaseolus vulgaris [French bean]
ref|XP_006649715.1|  PREDICTED: putative proline-rich receptor-li...    154   2e-38   Oryza brachyantha
emb|CDY72015.1|  BnaCnng75560D                                          150   3e-38   Brassica napus [oilseed rape]
ref|XP_002442921.1|  hypothetical protein SORBIDRAFT_08g004940          154   3e-38   Sorghum bicolor [broomcorn]
ref|XP_010690367.1|  PREDICTED: probable receptor-like protein ki...    154   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690368.1|  PREDICTED: probable receptor-like protein ki...    154   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_179266.2|  adenine nucleotide alpha hydrolases-domain cont...    153   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465576.1|  hypothetical protein SORBIDRAFT_01g041400          153   5e-38   Sorghum bicolor [broomcorn]
ref|XP_009402096.1|  PREDICTED: probable receptor-like serine/thr...    154   6e-38   
ref|XP_004985046.1|  PREDICTED: putative proline-rich receptor-li...    153   7e-38   Setaria italica
ref|XP_010432352.1|  PREDICTED: probable receptor-like serine/thr...    149   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009121184.1|  PREDICTED: probable receptor-like serine/thr...    152   1e-37   Brassica rapa
gb|KEH36388.1|  adenine nucleotide alpha hydrolase-like domain ki...    150   2e-37   Medicago truncatula
gb|KJB15811.1|  hypothetical protein B456_002G197700                    152   2e-37   Gossypium raimondii
gb|KJB15812.1|  hypothetical protein B456_002G197700                    152   2e-37   Gossypium raimondii
gb|ACR34314.1|  unknown                                                 149   2e-37   Zea mays [maize]
gb|KEH36387.1|  adenine nucleotide alpha hydrolase-like domain ki...    150   2e-37   Medicago truncatula
ref|XP_009106626.1|  PREDICTED: receptor-like cytosolic serine/th...    150   3e-37   Brassica rapa
ref|XP_009106842.1|  PREDICTED: probable receptor-like serine/thr...    150   3e-37   Brassica rapa
ref|XP_003604039.1|  Receptor-like protein kinase                       150   3e-37   Medicago truncatula
gb|KDO84917.1|  hypothetical protein CISIN_1g036172mg                   150   5e-37   Citrus sinensis [apfelsine]
ref|XP_003558383.1|  PREDICTED: receptor-like cytosolic serine/th...    150   5e-37   Brachypodium distachyon [annual false brome]
ref|XP_010228892.1|  PREDICTED: receptor-like cytosolic serine/th...    150   5e-37   
tpg|DAA44334.1|  TPA: putative protein kinase superfamily protein       149   5e-37   
ref|XP_011649293.1|  PREDICTED: serine/threonine-protein kinase C...    150   7e-37   
ref|XP_010432349.1|  PREDICTED: pto-interacting protein 1-like is...    148   7e-37   
emb|CDX69106.1|  BnaC01g03470D                                          149   7e-37   
ref|XP_006473692.1|  PREDICTED: probable receptor-like serine/thr...    150   8e-37   
ref|XP_011649290.1|  PREDICTED: receptor-like cytosolic serine/th...    150   8e-37   
ref|XP_008645813.1|  PREDICTED: uncharacterized protein LOC100384...    149   1e-36   
ref|XP_003540886.1|  PREDICTED: putative proline-rich receptor-li...    149   1e-36   
ref|XP_006435215.1|  hypothetical protein CICLE_v100004501mg            150   1e-36   
ref|XP_007199719.1|  hypothetical protein PRUPE_ppa002257mg             149   1e-36   
gb|KHN25469.1|  Putative proline-rich receptor-like protein kinas...    149   1e-36   
ref|XP_009376969.1|  PREDICTED: probable serine/threonine-protein...    149   2e-36   
ref|XP_008236015.1|  PREDICTED: probable serine/threonine-protein...    148   5e-36   
ref|XP_008236013.1|  PREDICTED: probable serine/threonine-protein...    148   5e-36   
ref|XP_010530898.1|  PREDICTED: receptor-like cytosolic serine/th...    147   5e-36   
ref|XP_008236014.1|  PREDICTED: probable serine/threonine-protein...    148   5e-36   
ref|XP_006846900.1|  PREDICTED: pto-interacting protein 1               146   6e-36   
ref|XP_004500727.1|  PREDICTED: probable receptor-like serine/thr...    146   1e-35   
ref|XP_009406141.1|  PREDICTED: putative receptor protein kinase ...    147   1e-35   
ref|XP_011092979.1|  PREDICTED: probable receptor-like serine/thr...    146   2e-35   
ref|XP_009384623.1|  PREDICTED: receptor-like cytosolic serine/th...    146   2e-35   
ref|XP_009406140.1|  PREDICTED: probable serine/threonine-protein...    147   2e-35   
ref|NP_001130327.1|  uncharacterized protein LOC100191422               145   2e-35   
gb|KFK30141.1|  protein kinase-like protein                             144   2e-35   
ref|XP_003538989.1|  PREDICTED: proline-rich receptor-like protei...    144   6e-35   
ref|XP_010266827.1|  PREDICTED: probable receptor-like protein ki...    144   7e-35   
gb|EYU37953.1|  hypothetical protein MIMGU_mgv1a002277mg                144   8e-35   
ref|XP_006409394.1|  hypothetical protein EUTSA_v10022595mg             144   9e-35   
tpg|DAA52404.1|  TPA: putative protein kinase superfamily protein       145   1e-34   
ref|XP_006412161.1|  hypothetical protein EUTSA_v10026926mg             142   2e-34   
ref|XP_006486742.1|  PREDICTED: probable receptor-like serine/thr...    143   2e-34   
gb|KDP29658.1|  hypothetical protein JCGZ_18820                         143   2e-34   
ref|XP_012081775.1|  PREDICTED: calmodulin-binding receptor-like ...    143   2e-34   
ref|XP_011457943.1|  PREDICTED: receptor-like cytosolic serine/th...    143   3e-34   
ref|XP_011457944.1|  PREDICTED: receptor-like cytosolic serine/th...    143   3e-34   
ref|XP_011457945.1|  PREDICTED: receptor-like cytosolic serine/th...    143   3e-34   
ref|XP_011457942.1|  PREDICTED: receptor-like cytosolic serine/th...    143   3e-34   
emb|CDY26785.1|  BnaC09g09120D                                          140   3e-34   
ref|XP_011457941.1|  PREDICTED: receptor-like cytosolic serine/th...    143   3e-34   
ref|XP_008457696.1|  PREDICTED: serine/threonine-protein kinase A...    142   3e-34   
ref|XP_008457693.1|  PREDICTED: serine/threonine-protein kinase A...    142   4e-34   
ref|XP_002993139.1|  hypothetical protein SELMODRAFT_136607             139   9e-34   
ref|XP_010933343.1|  PREDICTED: receptor-like cytosolic serine/th...    140   1e-33   
ref|XP_008364949.1|  PREDICTED: receptor-like cytosolic serine/th...    135   1e-33   
ref|XP_012073886.1|  PREDICTED: probable receptor-like serine/thr...    140   2e-33   
ref|XP_002301959.2|  hypothetical protein POPTR_0002s02080g             140   5e-33   
ref|XP_001769146.1|  predicted protein                                  137   6e-33   
gb|EMT21897.1|  Serine/threonine-protein kinase PBS1                    137   8e-33   
emb|CDY47477.1|  BnaA09g08860D                                          136   9e-33   
ref|XP_010548097.1|  PREDICTED: receptor-like cytosolic serine/th...    139   9e-33   
dbj|BAJ97343.1|  predicted protein                                      138   1e-32   
ref|XP_010107667.1|  putative receptor-like serine/threonine-prot...    138   1e-32   
emb|CAA17768.1|  protein kinase-like                                    136   1e-32   
dbj|BAJ96024.1|  predicted protein                                      138   1e-32   
ref|XP_008221234.1|  PREDICTED: proline-rich receptor-like protei...    137   2e-32   
ref|XP_010315381.1|  PREDICTED: probable receptor-like serine/thr...    138   2e-32   
ref|XP_006359697.1|  PREDICTED: proline-rich receptor-like protei...    138   2e-32   
ref|XP_007226295.1|  hypothetical protein PRUPE_ppa020418mg             137   2e-32   
ref|XP_011034991.1|  PREDICTED: inactive protein kinase SELMODRAF...    139   2e-32   
ref|XP_009355672.1|  PREDICTED: probable serine/threonine-protein...    137   3e-32   
ref|XP_009355675.1|  PREDICTED: probable serine/threonine-protein...    137   3e-32   
ref|XP_008357286.1|  PREDICTED: probable serine/threonine-protein...    137   3e-32   
ref|XP_008357288.1|  PREDICTED: probable serine/threonine-protein...    137   3e-32   
ref|XP_008377740.1|  PREDICTED: probable serine/threonine-protein...    137   3e-32   
gb|AFK38695.1|  unknown                                                 128   4e-32   
ref|XP_008377742.1|  PREDICTED: probable serine/threonine-protein...    137   4e-32   
ref|XP_006422602.1|  hypothetical protein CICLE_v10027936mg             135   1e-31   
ref|XP_011088607.1|  PREDICTED: probable receptor-like protein ki...    135   1e-31   
ref|XP_009376952.1|  PREDICTED: probable serine/threonine-protein...    135   2e-31   
ref|XP_002869112.1|  kinase family protein                              132   2e-31   
ref|XP_009334789.1|  PREDICTED: pto-interacting protein 1-like          134   2e-31   
emb|CDX75481.1|  BnaA01g02210D                                          132   2e-31   
ref|XP_001779016.1|  predicted protein                                  130   2e-31   
ref|XP_001777129.1|  predicted protein                                  131   3e-31   
ref|NP_001078492.1|  salt stress-related protein kinase                 131   5e-31   
ref|XP_008440133.1|  PREDICTED: receptor-like cytosolic serine/th...    134   5e-31   
ref|XP_009791612.1|  PREDICTED: probable serine/threonine-protein...    133   6e-31   
ref|XP_004303337.1|  PREDICTED: serine/threonine-protein kinase CDL1    132   7e-31   
ref|XP_008387921.1|  PREDICTED: receptor-like cytosolic serine/th...    132   7e-31   
ref|XP_008440132.1|  PREDICTED: LRR receptor-like serine/threonin...    134   1e-30   
ref|XP_001759325.1|  predicted protein                                  128   2e-30   
ref|XP_009626743.1|  PREDICTED: proline-rich receptor-like protei...    132   2e-30   
ref|XP_009626742.1|  PREDICTED: proline-rich receptor-like protei...    132   2e-30   
ref|XP_006482139.1|  PREDICTED: proline-rich receptor-like protei...    130   2e-30   
gb|ACJ85716.1|  unknown                                                 129   2e-30   
ref|XP_011657790.1|  PREDICTED: receptor-like cytosolic serine/th...    132   3e-30   
ref|XP_004291344.1|  PREDICTED: pto-interacting protein 1-like is...    130   3e-30   
ref|XP_011459100.1|  PREDICTED: pto-interacting protein 1-like is...    130   3e-30   
gb|KEH34674.1|  Serine/Threonine kinase family protein                  130   3e-30   
ref|XP_008378127.1|  PREDICTED: pto-interacting protein 1-like          130   4e-30   
ref|XP_011657789.1|  PREDICTED: probable LRR receptor-like serine...    132   5e-30   
gb|KJB15816.1|  hypothetical protein B456_002G197700                    130   7e-30   
ref|XP_002274329.2|  PREDICTED: serine/threonine-protein kinase CDL1    128   1e-29   
ref|XP_011023515.1|  PREDICTED: receptor-like cytosolic serine/th...    127   1e-29   
gb|KDO63088.1|  hypothetical protein CISIN_1g010012mg                   127   1e-29   
ref|XP_008229216.1|  PREDICTED: serine/threonine-protein kinase A...    128   1e-29   
ref|XP_006383313.1|  kinase family protein                              128   1e-29   
ref|XP_011023514.1|  PREDICTED: receptor-like cytosolic serine/th...    127   1e-29   
gb|KCW60916.1|  hypothetical protein EUGRSUZ_H03652                     128   1e-29   
ref|XP_002279454.1|  PREDICTED: receptor-like serine/threonine-pr...    130   1e-29   
ref|XP_011013520.1|  PREDICTED: receptor-like cytosolic serine/th...    127   1e-29   
gb|KCW60917.1|  hypothetical protein EUGRSUZ_H03652                     128   2e-29   
ref|XP_004517286.1|  PREDICTED: proline-rich receptor-like protei...    128   2e-29   
ref|XP_011013519.1|  PREDICTED: receptor-like cytosolic serine/th...    127   2e-29   
ref|XP_010024471.1|  PREDICTED: receptor-like cytosolic serine/th...    127   2e-29   
ref|XP_011023513.1|  PREDICTED: receptor-like cytosolic serine/th...    127   2e-29   
ref|XP_009334416.1|  PREDICTED: proline-rich receptor-like protei...    127   2e-29   
dbj|BAB10356.1|  Ser/Thr protein kinase-like protein                    125   2e-29   
ref|XP_011021400.1|  PREDICTED: serine/threonine-protein kinase C...    127   2e-29   
ref|XP_010024470.1|  PREDICTED: receptor-like cytosolic serine/th...    127   2e-29   
ref|XP_006430627.1|  hypothetical protein CICLE_v10011487mg             125   2e-29   
ref|XP_007215838.1|  hypothetical protein PRUPE_ppa004124mg             127   2e-29   
gb|KDO63087.1|  hypothetical protein CISIN_1g010012mg                   127   2e-29   
ref|XP_010418589.1|  PREDICTED: receptor-like cytosolic serine/th...    124   3e-29   
ref|XP_006375787.1|  hypothetical protein POPTR_0013s02930g             126   3e-29   
ref|XP_009604378.1|  PREDICTED: pto-interacting protein 1-like          127   3e-29   
ref|XP_007141893.1|  hypothetical protein PHAVU_008G234600g             126   4e-29   
ref|XP_011002778.1|  PREDICTED: serine/threonine-protein kinase C...    127   4e-29   
ref|XP_011073626.1|  PREDICTED: probable protein kinase At2g41970       126   4e-29   
ref|XP_009371790.1|  PREDICTED: protein kinase APK1B, chloroplast...    126   4e-29   
ref|XP_010109030.1|  Putative proline-rich receptor-like protein ...    127   4e-29   
gb|KJB48226.1|  hypothetical protein B456_008G058700                    125   5e-29   
ref|XP_010024468.1|  PREDICTED: receptor-like cytosolic serine/th...    127   5e-29   
ref|XP_006430629.1|  hypothetical protein CICLE_v10011487mg             125   6e-29   
ref|XP_010024469.1|  PREDICTED: receptor-like cytosolic serine/th...    127   6e-29   
ref|XP_006409395.1|  hypothetical protein EUTSA_v10022595mg             126   7e-29   
gb|KJB48227.1|  hypothetical protein B456_008G058700                    126   7e-29   
ref|XP_006480260.1|  PREDICTED: receptor-like cytosolic serine/th...    125   8e-29   
ref|XP_006433226.1|  hypothetical protein CICLE_v10001189mg             125   8e-29   
gb|KHG00423.1|  Serine/threonine-protein kinase PBS1                    125   8e-29   
ref|XP_007033048.1|  Kinase family protein isoform 1                    126   9e-29   
ref|XP_006430628.1|  hypothetical protein CICLE_v10011487mg             125   1e-28   
gb|KDO48498.1|  hypothetical protein CISIN_1g013927mg                   125   1e-28   
tpg|DAA44333.1|  TPA: putative protein kinase superfamily protein       120   1e-28   
ref|XP_002512317.1|  ATP binding protein, putative                      124   1e-28   
ref|XP_006283474.1|  hypothetical protein CARUB_v10004522mg             125   2e-28   
dbj|BAF00962.1|  protein kinase like protein                            125   2e-28   
ref|NP_198595.1|  protein kinase family protein                         125   2e-28   
ref|NP_001242440.1|  uncharacterized protein LOC100808074               124   2e-28   
ref|XP_010266088.1|  PREDICTED: pto-interacting protein 1-like is...    125   2e-28   
ref|XP_009775316.1|  PREDICTED: pto-interacting protein 1-like          124   2e-28   
ref|XP_011099476.1|  PREDICTED: pto-interacting protein 1-like          124   2e-28   
gb|KHN39451.1|  Proline-rich receptor-like protein kinase PERK13        124   2e-28   
gb|ABA95947.1|  Protein kinase domain containing protein                122   2e-28   
ref|XP_003544372.2|  PREDICTED: proline-rich receptor-like protei...    124   2e-28   
ref|XP_010266087.1|  PREDICTED: pto-interacting protein 1-like is...    125   2e-28   
ref|XP_010926481.1|  PREDICTED: receptor-like cytosolic serine/th...    124   2e-28   
ref|XP_002532467.1|  Protein kinase APK1B, chloroplast precursor,...    124   3e-28   
gb|KHN07554.1|  Proline-rich receptor-like protein kinase PERK13        124   3e-28   
gb|KHN17938.1|  Putative receptor-like serine/threonine-protein k...    124   3e-28   
ref|XP_010916502.1|  PREDICTED: serine/threonine-protein kinase C...    124   3e-28   
ref|XP_009120192.1|  PREDICTED: inactive protein kinase SELMODRAF...    118   3e-28   
ref|XP_008381327.1|  PREDICTED: protein kinase APK1B, chloroplast...    124   3e-28   
ref|XP_010440889.1|  PREDICTED: probable protein kinase At2g41970       124   3e-28   
ref|XP_003518378.2|  PREDICTED: proline-rich receptor-like protei...    124   3e-28   
gb|EPS57687.1|  hypothetical protein M569_17130                         122   4e-28   
ref|XP_007163395.1|  hypothetical protein PHAVU_001G231200g             123   4e-28   
ref|XP_002870566.1|  kinase family protein                              124   5e-28   
ref|XP_008809819.1|  PREDICTED: serine/threonine-protein kinase P...    124   5e-28   
ref|XP_010536938.1|  PREDICTED: probable receptor-like serine/thr...    124   5e-28   
ref|XP_009390242.1|  PREDICTED: probable receptor-like protein ki...    123   6e-28   
ref|XP_007030763.1|  Autophagy 18 H                                     126   6e-28   
gb|KHN41080.1|  Proline-rich receptor-like protein kinase PERK13-...    123   6e-28   
gb|KJB14385.1|  hypothetical protein B456_002G122500                    124   6e-28   
gb|KJB45136.1|  hypothetical protein B456_007G291900                    121   8e-28   
ref|XP_006474136.1|  PREDICTED: probable receptor-like serine/thr...    124   8e-28   
ref|XP_006474137.1|  PREDICTED: probable receptor-like serine/thr...    124   8e-28   
ref|XP_002305868.2|  kinase family protein                              123   8e-28   
ref|XP_006453444.1|  hypothetical protein CICLE_v10007784mg             124   8e-28   
ref|XP_008450837.1|  PREDICTED: inactive protein kinase SELMODRAF...    124   9e-28   
gb|KJB14384.1|  hypothetical protein B456_002G122500                    124   9e-28   
ref|XP_002510567.1|  conserved hypothetical protein                     124   1e-27   
ref|XP_010274711.1|  PREDICTED: serine/threonine-protein kinase B...    122   1e-27   
ref|XP_002319033.2|  kinase family protein                              122   1e-27   
gb|KJB45137.1|  hypothetical protein B456_007G291900                    122   1e-27   
ref|XP_010450541.1|  PREDICTED: probable protein kinase At2g41970       122   1e-27   
ref|XP_009379615.1|  PREDICTED: probable receptor-like serine/thr...    121   1e-27   
gb|KCW79544.1|  hypothetical protein EUGRSUZ_C00911                     122   1e-27   
gb|KJB45135.1|  hypothetical protein B456_007G291900                    122   1e-27   
ref|XP_002964522.1|  hypothetical protein SELMODRAFT_142471             122   1e-27   
ref|XP_008360512.1|  PREDICTED: probable receptor-like serine/thr...    121   1e-27   
gb|KDO62429.1|  hypothetical protein CISIN_1g008650mg                   122   1e-27   
ref|XP_010524886.1|  PREDICTED: receptor-like cytosolic serine/th...    122   1e-27   
ref|XP_010545336.1|  PREDICTED: inactive protein kinase SELMODRAF...    124   1e-27   
ref|XP_008805931.1|  PREDICTED: receptor-like cytosolic serine/th...    122   1e-27   
ref|XP_010095527.1|  Receptor-like cytosolic serine/threonine-pro...    125   2e-27   
ref|XP_008782089.1|  PREDICTED: probable receptor-like serine/thr...    122   2e-27   
ref|XP_008805930.1|  PREDICTED: receptor-like cytosolic serine/th...    121   2e-27   
ref|XP_003552967.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27   
gb|KHG29793.1|  Putative proline-rich receptor-like protein kinas...    124   2e-27   
ref|XP_010435689.1|  PREDICTED: serine/threonine-protein kinase A...    122   2e-27   
ref|XP_008455275.1|  PREDICTED: receptor-like cytosolic serine/th...    121   2e-27   
gb|KCW79543.1|  hypothetical protein EUGRSUZ_C00911                     122   2e-27   
ref|XP_011012550.1|  PREDICTED: receptor-like cytosolic serine/th...    121   3e-27   
ref|XP_004139200.2|  PREDICTED: receptor-like cytosolic serine/th...    121   3e-27   
gb|KFK33272.1|  hypothetical protein AALP_AA6G353500                    121   3e-27   
ref|XP_010047597.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   3e-27   
ref|XP_010027964.1|  PREDICTED: receptor-like cytosolic serine/th...    121   3e-27   
ref|XP_006405834.1|  hypothetical protein EUTSA_v10027710mg             121   3e-27   
ref|XP_010027963.1|  PREDICTED: receptor-like cytosolic serine/th...    121   3e-27   
gb|KJB47017.1|  hypothetical protein B456_008G006600                    120   3e-27   
ref|XP_004135703.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   3e-27   
ref|XP_011012530.1|  PREDICTED: receptor-like cytosolic serine/th...    121   3e-27   
ref|XP_011012531.1|  PREDICTED: receptor-like cytosolic serine/th...    121   3e-27   
ref|XP_010242571.1|  PREDICTED: autophagy-related protein 18h-like      124   3e-27   
ref|XP_011012532.1|  PREDICTED: receptor-like cytosolic serine/th...    121   3e-27   
ref|XP_002314438.2|  hypothetical protein POPTR_0010s02810g             120   4e-27   
ref|XP_009120189.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   4e-27   
emb|CDP01575.1|  unnamed protein product                                120   4e-27   
ref|XP_009126925.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   4e-27   
ref|XP_006280136.1|  hypothetical protein CARUB_v10026029mg             121   4e-27   
emb|CDY32758.1|  BnaA10g10910D                                          122   4e-27   
ref|XP_004235609.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   4e-27   
emb|CDY20711.1|  BnaA02g08510D                                          122   4e-27   
ref|XP_010047596.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   4e-27   
ref|XP_006401286.1|  hypothetical protein EUTSA_v10012884mg             122   4e-27   
emb|CDP02704.1|  unnamed protein product                                120   5e-27   
ref|XP_009765109.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   5e-27   
ref|XP_009599759.1|  PREDICTED: inactive protein kinase SELMODRAF...    122   5e-27   
emb|CBI37761.3|  unnamed protein product                                120   5e-27   



>ref|XP_009628102.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana tomentosiformis]
Length=760

 Score =   273 bits (697),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             LD  DVAGTFGYLAPEYF+ GKI EKIDVYA GVVLLELL+GKKPIDN N KGQESLV+W
Sbjct  571   LDSADVAGTFGYLAPEYFMQGKITEKIDVYAFGVVLLELLTGKKPIDNGNGKGQESLVMW  630

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AKQ+LK GK  ELLD S+++AYDHD+F+RMVLAA+LCIRR P FRP+IDIVVKLL+G+ E
Sbjct  631   AKQVLKGGKMRELLDPSMIDAYDHDQFERMVLAASLCIRRAPGFRPQIDIVVKLLQGDTE  690

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDS-LSITSSDQNISVDDYL  493
             TI+WAR+   + +EVD V GEQPAS+IQSFINLAL+NLED+S LS  S+   ISV+DYL
Sbjct  691   TIKWAREEGKASEEVDAVDGEQPASNIQSFINLALMNLEDESPLSCNSTGPTISVEDYL  749



>ref|XP_009788830.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=707

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 151/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             LD  DVAGTFGYLAPEYF+ GKI EKIDVYA GVVL ELLSGKKPIDN N KGQESLV+W
Sbjct  518   LDSADVAGTFGYLAPEYFMQGKITEKIDVYAFGVVLFELLSGKKPIDNGNGKGQESLVIW  577

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AKQ LK G+  ELLD SL++AYDHD+F+RMVLAA+LCIRR P FRP+IDIVVKLL+GE E
Sbjct  578   AKQALKCGEMRELLDPSLIDAYDHDQFERMVLAASLCIRRAPGFRPQIDIVVKLLQGEAE  637

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDD-SLSITSSDQNISVDDYL  493
             TI+WAR+   + +EVD V GEQPAS+IQSFINLAL+NLED+ SLS  S+   ISV+DYL
Sbjct  638   TIKWAREEGKASEEVDAVDGEQPASNIQSFINLALMNLEDESSLSCNSTGPTISVEDYL  696



>ref|XP_006345367.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Solanum tuberosum]
Length=717

 Score =   266 bits (681),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             LD +DVAGTFGYLAPEYF+HGKI EKIDVYA GVVLLELLSGKKPIDN N KGQESLV+W
Sbjct  528   LDSIDVAGTFGYLAPEYFMHGKITEKIDVYAFGVVLLELLSGKKPIDNGNGKGQESLVMW  587

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AKQ+LK G   ELLD SL++ YDHD+F+RMV AA+LCIRR P  RP+IDIVVKLL+GE E
Sbjct  588   AKQVLKGGNTKELLDPSLIDTYDHDQFERMVSAASLCIRRAPGIRPQIDIVVKLLQGEAE  647

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDD-SLSITSSDQNISVDDYL  493
             TI+WA +     +EVD V GEQP S+IQSFINLALLNLED+ SLS TS+   ISV+DYL
Sbjct  648   TIKWAIEEGKFSEEVDAVDGEQPPSNIQSFINLALLNLEDESSLSCTSTGPTISVEDYL  706



>ref|XP_010320789.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Solanum lycopersicum]
Length=606

 Score =   264 bits (674),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             LD +DVAGTFGYLAPEYF+HGKI EKIDVYA GVVLLELLSGKKPIDN N KGQESLV+W
Sbjct  417   LDSIDVAGTFGYLAPEYFMHGKITEKIDVYAFGVVLLELLSGKKPIDNGNGKGQESLVMW  476

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AKQ+LK G   ELLD SL++  DHD+F+RMV AA+LCIRR P  RP+IDIV+KLL+GE E
Sbjct  477   AKQVLKGGNTKELLDPSLIDTCDHDQFERMVSAASLCIRRAPGIRPQIDIVLKLLQGEAE  536

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDD-SLSITSSDQNISVDDYL  493
             TI+WA +   + +EVD V GEQP S+IQSFINLALLNLED+ SLS TS+   ISV+DYL
Sbjct  537   TIKWAMEEGKTSEEVDAVDGEQPPSNIQSFINLALLNLEDESSLSCTSTGPTISVEDYL  595



>ref|XP_004229167.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Solanum lycopersicum]
Length=717

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             LD +DVAGTFGYLAPEYF+HGKI EKIDVYA GVVLLELLSGKKPIDN N KGQESLV+W
Sbjct  528   LDSIDVAGTFGYLAPEYFMHGKITEKIDVYAFGVVLLELLSGKKPIDNGNGKGQESLVMW  587

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AKQ+LK G   ELLD SL++  DHD+F+RMV AA+LCIRR P  RP+IDIV+KLL+GE E
Sbjct  588   AKQVLKGGNTKELLDPSLIDTCDHDQFERMVSAASLCIRRAPGIRPQIDIVLKLLQGEAE  647

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDD-SLSITSSDQNISVDDYL  493
             TI+WA +   + +EVD V GEQP S+IQSFINLALLNLED+ SLS TS+   ISV+DYL
Sbjct  648   TIKWAMEEGKTSEEVDAVDGEQPPSNIQSFINLALLNLEDESSLSCTSTGPTISVEDYL  706



>ref|XP_011091800.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Sesamum 
indicum]
Length=690

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +D  DVAGTFGYLAPEYF+HGK+NE+IDVYA GVVLLELLSG+KPIDN + KGQESLV+W
Sbjct  500   MDTSDVAGTFGYLAPEYFIHGKLNERIDVYAFGVVLLELLSGRKPIDNGHPKGQESLVMW  559

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK GK +ELLD +L+NA D D+F+R+VLAATLCIR  P  RP I  V+KLL G+PE
Sbjct  560   AKHILKEGKTSELLDPNLVNACDPDQFERLVLAATLCIRDAPQSRPDISTVLKLLRGDPE  619

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
              + WARQ  N+ ++++ + GEQ A++IQSFINLALLNLEDD+ SI+S++QNISV+DYL
Sbjct  620   VVDWARQETNASEDINAINGEQSAANIQSFINLALLNLEDDTASISSTEQNISVEDYL  677



>emb|CDP16448.1| unnamed protein product [Coffea canephora]
Length=720

 Score =   245 bits (626),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 144/174 (83%), Gaps = 1/174 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPIDN + KG ESLV WAKQI
Sbjct  533   DVAGTFGYLAPEYFMHGKVVDKIDVYAYGVVLLELLSGRKPIDNGHPKGPESLVTWAKQI  592

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             LK GK  +LLD SL+NAYD +  ++MVLAA+LCIRR P FRP I IV KLL+G+ ET +W
Sbjct  593   LKGGKVADLLDPSLVNAYDDERIEKMVLAASLCIRRGPQFRPNISIVAKLLQGDQETTRW  652

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             ARQ +   DEVD V G+Q +++IQSFINLALLNLED S+S +S++Q ISV+DYL
Sbjct  653   ARQQVKGMDEVD-VEGQQSSTNIQSFINLALLNLEDHSVSSSSTEQTISVEDYL  705



>ref|XP_011088213.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Sesamum indicum]
Length=669

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +   DVAGTFGYLAPEYF+HGK+NEKIDVYA GVVLLELLSG+KPIDN    GQESLV+W
Sbjct  470   MSASDVAGTFGYLAPEYFMHGKLNEKIDVYAFGVVLLELLSGRKPIDNGFPNGQESLVMW  529

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK GK +EL D  L+NA + D+F++MVLAATLCIR EP  RP+  +V+KLL G+PE
Sbjct  530   AKHILKEGKISELQDPKLVNACNWDQFEKMVLAATLCIRLEPQSRPETSLVLKLLRGDPE  589

Query  666   TIQWARQNLNSGDEV-DEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
              ++WARQ   + +++ + + GEQ A++IQSFINLALLNL+DDS S +S++QN+SV+DYL
Sbjct  590   VVEWARQETETSEDLFNVINGEQSATNIQSFINLALLNLDDDSASNSSTEQNLSVEDYL  648



>gb|EYU38253.1| hypothetical protein MIMGU_mgv1a002401mg [Erythranthe guttata]
Length=679

 Score =   240 bits (612),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  1023  DGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWA  844
             D  D+AGTFGYLAPEYF+HGK+NEKIDVYA GVVLLELLSG+KPIDN   KGQESLV+WA
Sbjct  492   DTSDLAGTFGYLAPEYFMHGKLNEKIDVYAFGVVLLELLSGRKPIDNAFPKGQESLVMWA  551

Query  843   KQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPET  664
             K ILK GK +EL D  L+NA +H E++ MVLAATLCIR  P  RP+I +V KLL+G+ E 
Sbjct  552   KHILKEGKISELQDPKLVNACNHKEYEIMVLAATLCIRTAPQSRPQISLVSKLLQGDQEV  611

Query  663   IQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             + WARQ   S +E++ +  E  A+++QSFINLA L+LEDDS SI+S++QNISV+DYL
Sbjct  612   VDWARQETKSCEEINFISNELSATNMQSFINLAFLDLEDDSDSISSTEQNISVEDYL  668



>gb|EYU42966.1| hypothetical protein MIMGU_mgv1a002423mg [Erythranthe guttata]
Length=677

 Score =   232 bits (592),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 145/179 (81%), Gaps = 1/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +D  DVAGTFGYLAPEYF++ K+NEKIDVYA GVVLLELLSG+KPIDN   KG+ESLV+W
Sbjct  488   MDTSDVAGTFGYLAPEYFMNEKLNEKIDVYAFGVVLLELLSGRKPIDNALPKGEESLVMW  547

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +LK G  +EL D +L+NA D D+F +MVLAATLCIR  P  RP I  V+KLL+G+ E
Sbjct  548   AKHVLKEGNNSELQDPNLVNACDGDQFKKMVLAATLCIRHAPQSRPDISRVLKLLKGDQE  607

Query  666   TIQWARQNLNSGDEVDE-VGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
              ++WARQ ++S DEV+  + GE+  ++IQSFINLALL+LEDD+ S++S +QNISV+DYL
Sbjct  608   IVEWARQEVSSLDEVNNAINGERSTNNIQSFINLALLDLEDDTNSVSSGEQNISVEDYL  666



>ref|XP_011649434.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Cucumis sativus]
 gb|KGN62217.1| hypothetical protein Csa_2G336150 [Cucumis sativus]
Length=725

 Score =   232 bits (591),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  540   TDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELLSGRKPISNNCPKGQESLVMWAKP  599

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD SL + Y+HD+  RM+LAATLCIRR P  RP+I +++KLL+G+ E   
Sbjct  600   ILTEGKVSQLLDPSLGSDYNHDQIGRMILAATLCIRRAPRLRPQISLILKLLQGDEEITT  659

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WARQ ++  DE+D   GE   ++IQS +NLALL LEDDSLS+ S  Q+IS++DYL
Sbjct  660   WARQQIDESDEMDASDGEPLPTNIQSHLNLALLGLEDDSLSVGSGIQSISIEDYL  714



>ref|XP_008460873.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Cucumis melo]
Length=725

 Score =   232 bits (591),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  540   TDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELLSGRKPISNNCPKGQESLVMWAKP  599

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD SL + Y+HD+  RM+LAATLCIRR P  RP+I +++KLL+G+ E   
Sbjct  600   ILSEGKVSQLLDPSLGSDYNHDQIGRMILAATLCIRRAPRLRPQISLILKLLQGDEEITT  659

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WARQ ++  DE+D   GE   ++IQS +NLALL LEDDSLS+ S  Q+IS++DYL
Sbjct  660   WARQQIDETDELDASDGEPLPTNIQSHLNLALLGLEDDSLSVGSGIQSISIEDYL  714



>ref|XP_007048485.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007048486.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007048487.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92642.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92643.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92644.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
Length=726

 Score =   230 bits (586),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +   DVAGTFGYLAPEYF+HGK+++K+DVYA G+VLLELLSG+KPIDN   KGQESLV+W
Sbjct  538   MTCTDVAGTFGYLAPEYFMHGKMSDKVDVYAFGIVLLELLSGRKPIDNDCPKGQESLVMW  597

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+ K ++LLD  L + YD  + +R++LAATLCIRR PI RP+I +++KLL+G+ E
Sbjct  598   AKPILKDSKISQLLDPQLGSGYDFHQIERIILAATLCIRRAPIMRPQISLILKLLQGDQE  657

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WARQ + + +EVD V GE   ++I+S +NLALL+LEDDSLS++S++Q++ ++DYL
Sbjct  658   VTNWARQQVRASEEVDTVDGEVYPTNIESHLNLALLDLEDDSLSVSSNEQSVPIEDYL  715



>ref|XP_010087185.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
 gb|EXB28442.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
Length=718

 Score =   229 bits (583),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK 
Sbjct  531   TDVAGTFGYLAPEYFMYGKVNNKIDVYAFGVVLLELLSGRKPISSDYPKGQESLVMWAKP  590

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD SL  +YD D  +RMVLAATLCIRR P  RP++ +VVKLL+G+PE I+
Sbjct  591   ILNEGKVSKLLDPSLGGSYDQDRIERMVLAATLCIRRAPRARPQMSLVVKLLQGDPEVIK  650

Query  657   WARQNLNSGDEVDEVGGEQ--PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +NS  E D V  E   P S++QS +NLALL++EDDSLS++S +Q++S++DYL
Sbjct  651   WARLQMNSVKEADIVDDEAGCPRSNLQSHLNLALLDVEDDSLSMSSIEQSVSLEDYL  707



>ref|XP_010027607.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Eucalyptus 
grandis]
 gb|KCW54154.1| hypothetical protein EUGRSUZ_I00126 [Eucalyptus grandis]
Length=717

 Score =   226 bits (577),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+++ IDVYA GVV+LEL+SG++PID    KG ESLV+WAK I
Sbjct  533   DVAGTFGYLAPEYFMHGKVSDLIDVYAFGVVILELISGRRPIDGECPKGLESLVMWAKPI  592

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             LK GK ++LLD SL   YD ++  RMVLAATLCIRR   FRP+I +++KLL+G+ E  +W
Sbjct  593   LKAGKVSQLLDPSLDRDYDPEQIGRMVLAATLCIRRSSRFRPRISLILKLLQGDEEVREW  652

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             ARQ +NS +E+DE+ GE    SIQS +NLA  +LEDDSLS++S+DQ++S +DYL
Sbjct  653   ARQQINSSEELDEMEGEDSPVSIQSHLNLAFQDLEDDSLSVSSTDQSMSSEDYL  706



>gb|KCW54153.1| hypothetical protein EUGRSUZ_I00126 [Eucalyptus grandis]
Length=742

 Score =   226 bits (577),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+++ IDVYA GVV+LEL+SG++PID    KG ESLV+WAK I
Sbjct  558   DVAGTFGYLAPEYFMHGKVSDLIDVYAFGVVILELISGRRPIDGECPKGLESLVMWAKPI  617

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             LK GK ++LLD SL   YD ++  RMVLAATLCIRR   FRP+I +++KLL+G+ E  +W
Sbjct  618   LKAGKVSQLLDPSLDRDYDPEQIGRMVLAATLCIRRSSRFRPRISLILKLLQGDEEVREW  677

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             ARQ +NS +E+DE+ GE    SIQS +NLA  +LEDDSLS++S+DQ++S +DYL
Sbjct  678   ARQQINSSEELDEMEGEDSPVSIQSHLNLAFQDLEDDSLSVSSTDQSMSSEDYL  731



>ref|XP_002310531.2| hypothetical protein POPTR_0007s04490g [Populus trichocarpa]
 gb|EEE90981.2| hypothetical protein POPTR_0007s04490g [Populus trichocarpa]
Length=743

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+ PI++ + KGQESLV+WAK 
Sbjct  558   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRMPINSEHPKGQESLVMWAKP  617

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LLD  L + YD D  +RMVLAATLCIRR P  RP++ +++KLL+G+ E   
Sbjct  618   ILEGGKVSQLLDPHLGSEYDDDHIERMVLAATLCIRRSPRCRPQMSLILKLLQGDEEVKN  677

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E+D V GE   ++IQS +NLALL+LEDDSLSI+S++Q +SV+DYL
Sbjct  678   WARHQVCASEELDAVDGEAFPTNIQSHLNLALLDLEDDSLSISSTEQGVSVEDYL  732



>emb|CBI37518.3| unnamed protein product [Vitis vinifera]
Length=726

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  543   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSEYPKGQESLVMWAKPI  602

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK ++LLD  L + YD  + +RMVLAATLC+RR P FRP+I +V+KLL G+ E IQW
Sbjct  603   LRSGKISKLLDPDLDSNYDDPQIERMVLAATLCLRRAPRFRPQIGLVLKLLLGDMEIIQW  662

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+Q + S  E  EV GE   S+IQS +NLALL+LEDDSLSI+S++Q+IS++DYL
Sbjct  663   AKQQV-SAMEGQEVEGESFPSNIQSHLNLALLDLEDDSLSISSTEQSISLEDYL  715



>emb|CAN81737.1| hypothetical protein VITISV_043580 [Vitis vinifera]
Length=738

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  555   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSEYPKGQESLVMWAKPI  614

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK ++LLD  L + YD  + +RMVLAATLC+RR P FRP+I +V+KLL G+ E IQW
Sbjct  615   LRSGKISKLLDPDLDSNYDDPQIERMVLAATLCLRRAPRFRPQIGLVLKLLLGDMEIIQW  674

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+Q + S  E  EV GE   S+IQS +NLALL+LEDDSLSI+S++Q+IS++DYL
Sbjct  675   AKQQV-SAMEGQEVEGESFPSNIQSHLNLALLDLEDDSLSISSTEQSISLEDYL  727



>ref|XP_002264653.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=768

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  585   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSEYPKGQESLVMWAKPI  644

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK ++LLD  L + YD  + +RMVLAATLC+RR P FRP+I +V+KLL G+ E IQW
Sbjct  645   LRSGKISKLLDPDLDSNYDDPQIERMVLAATLCLRRAPRFRPQIGLVLKLLLGDMEIIQW  704

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+Q + S  E  EV GE   S+IQS +NLALL+LEDDSLSI+S++Q+IS++DYL
Sbjct  705   AKQQV-SAMEGQEVEGESFPSNIQSHLNLALLDLEDDSLSISSTEQSISLEDYL  757



>ref|XP_004289287.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Fragaria vesca subsp. vesca]
Length=698

 Score =   223 bits (569),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +D  DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLELLSG++PI +   K QESLV+W
Sbjct  510   IDCTDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELLSGRQPIYSKCPKDQESLVMW  569

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK G+  +LLD S+ + YDHD+ +RMV+AA LCIR  P  RP+I  V+KLL+G+ E
Sbjct  570   AKPILKGGEVAQLLDPSMGSDYDHDQIERMVVAANLCIRHAPGLRPEISTVLKLLQGDEE  629

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
               +WARQ +++ DE+D + GE   ++I+S +N+ALL+LEDDSLS +S +Q+ISV++YL
Sbjct  630   ITRWARQQVSASDELDALDGEVVPTNIKSHLNMALLDLEDDSLSTSSGEQSISVEEYL  687



>ref|XP_012092538.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 isoform 
X2 [Jatropha curcas]
Length=699

 Score =   223 bits (568),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF+HGK++EK+DV+A GVVLLELLSG+ PI+    KGQESLV+W
Sbjct  512   LTCTDVAGTFGYLAPEYFMHGKVSEKVDVFAFGVVLLELLSGRMPINGEQLKGQESLVMW  571

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK IL+  K  +LLD  + N YDHD+ +RMVLAATLCIRR P  RP+I +V+KLL+G+ E
Sbjct  572   AKPILEGDKVFQLLDPHIGNEYDHDQIERMVLAATLCIRRSPRLRPQISLVLKLLQGDNE  631

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WARQ + S  EVD   GE   ++IQS +N+ALL+LEDDSLS +S++Q IS++DYL
Sbjct  632   VKNWARQEV-STSEVDAADGEVFPTNIQSHLNIALLDLEDDSLSTSSTEQGISLEDYL  688



>ref|XP_009355844.1| PREDICTED: tyrosine-protein kinase Lck-like [Pyrus x bretschneideri]
Length=742

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 140/178 (79%), Gaps = 2/178 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +   DVAGTFGYLAPEYF+HGK+++KIDVYA GVV+LE+LSG+KPI + + KGQESLV+W
Sbjct  556   ISCTDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVVLEILSGRKPIFSKDPKGQESLVMW  615

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+G   +LLD SL  AYDHD+ +RM+LAA LCIR  P  RP I +V+KLL+G+ E
Sbjct  616   AKPILKSGNVAQLLDPSLGIAYDHDQIERMILAANLCIRHAPGLRPNISVVLKLLQGDEE  675

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
               +WARQ   S DE   V GE P+ SIQS +NLAL +LEDDS+S++S +Q+I+++DYL
Sbjct  676   VTRWARQVSVSEDEA--VDGEAPSCSIQSHLNLALRDLEDDSVSVSSGEQSIALEDYL  731



>ref|XP_012092537.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 isoform 
X1 [Jatropha curcas]
 gb|KDP20470.1| hypothetical protein JCGZ_05332 [Jatropha curcas]
Length=713

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF+HGK++EK+DV+A GVVLLELLSG+ PI+    KGQESLV+W
Sbjct  526   LTCTDVAGTFGYLAPEYFMHGKVSEKVDVFAFGVVLLELLSGRMPINGEQLKGQESLVMW  585

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK IL+  K  +LLD  + N YDHD+ +RMVLAATLCIRR P  RP+I +V+KLL+G+ E
Sbjct  586   AKPILEGDKVFQLLDPHIGNEYDHDQIERMVLAATLCIRRSPRLRPQISLVLKLLQGDNE  645

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WARQ + S  EVD   GE   ++IQS +N+ALL+LEDDSLS +S++Q IS++DYL
Sbjct  646   VKNWARQEV-STSEVDAADGEVFPTNIQSHLNIALLDLEDDSLSTSSTEQGISLEDYL  702



>ref|XP_011022896.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g15730 [Populus euphratica]
Length=718

 Score =   223 bits (568),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+ PI++ + KGQESLV+WAK 
Sbjct  533   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRMPINSEHPKGQESLVMWAKP  592

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LLD  L + YD D  +RMVLAATLCIRR P  RP++ I++KLL+G+ +   
Sbjct  593   ILEGGKVSQLLDPHLGSEYDDDHIERMVLAATLCIRRSPRCRPQMSIILKLLQGDEDVKN  652

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E+D V GE   ++IQS +NLALL+LEDDSLSI+S++  +S++DYL
Sbjct  653   WARHQVCASEELDAVDGEAFPTNIQSHLNLALLDLEDDSLSISSTEHGVSIEDYL  707



>ref|XP_008367819.1| PREDICTED: uncharacterized protein LOC103431442 [Malus domestica]
Length=796

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +   DVAGTFGYLAPEYF+HGK+++KIDVYA GVV+LE+LSG+KPI + + KGQESLV+W
Sbjct  609   ISCTDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVVLEILSGRKPIFSKDPKGQESLVMW  668

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+G   +LLD SL  AYDHD+ +RM+LAA LCIR  P  RP I +V+KLL+G+ E
Sbjct  669   AKPILKSGNVAQLLDPSLGIAYDHDQIERMILAANLCIRHAPGLRPNISVVLKLLQGDEE  728

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
               +WARQ ++  +E + V GE P+ +IQS +NLAL +LEDDS+S++S +Q+I+++DYL
Sbjct  729   VTRWARQ-VSVSEEDEAVDGEAPSCNIQSHLNLALRDLEDDSVSVSSGEQSIALEDYL  785



>ref|XP_007019225.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
 gb|EOY16450.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
Length=771

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  585   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNDYPKGQESLVMWAKP  644

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD SL + YD D+ +RMVLAATLCIRR P  RP++ +V KLL+G+ +  +
Sbjct  645   ILSGGKVSQLLDPSLGDGYDRDQMERMVLAATLCIRRAPRARPQMSVVWKLLQGDADVTK  704

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  D + GE  P S++QS ++LALL++EDDSLS++S +Q++S++DYL
Sbjct  705   WARLQVNASEGSDALDGEACPRSNLQSHLSLALLDVEDDSLSVSSIEQSVSLEDYL  760



>ref|XP_006434294.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
 gb|ESR47534.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
Length=611

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+G+KPI N + KGQESLV+WAK 
Sbjct  425   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTGRKPISNDHPKGQESLVMWAKP  484

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK T+LLD +L N YD+D+ +RMVLA+ LCIRR+P  RP++ +V+KLL G+ +  +
Sbjct  485   ILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDPRARPQMSLVLKLLRGDADVTK  544

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E + +  E  P S++QS +NLALL++EDDS S++S +Q++S++DYL
Sbjct  545   WARLQVNASEESEMLDDESCPRSNLQSHLNLALLDVEDDSFSMSSIEQSVSLEDYL  600



>gb|KDO80471.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=611

 Score =   220 bits (560),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+G+KPI N + KGQESLV+WAK 
Sbjct  425   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTGRKPISNDHPKGQESLVMWAKP  484

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK T+LLD +L N YD+D+ +RMVLA+ LCIRR+P  RP++ +V+KLL G+ +  +
Sbjct  485   ILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDPRARPQMSLVLKLLRGDADVTK  544

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E + +  E  P S++QS +NLALL++EDDS S++S +Q++S++DYL
Sbjct  545   WARLQVNASEESEMLDDESCPRSNLQSHLNLALLDVEDDSFSMSSIEQSVSLEDYL  600



>gb|KDO80468.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=696

 Score =   221 bits (562),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+G+KPI N + KGQESLV+WAK 
Sbjct  510   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTGRKPISNDHPKGQESLVMWAKP  569

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK T+LLD +L N YD+D+ +RMVLA+ LCIRR+P  RP++ +V+KLL G+ +  +
Sbjct  570   ILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDPRARPQMSLVLKLLRGDADVTK  629

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E + +  E  P S++QS +NLALL++EDDS S++S +Q++S++DYL
Sbjct  630   WARLQVNASEESEMLDDESCPRSNLQSHLNLALLDVEDDSFSMSSIEQSVSLEDYL  685



>gb|KDO80469.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=766

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+G+KPI N + KGQESLV+WAK 
Sbjct  580   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTGRKPISNDHPKGQESLVMWAKP  639

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK T+LLD +L N YD+D+ +RMVLA+ LCIRR+P  RP++ +V+KLL G+ +  +
Sbjct  640   ILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDPRARPQMSLVLKLLRGDADVTK  699

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E + +  E  P S++QS +NLALL++EDDS S++S +Q++S++DYL
Sbjct  700   WARLQVNASEESEMLDDESCPRSNLQSHLNLALLDVEDDSFSMSSIEQSVSLEDYL  755



>gb|KDO80470.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=770

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+G+KPI N + KGQESLV+WAK 
Sbjct  584   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTGRKPISNDHPKGQESLVMWAKP  643

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK T+LLD +L N YD+D+ +RMVLA+ LCIRR+P  RP++ +V+KLL G+ +  +
Sbjct  644   ILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDPRARPQMSLVLKLLRGDADVTK  703

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E + +  E  P S++QS +NLALL++EDDS S++S +Q++S++DYL
Sbjct  704   WARLQVNASEESEMLDDESCPRSNLQSHLNLALLDVEDDSFSMSSIEQSVSLEDYL  759



>ref|XP_002520305.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42091.1| ATP binding protein, putative [Ricinus communis]
Length=758

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+NEKIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  572   TDVAGTFGYLAPEYFMYGKVNEKIDVYAFGVVLLELLSGRKPISNDLPKGQESLVMWAKP  631

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + YD D+ +RMVLAATLC++R P  RP++ +V+KLL G+ E  +
Sbjct  632   ILDDGKFCQLLDPSLGDDYDQDQMERMVLAATLCVKRSPRARPQMSLVLKLLHGDAEVTK  691

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N  +E D +  E  P S+IQS +NLA L++EDDSLSI+S +Q +S++DYL
Sbjct  692   WARLQVNKVEESDMLDDETCPRSNIQSHLNLAFLDVEDDSLSISSIEQTVSLEDYL  747



>ref|XP_006434295.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
 gb|ESR47535.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
Length=770

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+G+KPI N + KGQESLV+WAK 
Sbjct  584   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTGRKPISNDHPKGQESLVMWAKP  643

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK T+LLD +L N YD+D+ +RMVLA+ LCIRR+P  RP++ +V+KLL G+ +  +
Sbjct  644   ILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDPRARPQMSLVLKLLRGDADVTK  703

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E + +  E  P S++QS +NLALL++EDDS S++S +Q++S++DYL
Sbjct  704   WARLQVNASEESEMLDDESCPRSNLQSHLNLALLDVEDDSFSMSSIEQSVSLEDYL  759



>ref|XP_011031141.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X3 [Populus euphratica]
Length=714

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  530   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  589

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  590   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  648

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  649   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  703



>ref|XP_011011404.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X3 [Populus euphratica]
Length=714

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  530   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  589

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  590   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  648

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  649   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  703



>ref|XP_011011405.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X4 [Populus euphratica]
Length=713

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  529   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  588

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  589   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  647

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  648   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  702



>ref|XP_011031140.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X2 [Populus euphratica]
Length=718

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  534   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  593

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  594   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  652

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  653   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  707



>ref|XP_011011403.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X2 [Populus euphratica]
Length=718

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  534   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  593

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  594   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  652

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  653   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  707



>ref|XP_011031139.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Populus euphratica]
Length=720

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  536   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  595

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  596   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  654

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  655   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  709



>ref|XP_011011402.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X1 [Populus euphratica]
Length=720

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  536   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  595

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  596   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  654

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  655   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  709



>ref|XP_011031142.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X4 [Populus euphratica]
Length=713

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  529   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  588

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  589   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  647

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  648   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  702



>ref|XP_002307046.2| hypothetical protein POPTR_0005s06800g [Populus trichocarpa]
 gb|EEE94042.2| hypothetical protein POPTR_0005s06800g [Populus trichocarpa]
Length=720

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+KPI++ + KGQESLV+WAK 
Sbjct  536   TDVAGTFGYLAPEYFMHGKVSDKVDVFAFGVVLLELLSGRKPINSEHPKGQESLVMWAKP  595

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LL   L + YD D  +RMVLAATLC+RR P +RP++ +V+KLL+G+ E   
Sbjct  596   ILEGGKVSQLL-PRLGSEYDDDHIERMVLAATLCLRRSPKWRPQMSLVLKLLQGDEEVKN  654

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  + + +E D + GE   S+IQS +NLALL+LEDDSLSI+S++Q +S++DYL
Sbjct  655   WARHQVCASEEHDAMDGETFPSNIQSHLNLALLDLEDDSLSISSTEQGVSIEDYL  709



>ref|XP_006472861.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase II.1-like [Citrus sinensis]
Length=770

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+G+KPI N + KGQESLV+WAK 
Sbjct  584   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTGRKPISNDHPKGQESLVMWAKP  643

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK T+LLD +L N YD+D+ +RMVLA+ LCIRR+P  RP++ +V+KLL G+ +  +
Sbjct  644   ILSSGKVTQLLDPALGNNYDYDQTERMVLASILCIRRDPRARPQMSLVLKLLRGDADVTK  703

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E + +  E  P S++QS +NLALL++EDDS S++S +Q++S++DYL
Sbjct  704   WARLQVNASEESEMLDDESCPRSNLQSHLNLALLDVEDDSFSMSSIEQSVSLEDYL  759



>gb|KDP32865.1| hypothetical protein JCGZ_12157 [Jatropha curcas]
Length=751

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KPI N + KGQESLVLWAK I
Sbjct  566   DVVGTFGYLAPEYFMYGKVNNKIDVYAFGVVLLELLSGRKPISNNHPKGQESLVLWAKPI  625

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + K ++LLD SL + YDHD+ +RMVLAATLC++R P  RP+I +V+KLL+G+ E ++W
Sbjct  626   LNDEKFSQLLDPSLGDDYDHDQMERMVLAATLCVKRSPRARPQISLVLKLLQGDTEVMKW  685

Query  654   ARQNLNSGDEVDEVGGE-QPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+ +E + +  +  P S+++S +NLALL++EDDSLS++S++Q +S++DYL
Sbjct  686   ARLQVNTAEEPEMLDDDVCPRSNLRSHLNLALLDVEDDSLSLSSNEQTVSLEDYL  740



>ref|XP_012078327.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Jatropha curcas]
Length=794

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KPI N + KGQESLVLWAK I
Sbjct  609   DVVGTFGYLAPEYFMYGKVNNKIDVYAFGVVLLELLSGRKPISNNHPKGQESLVLWAKPI  668

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + K ++LLD SL + YDHD+ +RMVLAATLC++R P  RP+I +V+KLL+G+ E ++W
Sbjct  669   LNDEKFSQLLDPSLGDDYDHDQMERMVLAATLCVKRSPRARPQISLVLKLLQGDTEVMKW  728

Query  654   ARQNLNSGDEVDEVGGE-QPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+ +E + +  +  P S+++S +NLALL++EDDSLS++S++Q +S++DYL
Sbjct  729   ARLQVNTAEEPEMLDDDVCPRSNLRSHLNLALLDVEDDSLSLSSNEQTVSLEDYL  783



>ref|XP_008227546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103327047 
[Prunus mume]
Length=748

 Score =   219 bits (557),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             VAGTFGYLAPEYF+HGK+++KIDVYA GVV+LELLSG+KPI + + KGQESLV+WAK IL
Sbjct  565   VAGTFGYLAPEYFMHGKVSDKIDVYAFGVVVLELLSGRKPIYSKDTKGQESLVMWAKPIL  624

Query  831   KNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWA  652
             K+G   +LLD SL + YD D+ +RMVLAA LCIR  P  RP I++V+KLL+G+ E  + A
Sbjct  625   KSGNVAQLLDPSLGSDYDQDQIERMVLAANLCIRHTPKLRPPINLVLKLLQGDEEVTRCA  684

Query  651   RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             RQ +++ +E++ + GE   S+IQS +NLALL+LEDDSLS +S +Q+IS++DYL
Sbjct  685   RQQVSASEELEALDGEALPSNIQSHLNLALLDLEDDSLSTSSGEQSISLEDYL  737



>ref|XP_007214539.1| hypothetical protein PRUPE_ppa002094mg [Prunus persica]
 gb|EMJ15738.1| hypothetical protein PRUPE_ppa002094mg [Prunus persica]
Length=717

 Score =   218 bits (556),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             VAGTFGYLAPEYF+HGK+++KIDVYA GVV+LELLSG+KPI + + KGQESLV+WAK IL
Sbjct  534   VAGTFGYLAPEYFMHGKVSDKIDVYAFGVVVLELLSGRKPIYSKDTKGQESLVMWAKPIL  593

Query  831   KNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWA  652
             K+G   +LLD SL + YD D+ +RMVLAA LCIR  P  RP I++V+KLL+G+ E  + A
Sbjct  594   KSGNVAQLLDPSLGSDYDQDQIERMVLAANLCIRHTPKLRPPINLVLKLLQGDEEVTRCA  653

Query  651   RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             RQ +++ +E++ + GE   S IQS +NLALL+LEDDSLS +S +Q+IS++DYL
Sbjct  654   RQQVSASEELEALDGEALPSDIQSHLNLALLDLEDDSLSTSSGEQSISLEDYL  706



>gb|KHN05157.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=711

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  525   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISGDYPKGQESLVMWASP  584

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  ++LD SL   YDH+E +RMVLAATLCIRR P  RP + ++ KLL G+P+ I+
Sbjct  585   ILNSGKVLQMLDPSLGENYDHEEMERMVLAATLCIRRAPRARPLMSLISKLLGGDPDVIK  644

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR   N+ +  + + GE  P S++QS +NLALL++EDDSLS+ S +QN+S++DYL
Sbjct  645   WARLEANALEAPEMLDGEACPPSNLQSHLNLALLDVEDDSLSMCSVEQNVSLEDYL  700



>ref|XP_004290918.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Fragaria vesca subsp. vesca]
Length=744

 Score =   218 bits (555),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSGKKPI +  +KG ESLV+WAK 
Sbjct  558   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGKKPISSDYSKGNESLVMWAKP  617

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK ++LLD SL N YD  + +RMVLAATLCIR  P  RP++  VVKLL+G+ E I+
Sbjct  618   ILNSGKVSQLLDPSLGNKYDQGQVERMVLAATLCIRHSPRARPQMSFVVKLLQGDVEMIK  677

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +++ +E D +  E  P S++QS +NLALL++EDDSLS++S +Q +S++DYL
Sbjct  678   WARLQVHAWEESDILDDEACPRSNLQSHLNLALLDVEDDSLSMSSIEQTVSLEDYL  733



>ref|XP_003542041.1| PREDICTED: uncharacterized protein LOC100797280 [Glycine max]
Length=736

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  550   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISGDYPKGQESLVMWASP  609

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  ++LD SL   YDH+E +RMVLAATLCIRR P  RP + ++ KLL G+P+ I+
Sbjct  610   ILNSGKVLQMLDPSLGENYDHEEMERMVLAATLCIRRAPRARPLMSLISKLLGGDPDVIK  669

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR   N+ +  + + GE  P S++QS +NLALL++EDDSLS+ S +QN+S++DYL
Sbjct  670   WARLEANALEAPEMLDGEACPPSNLQSHLNLALLDVEDDSLSMCSVEQNVSLEDYL  725



>gb|KHN31175.1| Proline-rich receptor-like protein kinase PERK9 [Glycine soja]
Length=699

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVY+ GVVLLELLS +KPI+N + KGQESLV+WA  
Sbjct  514   TDVAGTFGYLAPEYFMHGRVTDKIDVYSFGVVLLELLSNRKPINNESPKGQESLVMWATP  573

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LLD SL + Y+  +  RM+LAATLCIRR P  RP+I++++KLL G+ E I+
Sbjct  574   ILEGGKFSQLLDPSLGSEYNTCQIKRMILAATLCIRRIPRLRPQINLILKLLHGDEEVIR  633

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q +N+  E+D    E   ++IQS +NLALL+LEDD++SI+S++Q++S++DYL
Sbjct  634   WAEQEVNAPQELDGCDEEPVPTNIQSHLNLALLDLEDDTVSISSTEQSVSLEDYL  688



>ref|XP_006578781.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Glycine max]
Length=699

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVY+ GVVLLELLS +KPI+N + KGQESLV+WA  
Sbjct  514   TDVAGTFGYLAPEYFMHGRVTDKIDVYSFGVVLLELLSNRKPINNESPKGQESLVMWATP  573

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LLD SL + Y+  +  RM+LAATLCIRR P  RP+I++++KLL G+ E I+
Sbjct  574   ILEGGKFSQLLDPSLGSEYNTCQIKRMILAATLCIRRIPRLRPQINLILKLLHGDEEVIR  633

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q +N+  E+D    E   ++IQS +NLALL+LEDD++SI+S++Q++S++DYL
Sbjct  634   WAEQEVNAPQELDGCDEEPVPTNIQSHLNLALLDLEDDTVSISSTEQSVSLEDYL  688



>gb|EYU32494.1| hypothetical protein MIMGU_mgv1a001977mg [Erythranthe guttata]
Length=731

 Score =   216 bits (550),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 141/180 (78%), Gaps = 6/180 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+NEKIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  541   DVAGTFGYLAPEYFMYGKVNEKIDVYAYGVVLLELLSGRKPISSNCPKGQESLVMWAKPI  600

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + K  +LLD +L N YDH++ +RMVLAA+LCIRR P  RP++ +V+KLLEG+ E ++W
Sbjct  601   LNSEKFVQLLDHNLGNNYDHEQVERMVLAASLCIRRAPRARPQMSVVLKLLEGDEEVVKW  660

Query  654   ARQNLNSGDEVDEVGGEQ------PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+  EV E G +         S++QS +NLALL +++DSLS++S +Q++S++DYL
Sbjct  661   ARLQVNASHEVCEEGIDAIDEEIFSKSNLQSHLNLALLGVDEDSLSVSSIEQSVSLEDYL  720



>ref|XP_010093102.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
 gb|EXB53540.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
Length=743

 Score =   216 bits (550),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 144/177 (81%), Gaps = 2/177 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLELLSG+KPI+N   KGQES+VLWA  
Sbjct  556   TDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELLSGRKPINNEFPKGQESIVLWANP  615

Query  837   ILKNGKATELLDASLLNA-YDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
             ILK GK +ELLD SL +A  D ++ +RM+LAATLCIRR P  RP I +VVK+L+G+ E +
Sbjct  616   ILKGGKVSELLDPSLGSAESDKEKIERMILAATLCIRRSPKLRPCISVVVKILQGDEEAV  675

Query  660   QWARQNLNSGDEVDEVGGEQP-ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             +WARQ +++ ++ +EV   +P  S+IQS +NLALL++EDDS S++ S+Q+IS++DYL
Sbjct  676   RWARQQVSASEDEEEVVDGEPLPSNIQSHLNLALLDMEDDSYSLSGSEQSISIEDYL  732



>ref|NP_001238713.1| protein kinase family protein [Glycine max]
 gb|ACM89509.1| protein kinase family protein [Glycine max]
Length=649

 Score =   214 bits (546),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  463   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISGDYPKGQESLVMWASP  522

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + Y+H+E +RMVLAATLC RR P  RP++ ++ KLL G+P+ I+
Sbjct  523   ILNSGKVLQLLDPSLGDNYNHEEMERMVLAATLCTRRAPRARPQMSLISKLLGGDPDVIK  582

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  + +  E  P S++QS +NLALL++EDDSLS+ S +QN+S++DYL
Sbjct  583   WARLEVNALEAPEMLDDEACPPSNLQSHLNLALLDVEDDSLSMCSVEQNVSLEDYL  638



>ref|XP_007137781.1| hypothetical protein PHAVU_009G155000g [Phaseolus vulgaris]
 gb|ESW09775.1| hypothetical protein PHAVU_009G155000g [Phaseolus vulgaris]
Length=697

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVYA GVVLLELLS +KPI+N   KGQESLV+WA  
Sbjct  512   TDVAGTFGYLAPEYFMHGRVTDKIDVYAFGVVLLELLSNRKPINNECPKGQESLVMWATP  571

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             ILK GK T+LLD +L   YD  +  RMVLAA+LCIRR P  RP+I +++KLL G+ E  +
Sbjct  572   ILKGGKVTQLLDPNLGIEYDDCQMKRMVLAASLCIRRVPRLRPQISLILKLLRGDEEVTR  631

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q  N+  E+D    E   ++IQS +NLAL++LEDD++SI+S++Q++S++DYL
Sbjct  632   WAEQEANAPQELDGFDEEPVPTNIQSHLNLALMDLEDDAVSISSTEQSVSLEDYL  686



>ref|XP_008219572.1| PREDICTED: interleukin-1 receptor-associated kinase-like 2 [Prunus 
mume]
Length=761

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KG ESLV+WAK 
Sbjct  575   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKP  634

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD  L N Y+ D+ +RMVLAATLCIR  P  RP++  +VKLL+G+ + I+
Sbjct  635   ILSGGKVSQLLDPCLSNNYNQDQIERMVLAATLCIRHAPRARPQMSFIVKLLQGDADAIK  694

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +++ +E D +  E  P S++QS +NLALL++EDDSLS++S +Q++S++DYL
Sbjct  695   WARLQVHALEESDVLEDEACPRSNLQSHLNLALLDVEDDSLSMSSIEQSVSLEDYL  750



>gb|KHN38974.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=733

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  547   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISGDYPKGQESLVMWASP  606

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + Y+H+E +RMVLAATLC RR P  RP++ ++ KLL G+P+ I+
Sbjct  607   ILNSGKVLQLLDPSLGDNYNHEEMERMVLAATLCTRRAPRARPQMSLISKLLGGDPDVIK  666

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  + +  E  P S++QS +NLALL++EDDSLS+ S +QN+S++DYL
Sbjct  667   WARLEVNALEAPEMLDDEACPPSNLQSHLNLALLDVEDDSLSMCSVEQNVSLEDYL  722



>ref|XP_006595490.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
Length=735

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  549   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISGDYPKGQESLVMWASP  608

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + Y+H+E +RMVLAATLC RR P  RP++ ++ KLL G+P+ I+
Sbjct  609   ILNSGKVLQLLDPSLGDNYNHEEMERMVLAATLCTRRAPRARPQMSLISKLLGGDPDVIK  668

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  + +  E  P S++QS +NLALL++EDDSLS+ S +QN+S++DYL
Sbjct  669   WARLEVNALEAPEMLDDEACPPSNLQSHLNLALLDVEDDSLSMCSVEQNVSLEDYL  724



>ref|XP_007225237.1| hypothetical protein PRUPE_ppa001811mg [Prunus persica]
 gb|EMJ26436.1| hypothetical protein PRUPE_ppa001811mg [Prunus persica]
Length=761

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KG ESLV+WAK 
Sbjct  575   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGHESLVMWAKP  634

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD  L N Y+ D+ +RMVLAATLCIR  P  RP++  +VKLL+G+ + I+
Sbjct  635   ILSGGKVSQLLDPCLSNDYNQDQIERMVLAATLCIRHAPRARPQMSFIVKLLQGDADAIK  694

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +++ +E D +  E  P S++QS +NLALL++EDDSLS++S +Q++S++DYL
Sbjct  695   WARLQVHALEESDVLEDEACPRSNLQSHLNLALLDVEDDSLSMSSIEQSVSLEDYL  750



>ref|XP_004502543.1| PREDICTED: uncharacterized protein LOC101504509 [Cicer arietinum]
Length=731

 Score =   213 bits (543),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQES+V+WA  
Sbjct  544   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISGDYPKGQESIVMWASP  603

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             +L +GK ++LLD SL + YDH+E +RMVLAATLCI+R P  RP + IV KLL+G+ + I+
Sbjct  604   LLNSGKVSQLLDPSLGDNYDHEEMERMVLAATLCIKRAPKARPPMSIVSKLLQGDTDAIK  663

Query  657   WARQNLNSGDEVDEVGGE-QPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  + +  E  P S++QS INLALL++EDDSLS+ S  Q++S++DYL
Sbjct  664   WARLQVNALEAREMLDNEASPHSNLQSHINLALLDVEDDSLSMCSVMQSVSLEDYL  719



>ref|XP_010674424.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Beta vulgaris subsp. vulgaris]
Length=754

 Score =   213 bits (542),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 142/181 (78%), Gaps = 3/181 (2%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF+HGK+ +K+DVY+ GVVLLELLSG+KPIDN N KG+ESLV+W
Sbjct  563   LASSDVAGTFGYLAPEYFMHGKVTDKMDVYSFGVVLLELLSGRKPIDNRNPKGKESLVIW  622

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  ILK+ K ++LLD+ L + YDH++ +R+VLAATLCIRREP  RP+I  V+KLL+G+ E
Sbjct  623   ANTILKDEKLSQLLDSRLGSDYDHEQIERLVLAATLCIRREPQTRPRIGNVLKLLQGDIE  682

Query  666   TIQWARQNLNSGD-EVDEVGGEQPASSI-QSFINLALLNL-EDDSLSITSSDQNISVDDY  496
                WA+Q +NS   + + + GE P S I QS +N+ALL L EDD+ SI+S++ NIS++DY
Sbjct  683   VTNWAKQQVNSYPLDFEVLEGETPRSEILQSHLNVALLGLVEDDNASISSTEPNISLEDY  742

Query  495   L  493
             L
Sbjct  743   L  743



>gb|KHN44298.1| Putative receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=724

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  538   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISPDYPKGQESLVMWATP  597

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL   YDH E ++MVLAATLCI+R P  RP++ ++ KLL+G+ E I+
Sbjct  598   ILNSGKVLQLLDPSLGENYDHGEMEKMVLAATLCIKRAPRARPQMSLISKLLQGDAEAIK  657

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ D  + +  E  P S++QS INLALL++EDDSLS+ S +Q ++++DYL
Sbjct  658   WARLQVNALDAPEMLDDEACPPSNLQSHINLALLDVEDDSLSMCSVEQGLTLEDYL  713



>gb|KHG01419.1| Putative proline-rich receptor-like protein kinase PERK11 [Gossypium 
arboreum]
Length=772

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  585   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNDCPKGQESLVMWAKP  644

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD SL + YD D+ +RMVLAATLC+RR P  RP++ +VVKLL+G+ +  +
Sbjct  645   ILSGGKVSQLLDPSLADGYDCDQMERMVLAATLCLRRAPRARPQMGVVVKLLQGDADVTK  704

Query  657   WARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  D +  E     S++QS ++LALL++E+DS+S++S +Q +S++DYL
Sbjct  705   WARLQVNASEGSDTLDDEACPGRSNLQSHLSLALLDVEEDSVSMSSIEQPVSLEDYL  761



>emb|CBI18962.3| unnamed protein product [Vitis vinifera]
Length=732

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGY+APEYF++GK+NEKIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  547   DVAGTFGYMAPEYFMYGKVNEKIDVYAFGVVLLELLSGRKPISSDYPKGQESLVMWAKPI  606

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L  GK +ELLD SL + YD  + +RMV AA LCIRR P  RP++ +V+KLL+G+ E  +W
Sbjct  607   LYGGKVSELLDPSLGSNYDSSQMERMVWAAILCIRRAPRARPQMSLVLKLLQGDAEATKW  666

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+ +  D    E  P S++QS +NLALL++E+DSLS++S +Q++S++DYL
Sbjct  667   ARLQVNACEGSDTPDDEAFPHSNLQSHLNLALLDVEEDSLSMSSIEQSVSLEDYL  721



>gb|KJB80638.1| hypothetical protein B456_013G108200 [Gossypium raimondii]
Length=775

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  588   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNDCPKGQESLVMWAKP  647

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD SL + YD D+ +RMVLAATLC+RR P  RP++ +VVKLL+G+ +  +
Sbjct  648   ILSGGKVSQLLDPSLADGYDCDQMERMVLAATLCLRRAPRARPQMGVVVKLLQGDADVTK  707

Query  657   WARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  D +  E     S++QS ++LALL++E+DS+S++S +Q +S++DYL
Sbjct  708   WARLQVNASEGSDTLDDEACPGRSNLQSHLSLALLDVEEDSVSMSSIEQPVSLEDYL  764



>ref|XP_003526871.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Glycine max]
Length=700

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVYA GVVLLELLS +KPI+N   KGQ SLV+WA  
Sbjct  515   TDVAGTFGYLAPEYFMHGRVTDKIDVYAFGVVLLELLSNRKPINNECPKGQGSLVMWAIP  574

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LLD SL + YD  +  RM+LAATLCIRR P  RP+I +++KLL G+ E I+
Sbjct  575   ILEGGKFSQLLDPSLGSEYDDCQIRRMILAATLCIRRVPRLRPQISLILKLLHGDEEVIR  634

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q + +  E+D    E   ++IQS +NLALL+LEDD++SI+S++Q++S++DYL
Sbjct  635   WAEQEVIAPQELDGCDEEPVPTNIQSHLNLALLDLEDDTISISSTEQSVSLEDYL  689



>gb|KJB80639.1| hypothetical protein B456_013G108200 [Gossypium raimondii]
Length=805

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  618   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNDCPKGQESLVMWAKP  677

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD SL + YD D+ +RMVLAATLC+RR P  RP++ +VVKLL+G+ +  +
Sbjct  678   ILSGGKVSQLLDPSLADGYDCDQMERMVLAATLCLRRAPRARPQMGVVVKLLQGDADVTK  737

Query  657   WARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  D +  E     S++QS ++LALL++E+DS+S++S +Q +S++DYL
Sbjct  738   WARLQVNASEGSDTLDDEACPGRSNLQSHLSLALLDVEEDSVSMSSIEQPVSLEDYL  794



>ref|XP_004498354.1| PREDICTED: uncharacterized protein LOC101490391 [Cicer arietinum]
Length=728

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI+    KGQESLV+WA  
Sbjct  541   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPINGDYPKGQESLVMWASP  600

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             +L +GK ++LLD SL + YDH+E +RMVLAATLCI+R P  RP++ ++ K+L+G+ + I 
Sbjct  601   VLNSGKISQLLDPSLDDNYDHEEMERMVLAATLCIQRAPGARPQMSLITKVLKGDADVIM  660

Query  657   WARQNLNSGDEVDEVGGEQ---PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA+  +N+  +V E+  E+   P S +QS +NLALL++EDD+LS+ S DQN+S++DYL
Sbjct  661   WAKVEINAL-KVPEMFDEEEACPLSKLQSHLNLALLDVEDDTLSLCSVDQNVSLEDYL  717



>gb|KHN09628.1| Proline-rich receptor-like protein kinase PERK9 [Glycine soja]
Length=699

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVYA GVVLLELLS +KPI+N   KGQ SLV+WA  
Sbjct  514   TDVAGTFGYLAPEYFMHGRVTDKIDVYAFGVVLLELLSNRKPINNECPKGQGSLVMWAIP  573

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK ++LLD SL + YD  +  RM+LAATLCIRR P  RP+I +++KLL G+ E I+
Sbjct  574   ILEGGKFSQLLDPSLGSEYDDCQIRRMILAATLCIRRVPRLRPQISLILKLLHGDEEVIR  633

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q + +  E+D    E   ++IQS +NLALL+LEDD++SI+S++Q++S++DYL
Sbjct  634   WAEQEVIAPQELDGCDEEPVPTNIQSHLNLALLDLEDDTISISSTEQSVSLEDYL  688



>ref|XP_010664160.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Vitis vinifera]
Length=754

 Score =   211 bits (538),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGY+APEYF++GK+NEKIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  569   DVAGTFGYMAPEYFMYGKVNEKIDVYAFGVVLLELLSGRKPISSDYPKGQESLVMWAKPI  628

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L  GK +ELLD SL + YD  + +RMV AA LCIRR P  RP++ +V+KLL+G+ E  +W
Sbjct  629   LYGGKVSELLDPSLGSNYDSSQMERMVWAAILCIRRAPRARPQMSLVLKLLQGDAEATKW  688

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+ +  D    E  P S++QS +NLALL++E+DSLS++S +Q++S++DYL
Sbjct  689   ARLQVNACEGSDTPDDEAFPHSNLQSHLNLALLDVEEDSLSMSSIEQSVSLEDYL  743



>ref|XP_004502962.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Cicer arietinum]
Length=695

 Score =   210 bits (535),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVYA GVVLLELLS +KPI+N   KGQESLV+WA  
Sbjct  510   TDVAGTFGYLAPEYFMHGRVTDKIDVYAFGVVLLELLSNRKPINNECPKGQESLVMWATS  569

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             ILK+GK  +LLD SL + Y+H +  RMVLAATLCIRR P  RP+I +++KLL+G+ E  +
Sbjct  570   ILKSGKIFQLLDPSLGSEYNHCQIKRMVLAATLCIRRVPRSRPQISLILKLLQGDEEVTR  629

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q +++ + +D    E   ++IQS +NLALL+LEDD++S+  S+Q + ++DYL
Sbjct  630   WAEQEVSAPETLDGFDEEPVPTNIQSHLNLALLDLEDDTVSLGGSEQGVLLEDYL  684



>gb|KHN46982.1| Putative receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=724

 Score =   210 bits (535),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  538   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISRDYPKGQESLVMWASP  597

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + YDH+E +++VLAATLCI+R P  RP+++++ KLL+G+ E I+
Sbjct  598   ILNSGKVLQLLDPSLGDNYDHEEMEKIVLAATLCIKRAPRARPQMNLISKLLQGDAEAIK  657

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ D  + +  E  P S++QS INLALL++EDD LS+ S +Q ++++DYL
Sbjct  658   WARLQVNALDPPEMLDDEACPPSNLQSHINLALLDVEDDLLSMCSVEQGLTLEDYL  713



>ref|XP_003526656.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like [Glycine max]
Length=743

 Score =   210 bits (535),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  557   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISRDYPKGQESLVMWASP  616

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + YDH+E +++VLAATLCI+R P  RP+++++ KLL+G+ E I+
Sbjct  617   ILNSGKVLQLLDPSLGDNYDHEEMEKIVLAATLCIKRAPRARPQMNLISKLLQGDAEAIK  676

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ D  + +  E  P S++QS INLALL++EDD LS+ S +Q ++++DYL
Sbjct  677   WARLQVNALDPPEMLDDEACPPSNLQSHINLALLDVEDDLLSMCSVEQGLTLEDYL  732



>emb|CDX88355.1| BnaC06g37990D [Brassica napus]
Length=707

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLVLWAK I
Sbjct  525   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVLWAKPI  584

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK ++LLD SL +  + D+  RM LAATLCIRR P  RPK+ IV+KLL+G+ +T++W
Sbjct  585   LDDGKYSQLLDQSLKDNNNGDQMQRMALAATLCIRRSPQARPKMSIVLKLLKGDEDTLKW  644

Query  654   ARQNL-NSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q   NS DE + +  E+   S++QS + +ALL++EDDSLS+ S DQ +SV+DYL
Sbjct  645   AMQQASNSSDESEMLKDEECQRSNLQSHLKVALLDVEDDSLSMGSFDQGVSVEDYL  700



>gb|KHG19309.1| Proline-rich receptor-like protein kinase PERK10 [Gossypium arboreum]
Length=711

 Score =   209 bits (533),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +  +DVAGTFGYLAPEY +HGK+++KIDVYA G+VLLELL+G+KPIDN   KGQESL +W
Sbjct  523   MTCMDVAGTFGYLAPEYLMHGKMSDKIDVYAFGIVLLELLTGRKPIDNNCPKGQESLAVW  582

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+  +++LLD  L +  +  E +RMVLAATLCIRR P+ RP+I +++KLL+G+ E
Sbjct  583   AKPILKDCDSSQLLDPQLGSGCEFHEIERMVLAATLCIRRSPLMRPQISLILKLLQGDQE  642

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WA Q + + +EVD    E   ++I+S +NLALL+LEDDS+S +S +Q++ ++DYL
Sbjct  643   VANWAEQEVRTSEEVDVSDEELYPTNIESHLNLALLDLEDDSVSASSDEQSLEIEDYL  700



>ref|XP_006432125.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
 gb|ESR45365.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
Length=607

 Score =   208 bits (529),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF+HGK++EKIDVYA G+VLLELLSGKKPI++ N KGQESLV+W
Sbjct  419   LTCTDVAGTFGYLAPEYFMHGKVSEKIDVYAFGIVLLELLSGKKPINSENPKGQESLVMW  478

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+GK ++LLD SL   YD+D+ +RMVLAATL I R P  RP+I++V+KLL+G+ E
Sbjct  479   AKPILKDGKVSQLLDPSLDTDYDNDQIERMVLAATLSISRAPAVRPQINLVLKLLQGDEE  538

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WA++ +++ +E+D + GE   ++IQS +NLALL+L+DDS+S  S+ Q ISV+DYL
Sbjct  539   ATNWAKEQVSASEELDSIDGEASPTNIQSHLNLALLDLDDDSVSAGSTQQIISVEDYL  596



>gb|KEH35608.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=648

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVYA GVVLLELLS +KPI+N   KG ESLV+WA  
Sbjct  463   TDVAGTFGYLAPEYFMHGRVTDKIDVYAFGVVLLELLSNRKPINNERPKGHESLVMWATS  522

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             +LK+GK ++LLD SL + Y++ +  RMVLAATLCIRR P  RP+I +++KLL G+ E  +
Sbjct  523   VLKSGKISQLLDPSLGSEYNNCQIKRMVLAATLCIRRVPRLRPQIGVILKLLHGDEEVTR  582

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q + + +  D    E   ++IQS +NLALL+LEDD++SI S++Q +S++DYL
Sbjct  583   WAEQEVCAPETHDGFDEELFPTNIQSHLNLALLDLEDDAVSICSTEQCVSLEDYL  637



>ref|XP_011102142.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Sesamum indicum]
Length=764

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 140/188 (74%), Gaps = 13/188 (7%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+NEKIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK 
Sbjct  566   TDVAGTFGYLAPEYFMYGKVNEKIDVYAYGVVLLELLSGRKPICSDCPKGQESLVMWAKP  625

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL + K   LLD SL ++YDH++ +RMVLAA+LCIRR P  RP++ +VVKLL+G+ E ++
Sbjct  626   ILNSEKFVTLLDPSLGSSYDHNQVERMVLAASLCIRRAPRARPQMSLVVKLLQGDAEVVK  685

Query  657   WA------------RQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQ  517
             WA            RQ  NS D  D +  E    S++QS +NLALL +E+DSLSI+S +Q
Sbjct  686   WARLQVNASEGSNIRQEANSLDGADALDDETFSQSNLQSHLNLALLGVEEDSLSISSIEQ  745

Query  516   NISVDDYL  493
             ++S++DYL
Sbjct  746   SVSLEDYL  753



>ref|XP_009349910.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Pyrus x bretschneideri]
Length=764

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG++PI + + KG ESLV+WAK I
Sbjct  579   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRRPISSDHPKGHESLVMWAKPI  638

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L  G+ ++LLD  L N YD    +RMVLAATLCIR  P  RP++  +VKLL+G+ +  +W
Sbjct  639   LNGGQVSQLLDPHLGNNYDQGPIERMVLAATLCIRHAPRARPQMSFIVKLLQGDADVTKW  698

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +++ +E D +  E  P S++QS +NLALL++EDDSLS++S +Q +S++DYL
Sbjct  699   ARLQVHAVEESDVLENETCPHSNLQSHLNLALLDVEDDSLSMSSIEQTVSLEDYL  753



>gb|KFK42126.1| hypothetical protein AALP_AA2G214300 [Arabis alpina]
Length=738

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  552   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  611

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK ++LLD  L +  D D+  RM LAATLCIRR P  RPK+ IV+KLL+G+ +T++W
Sbjct  612   LDDGKYSQLLDPILRDNNDGDQMKRMALAATLCIRRSPQARPKMSIVLKLLKGDEDTLKW  671

Query  654   ARQNLNSGD-EVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q +NS   E + +  EQ   S++QS +N+ALL++EDDS+S+ S +Q ISV+DYL
Sbjct  672   AMQKVNSSSGEAEMLKDEQCQRSNLQSHLNVALLDVEDDSISMGSIEQGISVEDYL  727



>gb|KEH35607.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=690

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG++ +KIDVYA GVVLLELLS +KPI+N   KG ESLV+WA  
Sbjct  505   TDVAGTFGYLAPEYFMHGRVTDKIDVYAFGVVLLELLSNRKPINNERPKGHESLVMWATS  564

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             +LK+GK ++LLD SL + Y++ +  RMVLAATLCIRR P  RP+I +++KLL G+ E  +
Sbjct  565   VLKSGKISQLLDPSLGSEYNNCQIKRMVLAATLCIRRVPRLRPQIGVILKLLHGDEEVTR  624

Query  657   WARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WA Q + + +  D    E   ++IQS +NLALL+LEDD++SI S++Q +S++DYL
Sbjct  625   WAEQEVCAPETHDGFDEELFPTNIQSHLNLALLDLEDDAVSICSTEQCVSLEDYL  679



>ref|XP_009106391.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Brassica rapa]
Length=696

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLVLWAK I
Sbjct  514   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVLWAKPI  573

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK ++LLD+SL +  + D+  RM LAATLCIRR P  RPK+ IV+KLL+G+ +T++W
Sbjct  574   LDDGKYSQLLDSSLKDNNNGDQMQRMALAATLCIRRSPQARPKMSIVLKLLKGDEDTLKW  633

Query  654   ARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q ++S  +  E+  ++    S +QS + +ALL++EDDSLS+ S DQ  SV+DYL
Sbjct  634   AMQQVSSSSDESEMLKDEECQRSDLQSHLKVALLDVEDDSLSMGSFDQGFSVEDYL  689



>gb|KEH35354.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=754

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQ++LV+WA  
Sbjct  568   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISVDYPKGQQNLVMWASP  627

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             ++ +GK ++LLD SL + YDHDE +RMVLAATLCI+R P  RP++ IV KLL+G+ + I+
Sbjct  628   LINSGKVSQLLDPSLGDNYDHDEMERMVLAATLCIKRAPKARPQMSIVSKLLQGDIDAIK  687

Query  657   WARQNLNSGDEVDEVGGE-QPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +  + +  E  P S+IQS +NLALL+++DDSLS+ S +Q++S++DYL
Sbjct  688   WARLEVNALEAHEMLDDEVCPPSNIQSHLNLALLDVDDDSLSMYSVEQSVSLEDYL  743



>ref|XP_010534448.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=739

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N   KGQESLV+ AK I
Sbjct  553   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNECPKGQESLVMSAKPI  612

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK ++LLD SL ++Y+  + +RM LAATLCIRR P  RPK+ +V+KLL+G+ E + W
Sbjct  613   LDDGKYSQLLDQSLEDSYEGFQMERMALAATLCIRRSPQSRPKMSMVLKLLKGDEEVVAW  672

Query  654   ARQNL-NSGDEVDEVGGEQPA-SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             ARQ + N  D+ + +  E+   S++QS +NLALL++EDDSLS+ S +Q ISV+DYL
Sbjct  673   ARQQVENPSDDSEALKEEESQRSNLQSHLNLALLDVEDDSLSMGSIEQGISVEDYL  728



>emb|CDX87529.1| BnaA07g33440D [Brassica napus]
Length=743

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLVLWAK I
Sbjct  561   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVLWAKPI  620

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK ++LLD+SL +  + D+  RM LAATLCIRR P  RPK+ IV+KLL+G+ +T++W
Sbjct  621   LDDGKYSQLLDSSLKDNNNGDQMQRMALAATLCIRRSPQARPKMSIVLKLLKGDEDTLKW  680

Query  654   ARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q ++S  +  E+  ++    S +QS + +ALL++EDDSLS+ S DQ  SV+DYL
Sbjct  681   AMQQVSSSSDESEMLKDEECQRSDLQSHLKVALLDVEDDSLSMGSFDQGFSVEDYL  736



>gb|KDO57493.1| hypothetical protein CISIN_1g041755mg, partial [Citrus sinensis]
Length=678

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF+HGK++EKIDVYA G+VLLELLSGKKPI++ N KGQESLV+W
Sbjct  490   LTCTDVAGTFGYLAPEYFMHGKVSEKIDVYAFGIVLLELLSGKKPINSENPKGQESLVMW  549

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+GK ++LLD SL   YD+D+ +RMVLAATL I R P  RP+I++V+KLL+G+ E
Sbjct  550   AKPILKDGKVSQLLDPSLDTDYDNDQIERMVLAATLSISRAPTVRPQINLVLKLLQGDEE  609

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WA++ +++ +E+D + GE   ++IQS +NLALL+L+DDS+S  S+ Q ISV+DYL
Sbjct  610   AANWAKEQVSASEELDSIDGEASPTNIQSHLNLALLDLDDDSVSAGSTQQIISVEDYL  667



>ref|XP_009362341.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
 ref|XP_009362344.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=759

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI + + KG +SLV+WAK I
Sbjct  574   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDHPKGHKSLVMWAKPI  633

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L  G+ ++LLD  L N YD    +RMVLAATLCIR  P  RP++  +VKLL+G+ +  +W
Sbjct  634   LNGGQVSQLLDPHLGNNYDQGPIERMVLAATLCIRHAPRARPQMSFIVKLLQGDADVTKW  693

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +++ +E D +  E  P S++QS +NLALL++EDDSLS++S +Q +S++DYL
Sbjct  694   ARLQVHAVEESDVLENETCPHSNLQSHLNLALLDVEDDSLSMSSIEQTVSLEDYL  748



>ref|XP_006432126.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
 ref|XP_006465102.1| PREDICTED: proline-rich receptor-like protein kinase PERK2-like 
isoform X2 [Citrus sinensis]
 gb|ESR45366.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
Length=679

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF+HGK++EKIDVYA G+VLLELLSGKKPI++ N KGQESLV+W
Sbjct  491   LTCTDVAGTFGYLAPEYFMHGKVSEKIDVYAFGIVLLELLSGKKPINSENPKGQESLVMW  550

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+GK ++LLD SL   YD+D+ +RMVLAATL I R P  RP+I++V+KLL+G+ E
Sbjct  551   AKPILKDGKVSQLLDPSLDTDYDNDQIERMVLAATLSISRAPAVRPQINLVLKLLQGDEE  610

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WA++ +++ +E+D + GE   ++IQS +NLALL+L+DDS+S  S+ Q ISV+DYL
Sbjct  611   ATNWAKEQVSASEELDSIDGEASPTNIQSHLNLALLDLDDDSVSAGSTQQIISVEDYL  668



>ref|XP_006432127.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
 ref|XP_006465101.1| PREDICTED: proline-rich receptor-like protein kinase PERK2-like 
isoform X1 [Citrus sinensis]
 gb|ESR45367.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
Length=690

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF+HGK++EKIDVYA G+VLLELLSGKKPI++ N KGQESLV+W
Sbjct  502   LTCTDVAGTFGYLAPEYFMHGKVSEKIDVYAFGIVLLELLSGKKPINSENPKGQESLVMW  561

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+GK ++LLD SL   YD+D+ +RMVLAATL I R P  RP+I++V+KLL+G+ E
Sbjct  562   AKPILKDGKVSQLLDPSLDTDYDNDQIERMVLAATLSISRAPAVRPQINLVLKLLQGDEE  621

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WA++ +++ +E+D + GE   ++IQS +NLALL+L+DDS+S  S+ Q ISV+DYL
Sbjct  622   ATNWAKEQVSASEELDSIDGEASPTNIQSHLNLALLDLDDDSVSAGSTQQIISVEDYL  679



>ref|XP_010537354.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=765

 Score =   207 bits (528),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N + K Q SLV+WAK I
Sbjct  579   DVFGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNESPKVQTSLVMWAKPI  638

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L NGK ++LLD SL + Y+ D+ + M +AATLCIR  P  RPK+ +V+KLL+G+ + + W
Sbjct  639   LDNGKYSQLLDPSLRDNYEGDQMELMAMAATLCIRHSPQARPKMSMVLKLLKGDEDALTW  698

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             ARQ LN+  E  EV  ++    S++QS +NLALL++EDDSLS+ S +Q+ISV+DYL
Sbjct  699   ARQQLNNPSEDSEVLKDEKFRRSNLQSHLNLALLDVEDDSLSMGSIEQSISVEDYL  754



>ref|XP_008441611.1| PREDICTED: uncharacterized protein LOC103485693 [Cucumis melo]
Length=756

 Score =   207 bits (528),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 138/179 (77%), Gaps = 7/179 (4%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA+ 
Sbjct  570   TDVAGTFGYLAPEYFMYGKVNDKIDVYAYGVVLLELLSGRKPISTEYPKGQESLVMWARP  629

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK + LLD +L   Y+ DE +R+VLAA+LCIRR P  RP + +V+KLL+G+ +  +
Sbjct  630   ILIDGKVSRLLDPTLGGNYNQDEMERVVLAASLCIRRAPRARPPMSLVLKLLQGDADVTK  689

Query  657   WARQNLNS-GDEV---DEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WARQ +N+ GD     DEV    P S IQS +NLALL+++DDSLS++S + +IS++DYL
Sbjct  690   WARQQINALGDSNTLDDEVC---PRSDIQSHLNLALLDVDDDSLSLSSIEHSISLEDYL  745



>ref|XP_003522567.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X1 [Glycine max]
 ref|XP_006578953.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X2 [Glycine max]
Length=750

 Score =   207 bits (527),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WA  
Sbjct  564   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISPDYPKGQESLVMWATP  623

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL   YDH E ++MVLAATLCI+R P  RP++ ++ KLL+G+ E I+
Sbjct  624   ILNSGKVLQLLDPSLGENYDHGEMEKMVLAATLCIKRAPRARPQMSLISKLLQGDAEAIK  683

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
              AR  +N+ D  + +  E  P S++QS INLALL++EDDSLS+ S +Q ++++DYL
Sbjct  684   RARLQVNALDAPEMLDDEACPPSNLQSHINLALLDVEDDSLSMCSVEQGLTLEDYL  739



>ref|XP_009354013.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=759

 Score =   207 bits (527),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI + + KG ESLV+WAK 
Sbjct  573   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDHPKGHESLVMWAKP  632

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK ++LLD SL + YD  + +RMVLAATLCIR     RP++  +VKLL+G+ +  +
Sbjct  633   ILNSGKVSQLLDPSLGDNYDQGQIERMVLAATLCIRHASRARPQMSFIVKLLQGDADVTK  692

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             W+R  +++ +E + +  E  P S++QS +NLALL++EDDSLS++S +Q +S++DYL
Sbjct  693   WSRLQVHAMEESEVLENETCPRSNLQSHLNLALLDVEDDSLSMSSIEQTVSLEDYL  748



>ref|XP_008394166.1| PREDICTED: interleukin-1 receptor-associated kinase-like 2 [Malus 
domestica]
Length=759

 Score =   207 bits (527),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI + + KG ESLV+WAK 
Sbjct  573   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDHPKGHESLVMWAKP  632

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK ++LLD  L + YD  + +RMVLAATLCIR     RP++  +VKLL+G+ +  +
Sbjct  633   ILNSGKVSQLLDPCLGDNYDQGQIERMVLAATLCIRHASRARPQMSFIVKLLQGDADVTK  692

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             W+R  +++ +E D +  E  P S++QS +NLALL++EDDSLS++S +Q +S++DYL
Sbjct  693   WSRLQVHAMEESDVLENETCPRSNLQSHLNLALLDVEDDSLSMSSIEQTVSLEDYL  748



>ref|XP_011657416.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Cucumis sativus]
Length=756

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 138/179 (77%), Gaps = 7/179 (4%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLEL+SG+KPI     KGQESLV+WA+ 
Sbjct  570   TDVAGTFGYLAPEYFMYGKVNDKIDVYAYGVVLLELISGRKPISTKYPKGQESLVMWARP  629

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK + LLD +L   Y+ DE +R+VLAA+LCIRR P  RP + +V+KLL+G+ +  +
Sbjct  630   ILIDGKVSRLLDPTLGGNYNQDEMERVVLAASLCIRRAPRARPPMSLVLKLLQGDADVTK  689

Query  657   WARQNLNS-GDEV---DEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WARQ +N+ GD     DEV    P S IQS +NLALL+++DDSLS++S + +IS++DYL
Sbjct  690   WARQQINALGDSNTLDDEVC---PRSDIQSHLNLALLDVDDDSLSLSSIEHSISLEDYL  745



>ref|XP_010678918.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Beta vulgaris subsp. vulgaris]
Length=752

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+ +KIDVYA GVVLLELLSG+ PI+N   KG+ESLV+WAK 
Sbjct  566   TDVAGTFGYLAPEYFMYGKVTDKIDVYAFGVVLLELLSGRLPINNQLPKGEESLVMWAKP  625

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD S+ + Y+ D+ + MVLAATLCIRR P  RP + +++KLL+G P+T++
Sbjct  626   ILNGGKVSKLLDPSMGSNYNRDQIESMVLAATLCIRRAPRARPHMSLILKLLQGNPDTVK  685

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ + +D +  +  P   +QS ++LALL++EDDSLS++S +Q++S+++YL
Sbjct  686   WARLQVNALENIDRLDEDGLPRIDLQSHLSLALLDVEDDSLSMSSIEQHVSLEEYL  741



>ref|XP_010428799.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=756

 Score =   206 bits (524),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLE+LSG+KPI +   KGQESLV+WAK I
Sbjct  570   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLEILSGRKPISSGCPKGQESLVMWAKPI  629

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK  +LLD SL +  ++D+  RM LAATLCIRR P  RPK+ IV+KLL+G+  T +W
Sbjct  630   LDDGKYCQLLDPSLRDNNNNDQMQRMALAATLCIRRSPQARPKMSIVLKLLKGDEYTYEW  689

Query  654   ARQNL-NSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q + NS +E + +  EQ   S++QS +N+ALL++EDDS+S  S +Q +SV+DYL
Sbjct  690   ALQQVSNSSEESEMLKDEQCQRSNLQSHLNVALLDVEDDSISTGSIEQGVSVEDYL  745



>ref|XP_009355832.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=761

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI + + KG ESLV+WAK 
Sbjct  575   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDHPKGHESLVMWAKP  634

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK ++LLD  L + YD  + +RMVLAATLCIR     RP++  +VKLL+G+ +  +
Sbjct  635   ILNSGKVSQLLDPRLGDNYDQGQIERMVLAATLCIRHASRARPQMSFIVKLLQGDADVTK  694

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             W+R  +++ +E + +  E  P S++QS +NLALL++EDDSLS++S +Q +S++DYL
Sbjct  695   WSRLQVHAMEESEVLENETCPRSNLQSHLNLALLDVEDDSLSMSSIEQTVSLEDYL  750



>ref|XP_002516327.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46074.1| ATP binding protein, putative [Ricinus communis]
Length=674

 Score =   204 bits (519),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 142/178 (80%), Gaps = 3/178 (2%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HGK+++K+DV+A GVVLLELLSG+ PI+  N KGQESLV+WAK 
Sbjct  486   TDVAGTFGYLAPEYFLHGKVSDKVDVFAFGVVLLELLSGRMPINGENPKGQESLVMWAKP  545

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK +ELLD  +   Y+ D+ +RMVLAATLCIRR P  RP+I +V+KLL+G+ E   
Sbjct  546   ILDGGKVSELLDPHIGTNYNDDQIERMVLAATLCIRRSPRSRPQISLVLKLLQGDDEVKN  605

Query  657   WARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLED-DSLSITSSDQNISVDDYL  493
             WARQ +++ +EV++V  ++ A  ++IQS +NLA L+LED DSLS++S++Q IS++DYL
Sbjct  606   WARQQVSALEEVEDVEVDEEAIPTNIQSHLNLAFLDLEDEDSLSVSSTEQGISLEDYL  663



>gb|KJB48945.1| hypothetical protein B456_008G094600 [Gossypium raimondii]
Length=711

 Score =   204 bits (520),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +  +DVAGTFGYLAPEY +HGK+++KIDVYA G+VLLELL+G+KPIDN   KGQESL +W
Sbjct  523   MTCMDVAGTFGYLAPEYLMHGKMSDKIDVYAFGIVLLELLTGRKPIDNNRPKGQESLAVW  582

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK ILK+   ++LL+  L +  +  E +RMVLAATLCIRR P+ RP+I +++KLL G+ E
Sbjct  583   AKPILKDHDISQLLNPQLGSGCEFHEIERMVLAATLCIRRAPLMRPQISLILKLLLGDQE  642

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WA Q + + +EVD    E   ++++S +NLALL+LEDDS+S +S +Q++ ++DYL
Sbjct  643   VTNWAEQQVRTSEEVDVSDEELYPTNMESHLNLALLDLEDDSVSASSDEQSLEIEDYL  700



>ref|NP_177852.2| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
 gb|AEE35957.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=794

 Score =   205 bits (521),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  606   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  665

Query  834   LKNGKATELLDASL--LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
             L +GK ++LLD SL   N  + D+  RM LAATLCIRR P  RPK+ IV+KLL+G+ +T+
Sbjct  666   LDDGKYSQLLDPSLRDNNNNNDDQMQRMALAATLCIRRSPQARPKMSIVLKLLKGDEDTL  725

Query  660   QWARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             +WA Q +NS  E  E+  ++    S++QS +NLALL++EDDS+S+ S +Q +SV+DYL
Sbjct  726   EWAMQQVNSSSEESEMLKDEQCQRSNLQSHLNLALLDVEDDSISMGSIEQGVSVEDYL  783



>ref|XP_007137480.1| hypothetical protein PHAVU_009G130300g [Phaseolus vulgaris]
 gb|ESW09474.1| hypothetical protein PHAVU_009G130300g [Phaseolus vulgaris]
Length=753

 Score =   204 bits (520),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG++PI+    KGQESLV+WA  
Sbjct  565   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRRPINRDYPKGQESLVMWASP  624

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + YDH+E ++MVLAATLCI+R P  RP++++++KLL+G+ ET++
Sbjct  625   ILNSGKVLQLLDPSLGDNYDHEEMEKMVLAATLCIKRAPRARPQMNLILKLLQGDTETMK  684

Query  657   WARQNLNSG-DEVDEVGGEQ--PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+  D  + V  E   P++++QS IN+AL ++ DDS+S+ S +Q +++++YL
Sbjct  685   WARLEVNNALDAAETVDDEACPPSNNLQSHINVALGDVVDDSVSMCSVEQGLTLEEYL  742



>ref|XP_010269084.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nelumbo nucifera]
Length=765

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++G +N+K+DVYA GVVLLELLSG+KPI N   KGQESLVLWAK I
Sbjct  580   DVAGTFGYLAPEYFMYGNVNDKVDVYAFGVVLLELLSGRKPISNDCPKGQESLVLWAKPI  639

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L  GK  +LLD  L+ +Y+HD+ + MVLAATLCIRR P  RP++ +V+KLL+G+ E  +W
Sbjct  640   LNGGKTIQLLDPCLIGSYNHDQMEWMVLAATLCIRRSPRSRPRMSLVLKLLQGDAEVTKW  699

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+  E D +  E  P  +IQS +N+ALL++EDDSLS++S +Q++S++DYL
Sbjct  700   ARMQVNASGEFDALDDEAIPPPNIQSHLNVALLDVEDDSLSVSSIEQSVSLEDYL  754



>gb|KEH40498.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=701

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELL+ +KPI     KGQESLV+WA  I
Sbjct  516   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLTRRKPISGDYPKGQESLVMWASPI  575

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK ++LLD SL + YDH+E +RMVLAATLCIRR P  RP + ++ K+L+G+   I+W
Sbjct  576   LNSGKLSQLLDPSLGDNYDHEEMERMVLAATLCIRRAPGARPHMSLISKVLKGDAVVIKW  635

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+  +N+    + +  E  P S IQS +NLALL+++DD+LS+ S +QN+S++DYL
Sbjct  636   AKLEINALKASELLDEEACPPSDIQSHLNLALLDVDDDTLSMFSVEQNVSLEDYL  690



>ref|XP_010270301.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nelumbo nucifera]
Length=775

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK 
Sbjct  589   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDCPKGQESLVMWAKP  648

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK T+LLD  L + YD D+ ++MVLAATLCIRR P  RP++ +V+KLL+G+ E  +
Sbjct  649   ILNGGKTTQLLDPCLGDIYDPDQMEKMVLAATLCIRRSPQSRPRMSLVLKLLQGDAEISK  708

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +++ ++ D +  E  P  +IQS +N+ALL++EDDSLSI+SS+Q++ ++DYL
Sbjct  709   WARMQVDASEQFDTLDDEAVPPPNIQSHLNVALLDVEDDSLSISSSEQSVPLEDYL  764



>ref|XP_009795415.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana sylvestris]
Length=774

 Score =   202 bits (515),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 135/188 (72%), Gaps = 13/188 (7%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  576   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNNCPKGQESLVIWAKP  635

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK T+LLD  L + YD ++ + MVLAA LCIRR P  RP++ IV KLL+G+ ET +
Sbjct  636   ILTCGKYTQLLDPQLSSDYDREQVESMVLAAALCIRRAPRARPQMSIVSKLLKGDTETTK  695

Query  657   WARQNLNSGD------EVDEVGGEQ-------PASSIQSFINLALLNLEDDSLSITSSDQ  517
             WAR  +N  +       ++ + G           S+++S +NLALL +E+DSLS++S + 
Sbjct  696   WARLQVNGSEGSDTRLPINAIEGADMLEDDTFSQSNLRSHLNLALLGVEEDSLSLSSIEH  755

Query  516   NISVDDYL  493
             N+S++DYL
Sbjct  756   NVSLEDYL  763



>ref|XP_008805891.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinase 12-like 
[Phoenix dactylifera]
Length=812

 Score =   202 bits (515),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 138/183 (75%), Gaps = 9/183 (5%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI     KGQESLV+WAK I
Sbjct  619   DVAGTFGYLAPEYFMYGKVNKKIDVYAFGVVLLELLSGRKPISTGCPKGQESLVMWAKPI  678

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G+  +L+D  L N YD D+ +R+ LAA+LCIRR    RP+I +V+KLL+G+ + ++W
Sbjct  679   LQVGEVKQLVDPCLGNEYDSDQMERVTLAASLCIRRAHQSRPQIALVLKLLQGDDDVVKW  738

Query  654   ARQNLNSGDEVDEVGGE--QPASSIQSFINLALLNLEDDSLSITSSDQ-------NISVD  502
             AR  +++ + +DE+  E   P S IQS +NLALL+++DDSLSI+S++        N S++
Sbjct  739   ARSKVSTSEGLDELDDELIHPKSIIQSHLNLALLDVDDDSLSISSTEHTVDFITANTSME  798

Query  501   DYL  493
             DYL
Sbjct  799   DYL  801



>ref|XP_002302218.2| kinase family protein [Populus trichocarpa]
 gb|EEE81491.2| kinase family protein [Populus trichocarpa]
Length=749

 Score =   202 bits (513),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSGKKPI N   KGQESLV+WAK 
Sbjct  566   TDVAGTFGYLAPEYFMYGKVNKKIDVYAFGVVLLELLSGKKPISNDLPKGQESLVMWAKP  625

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD+SL ++YD D+ +RMVLAA LC++R P  RP++ +VVKLL+G+ E  +
Sbjct  626   ILNGGKVSQLLDSSLGDSYDLDQMERMVLAANLCVKRAPRARPQMSLVVKLLQGDAEATK  685

Query  657   WARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             WAR  +N+ +E D +  E  P S++ S +NLALL++EDD LS++S + +IS++DYL
Sbjct  686   WARLQVNAAEESDVLDDEACPRSNLLSHLNLALLDVEDDLLSLSSIEHSISLEDYL  741



>ref|XP_010471913.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=753

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG++PI +   KGQESLV+WAK I
Sbjct  567   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGREPISSGCPKGQESLVMWAKPI  626

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + K ++LLD SL +  D+D+   M LAATLCIRR P  RPK+ IV+KLL+G+ +T +W
Sbjct  627   LDDRKYSQLLDPSLRDNNDNDQMQMMALAATLCIRRSPQARPKMSIVLKLLKGDEDTHEW  686

Query  654   ARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q +++  E  E+  ++    S++QS +N+ALL++EDDS+S+ S +Q +SV+DYL
Sbjct  687   ALQQVSNSSEESEMLKDKQCQRSNLQSHLNVALLDVEDDSISMGSIEQGVSVEDYL  742



>ref|XP_004237363.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Solanum lycopersicum]
Length=769

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 136/188 (72%), Gaps = 13/188 (7%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLEL+SG+KPI +   KGQESLV+WAK 
Sbjct  571   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELISGRKPISSNCPKGQESLVIWAKP  630

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD  L + YD +  +RMVLAA LCIRR P  RP++ IV KLL+G+ ET +
Sbjct  631   ILTSGKYAQLLDPQLSSDYDCELVERMVLAAALCIRRAPRARPQMSIVSKLLKGDDETTK  690

Query  657   WARQNLNSGDEVDE---VGGEQPA----------SSIQSFINLALLNLEDDSLSITSSDQ  517
             WAR  +N  +  D    + G + A          S+++S +NLALL +E+DSLSI+S + 
Sbjct  691   WARLQVNGSEGSDTKLPINGMEGADMLEDDTFSHSNLRSHLNLALLGVEEDSLSISSIEH  750

Query  516   NISVDDYL  493
             N+S++DYL
Sbjct  751   NVSLEDYL  758



>ref|XP_006357335.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g60630-like [Solanum tuberosum]
Length=769

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 136/188 (72%), Gaps = 13/188 (7%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLEL+SG+KPI +   KGQESLV+WAK 
Sbjct  571   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELISGRKPISSNCPKGQESLVIWAKP  630

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD  L + YD +  +RMVLAA LCIRR P  RP++ IV KLL+G+ ET +
Sbjct  631   ILTSGKYAQLLDPQLSSDYDCELVERMVLAAALCIRRAPRARPQMSIVSKLLKGDDETTK  690

Query  657   WARQNLNSGDEVDE---VGGEQPA----------SSIQSFINLALLNLEDDSLSITSSDQ  517
             WAR  +N  +  D    + G + A          S+++S +NLALL +E+DSLSI+S + 
Sbjct  691   WARLQVNGSEGSDTKLPINGMEGADMLEDDTFSHSNLRSHLNLALLGVEEDSLSISSIEH  750

Query  516   NISVDDYL  493
             N+S++DYL
Sbjct  751   NVSLEDYL  758



>ref|XP_011016100.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Populus euphratica]
Length=758

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSGKKPI N   KGQESLV+WAK I
Sbjct  573   DVAGTFGYLAPEYFMYGKVNNKIDVYAFGVVLLELLSGKKPISNDLPKGQESLVMWAKPI  632

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L  GK ++LLD  L ++ D D+ +RMVLAATLC+RR P  RP++ +VVKLL+G+ E  +W
Sbjct  633   LNGGKVSQLLDPILGDSCDRDQMERMVLAATLCVRRAPRARPQMSLVVKLLQGDAEVTRW  692

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+ +E D +  E  P S++QS +NLALL++E+DSLS +S +Q+IS++DYL
Sbjct  693   ARLQVNAVEESDVLDDEACPRSNLQSHLNLALLDVENDSLSSSSLEQSISLEDYL  747



>ref|XP_009588636.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana tomentosiformis]
Length=772

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 134/188 (71%), Gaps = 13/188 (7%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI N   KGQESLV+WAK 
Sbjct  574   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISNNCPKGQESLVIWAKP  633

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK  +LLD  L + YD ++ +RMVLAA LCIRR P  RP++ IV KLL+G+ ET  
Sbjct  634   ILTCGKYAQLLDPQLSSDYDREQAERMVLAAALCIRRAPRARPQMSIVSKLLKGDAETTN  693

Query  657   WARQNLNSGD------EVDEVGGEQ-------PASSIQSFINLALLNLEDDSLSITSSDQ  517
             WAR  +N  +       ++ + G           S+++S +NLALL +E+DSLS++S + 
Sbjct  694   WARLQVNGLEGSDTRLPINAIEGADMLEDDTFSQSNLRSHLNLALLGVEEDSLSLSSIEH  753

Query  516   NISVDDYL  493
             N+S++DYL
Sbjct  754   NVSLEDYL  761



>ref|XP_006390104.1| hypothetical protein EUTSA_v10018181mg [Eutrema salsugineum]
 gb|ESQ27390.1| hypothetical protein EUTSA_v10018181mg [Eutrema salsugineum]
Length=750

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+K+DVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  565   DVAGTFGYLAPEYFMYGKVNDKVDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  624

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +GK +ELLD SL +  + D+  RM LAATLCIRR P  RPK+ IV+KLL+G+ +T++W
Sbjct  625   LDDGKYSELLDPSLRDN-NGDQMQRMALAATLCIRRSPQARPKMSIVLKLLKGDEDTVKW  683

Query  654   ARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q ++S  E  EV  ++    S++QS +N+ALL++EDDS+S+ S +Q +SV+DYL
Sbjct  684   AMQQVSSSSEESEVLKDEECQRSNLQSHLNVALLDVEDDSISMGSIEQGVSVEDYL  739



>ref|XP_007161426.1| hypothetical protein PHAVU_001G067700g [Phaseolus vulgaris]
 gb|ESW33420.1| hypothetical protein PHAVU_001G067700g [Phaseolus vulgaris]
Length=742

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGY+APEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WA  
Sbjct  556   TDVAGTFGYMAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSDYPKGQESLVMWANP  615

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK  +LLD SL + YD +E +RMVLAATLCIRR P  RP + ++ KLL G+ E + 
Sbjct  616   ILNSGKVLQLLDPSLGDNYDPEEMERMVLAATLCIRRAPRARPPMTLISKLLGGDSEVVN  675

Query  657   WARQNLNSGDEVDEVGGEQPA-SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
              AR  +++ +  + +  E  + S++QS +NLAL ++EDDSLSI S +QN+S++DYL
Sbjct  676   RARVEVHAMEAAEMLDDEACSPSNLQSHLNLALRDVEDDSLSICSVEQNVSLEDYL  731



>ref|XP_002306655.2| kinase family protein [Populus trichocarpa]
 gb|EEE93651.2| kinase family protein [Populus trichocarpa]
Length=707

 Score =   200 bits (508),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSGKKPI N   KGQESLV+WAK I
Sbjct  522   DVAGTFGYLAPEYFMYGKVNNKIDVYAFGVVLLELLSGKKPISNDLPKGQESLVMWAKPI  581

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L  GK ++LLD  L ++ D D+ +RMVLAATLC+RR P  RP++ +VVKLL+G+ E  +W
Sbjct  582   LNGGKVSQLLDPILGDSCDRDQMERMVLAATLCVRRAPRARPQMSLVVKLLQGDAEVTRW  641

Query  654   ARQNLNSGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             AR  +N+ +E D +  E  P S++QS +NLALL++E+DSLS +S +Q+IS+ DYL
Sbjct  642   ARLQVNAVEESDVLDDEACPRSNLQSHLNLALLDVENDSLSSSSLEQSISLQDYL  696



>ref|XP_009128214.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Brassica rapa]
Length=698

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  512   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  571

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK ++LLD SL +  ++++  RMVLAATLCIRR P  RPK+  V+KLL+G+ +T++W
Sbjct  572   LEDGKYSQLLDPSLRDNKNNNQIKRMVLAATLCIRRSPQARPKMSSVLKLLKGDEDTLKW  631

Query  654   ARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A Q ++S  E  E+  ++ +  S +QS +NLALL++EDDS+S+ S +Q +SV++Y+
Sbjct  632   AMQQVSSSSEESEMLEDEESQRSDLQSHLNLALLDVEDDSISMGSFEQGVSVEEYI  687



>ref|XP_010527069.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase II.1 [Tarenaya hassleriana]
Length=745

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 125/162 (77%), Gaps = 5/162 (3%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF+HG+++EK+DVYA GVVLLELLSG+KPID+ N   QESLVLWAK 
Sbjct  551   TDVAGTFGYLAPEYFMHGRVSEKVDVYAFGVVLLELLSGRKPIDSGNNNCQESLVLWAKP  610

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL+ GK  +LLD SL + YD ++ +R+ +AA LCIRR P  RP I I++KLL+GE E  +
Sbjct  611   ILEGGKMLQLLDPSLKSDYDVNQIERITMAAMLCIRRTPRLRPDICIILKLLKGEEEVEK  670

Query  657   WARQNLNSGDEV---DEVGGE--QPASSIQSFINLALLNLED  547
             WARQ LNS  E    DE+ GE  QP S+IQS +NLALL++++
Sbjct  671   WARQQLNSTSEETVDDEMDGEWSQPTSNIQSHLNLALLDIDN  712



>ref|XP_008783316.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
STE20-like [Phoenix dactylifera]
Length=801

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 139/187 (74%), Gaps = 9/187 (5%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DVAGTFGYLAPEYF++GK+NEK+DVYA GVVLLELLSG+KPI     KG+ESLV+W
Sbjct  604   LTANDVAGTFGYLAPEYFMYGKVNEKVDVYAFGVVLLELLSGRKPISMGCPKGEESLVMW  663

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK IL++G+  +L+D  L N YD D+ +R+ LAA+LCIRR    RP+I  V+KLL+G+ +
Sbjct  664   AKPILQDGEIKQLVDPCLENEYDGDQMERVTLAASLCIRRAHQSRPQIASVLKLLQGDDD  723

Query  666   TIQWARQNLNSGDEVDEVGGE--QPASSIQSFINLALLNLEDDSLSITSSDQ-------N  514
              ++WAR  +++ + +DE+  E     S IQS +NLALL+++DDSLSI+S++Q       N
Sbjct  724   VVKWARSQVSTSEGLDELDDELTDMKSIIQSHLNLALLDVDDDSLSISSTEQTVDSITAN  783

Query  513   ISVDDYL  493
              S++DYL
Sbjct  784   ASMEDYL  790



>emb|CDY40878.1| BnaCnng09690D [Brassica napus]
Length=705

 Score =   196 bits (499),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  517   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  576

Query  834   LKNGKATELLDASLLNAYDH--DEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
             L++GK ++LLD+SL +  ++  D+  RMVLAATLCIRR P  RPK+  V+KLL+G+ +T+
Sbjct  577   LEDGKYSQLLDSSLRDNKNNNGDQMQRMVLAATLCIRRSPQARPKMSSVLKLLKGDEDTL  636

Query  660   QWARQNL--NSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             +WA Q +  +S +       +   S +QS +NLALL++EDDS+S+ S +Q +SV++Y+
Sbjct  637   EWAMQQVSSSSEESEMLEDEQSQRSDLQSHLNLALLDVEDDSISMGSFEQGVSVEEYI  694



>ref|XP_010911250.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Elaeis 
guineensis]
 ref|XP_010911254.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Elaeis 
guineensis]
Length=736

 Score =   196 bits (499),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+NEKIDVYA GVVLLELLSG+KPI     KG ESLV+WAK I
Sbjct  544   DVAGTFGYLAPEYFMYGKVNEKIDVYAFGVVLLELLSGRKPISMGCPKGAESLVMWAKPI  603

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G   +L+D  L N YD D+ +RM L A+LCIRR    RP+I  V+KLL+G+ + ++W
Sbjct  604   LQGGDIKQLVDPCLGNEYDSDQMERMTLGASLCIRRAHQSRPQIASVLKLLQGDDDVVKW  663

Query  654   ARQNLNSGDEVDEVGGEQPASS-IQSFINLALLNLEDDSLSITSSDQ-------NISVDD  499
             AR  +++ +  DE+  E    S IQS +NLALL+++DDSLSI+S++Q       N S +D
Sbjct  664   ARSQISTSEGPDELDEELDMKSIIQSHLNLALLDVDDDSLSISSTEQTVDFITTNTSTED  723

Query  498   YL  493
             YL
Sbjct  724   YL  725



>emb|CDY08194.1| BnaA06g15320D [Brassica napus]
Length=750

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV+GTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KPI++ + K +ESLV+WAK I
Sbjct  564   DVSGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPINSESPKARESLVMWAKPI  623

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G  ++LLD SLL+  D D+ +RM LAATLCIR  P  RP + +V+ L++G+ E ++W
Sbjct  624   LEDGDYSQLLDPSLLDDNDGDQMERMALAATLCIRHNPQSRPDMGMVLNLVKGDMEILKW  683

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A++ ++SG E  ++  ++    S++QS +NLA L++EDD+ S+ S DQ ISV+DYL
Sbjct  684   AKEEISSGLEDSKLLKDEKLHRSNLQSHLNLAFLDMEDDAHSMVSMDQGISVEDYL  739



>emb|CDY38355.1| BnaA02g18480D [Brassica napus]
Length=701

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 137/178 (77%), Gaps = 4/178 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  513   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  572

Query  834   LKNGKATELLDASLLNAYDH--DEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
             L++GK ++LLD SL +  ++  D+  RMVLAATLCIRR P  RPK+  ++KLL+G+ +T+
Sbjct  573   LEDGKYSQLLDPSLRDNKNNNGDQMQRMVLAATLCIRRSPQARPKMSSILKLLKGDEDTL  632

Query  660   QWARQNL--NSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             +WA Q +  +S +       +   S +QS +NLALL++EDDS+S+ S +Q +SV++Y+
Sbjct  633   KWAMQQVSSSSEESEMLEDEQSQRSDLQSHLNLALLDVEDDSISMGSFEQGVSVEEYI  690



>ref|XP_002889134.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65393.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=793

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  605   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  664

Query  834   LKNGKATELLDASL--LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
             L +GK ++LLD +L   N  + D+  RM LAATLCIRR P  RPK+ IV+KLL+G+ ET+
Sbjct  665   LDDGKYSQLLDPTLRDNNNNNDDQMQRMALAATLCIRRSPQARPKMSIVLKLLKGDEETL  724

Query  660   QWARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             +WA Q ++S  E  E+  ++    S++QS +NLAL ++EDDS+S+ S +Q +SV+DYL
Sbjct  725   EWAMQQVSSSSEESEMLKDEECQRSNLQSHLNLALHDVEDDSISMGSIEQGVSVEDYL  782



>ref|XP_010236761.1| PREDICTED: uncharacterized protein LOC100842077 [Brachypodium 
distachyon]
Length=927

 Score =   194 bits (493),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGYLAPEYF HGK+NEKIDVYA GVVLLE++SG++PI    AKGQESLV W
Sbjct  744   LTCTDITGTFGYLAPEYFSHGKVNEKIDVYAFGVVLLEIISGRRPITTGCAKGQESLVGW  803

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A+ +L +G+  +++D  L N YD DE +RM LAA+LC R     RP+  +V+KLL+G+ E
Sbjct  804   ARPLLSSGEIKQVVDPVLGNNYDCDEMERMTLAASLCTRMSSYARPETPLVLKLLQGDDE  863

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNL-EDDSLSITSSDQNISVDDY  496
             TI WAR  L +G +V +     P S++QS +NLALL + EDD++S +S++Q  +VD Y
Sbjct  864   TIHWARSQLTAGSDVSDEEAVTPGSNMQSHLNLALLGVDEDDTISRSSTEQ--TVDTY  919



>ref|XP_010905327.1| PREDICTED: uncharacterized protein LOC105032560 [Elaeis guineensis]
Length=802

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 134/182 (74%), Gaps = 9/182 (5%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             VAGTFGYLAPEYF++GK+NEKIDVYA GV+LLELLSG+KPI     KGQESLV+WAK IL
Sbjct  610   VAGTFGYLAPEYFMYGKVNEKIDVYAFGVMLLELLSGRKPISTGYPKGQESLVMWAKPIL  669

Query  831   KNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWA  652
             + G+  +L+D  L N YD ++ +R+ LAA+LCIRR    RP+I  V+KLL+G+ + ++WA
Sbjct  670   QGGEVQQLVDPCLGNEYDSNQMERVTLAASLCIRRAHQSRPRIAPVLKLLQGDDDVVKWA  729

Query  651   RQNLNSGDEVDEVGGE--QPASSIQSFINLALLNLEDDSLSITSSDQNI-------SVDD  499
             R  L++ + +DE+  E     S IQS +NLALL+++DDSLSI+S++  +        ++D
Sbjct  730   RSQLSTFEGLDELDDELMHAKSIIQSHLNLALLDVDDDSLSISSAEHTVDFISANNPMED  789

Query  498   YL  493
             YL
Sbjct  790   YL  791



>ref|XP_010930690.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Elaeis guineensis]
Length=793

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 134/183 (73%), Gaps = 11/183 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGY+APEYF++GK+NEK DVYA GVVLLEL+SG+KP+     KGQESLV+WAK+I
Sbjct  602   DVAGTFGYVAPEYFMYGKVNEKTDVYAFGVVLLELISGRKPVCADCPKGQESLVMWAKKI  661

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GKA +L+D  L   Y  D+ +RM+LAA+LCIRR P  RP+I  V+KLL G+ + ++W
Sbjct  662   LQDGKAEQLVDPCLGTNYSDDQSERMILAASLCIRRAPQSRPRIATVLKLLGGDDDIVKW  721

Query  654   ARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSD-------QNISVD  502
             A+  +++  E D +  E P   S+IQS+INLAL  L+DDSLS+ S D        N S++
Sbjct  722   AKSEVSASIEFDGLDDEAPLRDSNIQSYINLAL--LDDDSLSVGSVDPSVDFIAANTSLE  779

Query  501   DYL  493
             +YL
Sbjct  780   EYL  782



>gb|KGN47686.1| hypothetical protein Csa_6G376270 [Cucumis sativus]
Length=722

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 131/171 (77%), Gaps = 7/171 (4%)
 Frame = -2

Query  993  YLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQILKNGKAT  814
            YLAPEYF++GK+N+KIDVYA GVVLLEL+SG+KPI     KGQESLV+WA+ IL +GK +
Sbjct  544  YLAPEYFMYGKVNDKIDVYAYGVVLLELISGRKPISTKYPKGQESLVMWARPILIDGKVS  603

Query  813  ELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWARQNLNS  634
             LLD +L   Y+ DE +R+VLAA+LCIRR P  RP + +V+KLL+G+ +  +WARQ +N+
Sbjct  604  RLLDPTLGGNYNQDEMERVVLAASLCIRRAPRARPPMSLVLKLLQGDADVTKWARQQINA  663

Query  633  -GDEV---DEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             GD     DEV    P S IQS +NLALL+++DDSLS++S + +IS++DYL
Sbjct  664  LGDSNTLDDEVC---PRSDIQSHLNLALLDVDDDSLSLSSIEHSISLEDYL  711



>gb|KFK44259.1| hypothetical protein AALP_AA1G235200 [Arabis alpina]
Length=758

 Score =   191 bits (485),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KPI + + K QESLV+WAK I
Sbjct  572   DVAGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPICSESPKAQESLVMWAKPI  631

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +   ++LLD SL +  + D+ +RM LAATLCIR  P  RPK+ +V+ LL+G+ E ++W
Sbjct  632   LDDKDYSQLLDPSLQDDNNGDQMERMALAATLCIRHNPQSRPKMGMVLNLLKGDAEMLKW  691

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+Q +++  E  ++  ++    S++QS +NLA L++EDDSLS+ S +Q +SV+DYL
Sbjct  692   AKQQVSNSLEDSKLLKDEKLRRSNLQSHLNLAFLDIEDDSLSMGSIEQGVSVEDYL  747



>ref|XP_006416287.1| hypothetical protein EUTSA_v10006893mg [Eutrema salsugineum]
 gb|ESQ34640.1| hypothetical protein EUTSA_v10006893mg [Eutrema salsugineum]
Length=754

 Score =   191 bits (485),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK++ KIDVYA GVVLLELLSG+KPI + + K QESLV+WAK I
Sbjct  568   DVAGTFGYLAPEYFMYGKMDNKIDVYAYGVVLLELLSGRKPISSESPKAQESLVMWAKPI  627

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +   + LLD SL +  + D+ +RM LAATLCIR  P  RPK+ +V+ LL+G+ E ++W
Sbjct  628   LDDRDYSRLLDPSLRDDNNGDQMERMALAATLCIRHNPQSRPKMGMVLNLLKGDAELLKW  687

Query  654   ARQNLNSGDEVDEVGGEQPAS--SIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+Q +++  E  ++  ++     S+QS +NLA L++EDDSLS+ S++Q ISV+DYL
Sbjct  688   AKQQISNCLEDSKLLNDEKLQRLSLQSHLNLAFLDMEDDSLSMGSTEQGISVEDYL  743



>ref|XP_006652004.1| PREDICTED: serine/threonine-protein kinase pakF-like [Oryza brachyantha]
Length=890

 Score =   192 bits (487),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 125/179 (70%), Gaps = 2/179 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGYLAPEYF HGK+NEKIDVYA GVV+LE++SG+KPI    AKGQESLV W
Sbjct  704   LTCTDITGTFGYLAPEYFSHGKVNEKIDVYAFGVVILEIISGRKPIRTGCAKGQESLVGW  763

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +L NG+  +L+D  L N YD DE +RM LAA+LC R     RP++  ++KLLEG+ E
Sbjct  764   AKPLLSNGEIKQLVDPFLGNDYDCDEMERMTLAASLCTRTSSHSRPEMSQILKLLEGDDE  823

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDY  496
             TI WAR  + +  +  +     P S++QS +NLALL ++DD+LS  S++Q +  S D Y
Sbjct  824   TIHWARSQVTASFDGSDEEAVAPDSNMQSHLNLALLGVDDDTLSHCSTEQTMDTSADGY  882



>gb|EMS55837.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Triticum urartu]
Length=758

 Score =   190 bits (483),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 127/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGY+APEYF HGK+N+KIDVYA GVVLLE++SG+KPI    AKGQESLV W
Sbjct  569   LTCTDITGTFGYMAPEYFSHGKVNKKIDVYAFGVVLLEIISGRKPIITGCAKGQESLVGW  628

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A+ +L +G+  +L+D++L N YD DE +RM LAA+LC R     RP++ +V+KLLEG+ E
Sbjct  629   ARPLLSSGEIKQLVDSALGNDYDCDEMERMTLAASLCTRTSSDSRPEMPLVLKLLEGDDE  688

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNL--EDDSLSITSSDQN  514
             T+QWAR  + +G +V +     P S++QS +NLALL +  E+D+LS  S+++ 
Sbjct  689   TVQWARSQMCAGSDVSDEEAMTPRSNMQSHLNLALLGVDEEEDTLSRCSTERT  741



>dbj|BAK04018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=928

 Score =   191 bits (486),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGY+APEYF HGK+N+KIDVYA GVVLLE++SG+KPI    AKGQESLV W
Sbjct  739   LTCTDITGTFGYMAPEYFSHGKVNKKIDVYAFGVVLLEIISGRKPIITGCAKGQESLVGW  798

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A+ +L +G+  +L+D++L N YD DE +RM LAA+LC R     RP+  +V+KLLEG+ E
Sbjct  799   ARPLLSSGEIKQLVDSALGNDYDCDEMERMTLAASLCTRTSSDSRPETQLVLKLLEGDDE  858

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNL--EDDSLSITSSDQN  514
             T+QWAR  + +G +V +     P S++QS +NLALL +  EDD+LS  S+++ 
Sbjct  859   TVQWARSQMCAGSDVSDEEAMTPRSNMQSHLNLALLGVDEEDDTLSQCSTERT  911



>gb|AAC34357.1| Putative protein kinase [Arabidopsis thaliana]
Length=781

 Score =   190 bits (483),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 139/207 (67%), Gaps = 33/207 (16%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW----  847
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI +   KGQESLV+W    
Sbjct  564   DVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVMWVCTT  623

Query  846   -------------------------AKQILKNGKATELLDASL--LNAYDHDEFDRMVLA  748
                                      AK IL +GK ++LLD SL   N  + D+  RM LA
Sbjct  624   ANQLSQNQAFSILLLKTSMYDVHIQAKPILDDGKYSQLLDPSLRDNNNNNDDQMQRMALA  683

Query  747   ATLCIRREPIFRPKIDIVVKLLEGEPETIQWARQNLNSGDEVDEVGGEQPA--SSIQSFI  574
             ATLCIRR P  RPK+ IV+KLL+G+ +T++WA Q +NS  E  E+  ++    S++QS +
Sbjct  684   ATLCIRRSPQARPKMSIVLKLLKGDEDTLEWAMQQVNSSSEESEMLKDEQCQRSNLQSHL  743

Query  573   NLALLNLEDDSLSITSSDQNISVDDYL  493
             NLALL++EDDS+S+ S +Q +SV+DYL
Sbjct  744   NLALLDVEDDSISMGSIEQGVSVEDYL  770



>gb|EAY92512.1| hypothetical protein OsI_14251 [Oryza sativa Indica Group]
Length=921

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 126/180 (70%), Gaps = 3/180 (2%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGYLAPEYF HGK+NEKIDVYA GVV+LE++SG++PI    +KGQESLV W
Sbjct  734   LTCTDITGTFGYLAPEYFSHGKVNEKIDVYAFGVVILEIISGRRPIRTGCSKGQESLVGW  793

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +L +G+  +L+D  L N YD DE +RM LAA+LC R     RP++  ++KLLEG+ E
Sbjct  794   AKPLLSSGEIKQLVDPFLGNDYDCDEMERMTLAASLCTRTSSHSRPEMSQMLKLLEGDDE  853

Query  666   TIQWARQNLNSG-DEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDY  496
             TI WAR  + +  D  DE     P S++QS +NLALL +EDD+LS  S++Q +  S D Y
Sbjct  854   TIHWARTQVTASFDGSDEEAVAAPDSNMQSHLNLALLGVEDDTLSHCSTEQTMDTSADGY  913



>ref|NP_001051845.1| Os03g0839900 [Oryza sativa Japonica Group]
 gb|AAT77004.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF99799.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13759.1| Os03g0839900 [Oryza sativa Japonica Group]
Length=938

 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 126/180 (70%), Gaps = 3/180 (2%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGYLAPEYF HGK+NEKIDVYA GVV+LE++SG++PI    +KGQESLV W
Sbjct  751   LTCTDITGTFGYLAPEYFSHGKVNEKIDVYAFGVVILEIISGRRPIRTGCSKGQESLVGW  810

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +L +G+  +L+D  L N YD DE +RM LAA+LC R     RP++  ++KLLEG+ E
Sbjct  811   AKPLLSSGEIKQLVDPFLGNDYDCDEMERMTLAASLCTRTSSHSRPEMSQMLKLLEGDDE  870

Query  666   TIQWARQNLNSG-DEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDY  496
             TI WAR  + +  D  DE     P S++QS +NLALL +EDD+LS  S++Q +  S D Y
Sbjct  871   TIHWARTQVTASFDGSDEEAVAAPDSNMQSHLNLALLGVEDDTLSHCSTEQTMDTSADGY  930



>gb|AAO41118.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 gb|EAZ29240.1| hypothetical protein OsJ_13303 [Oryza sativa Japonica Group]
Length=921

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 126/180 (70%), Gaps = 3/180 (2%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGYLAPEYF HGK+NEKIDVYA GVV+LE++SG++PI    +KGQESLV W
Sbjct  734   LTCTDITGTFGYLAPEYFSHGKVNEKIDVYAFGVVILEIISGRRPIRTGCSKGQESLVGW  793

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +L +G+  +L+D  L N YD DE +RM LAA+LC R     RP++  ++KLLEG+ E
Sbjct  794   AKPLLSSGEIKQLVDPFLGNDYDCDEMERMTLAASLCTRTSSHSRPEMSQMLKLLEGDDE  853

Query  666   TIQWARQNLNSG-DEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDY  496
             TI WAR  + +  D  DE     P S++QS +NLALL +EDD+LS  S++Q +  S D Y
Sbjct  854   TIHWARTQVTASFDGSDEEAVAAPDSNMQSHLNLALLGVEDDTLSHCSTEQTMDTSADGY  913



>ref|XP_009404967.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Musa acuminata subsp. malaccensis]
Length=788

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 135/183 (74%), Gaps = 11/183 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEY ++GK+NEKID+YA GVVLLELLSG+KPI +   KGQESLV+WAK I
Sbjct  597   DVAGTFGYLAPEYILYGKVNEKIDIYAFGVVLLELLSGRKPISSGCPKGQESLVMWAKPI  656

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++    +L+D +L N ++ D+ +RM+LAA+LC+RR    RP + IV+KLL+G+ +T++W
Sbjct  657   LQDEDVKQLIDPALKNDFNSDQVERMILAASLCVRRLHRARPSMSIVLKLLQGDDDTVKW  716

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNI-------SVD  502
             AR  + +    D +  E P   S I+S +NLALL++EDDS+S++S+D  +       SV+
Sbjct  717   ARSEVTT--RADVLDDEMPNLESDIRSHLNLALLDVEDDSISVSSTDHTVDSLTVSTSVE  774

Query  501   DYL  493
             +YL
Sbjct  775   NYL  777



>ref|XP_010498614.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=744

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KP+++ + K QESLV+WAK I
Sbjct  558   DIAGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQESLVMWAKTI  617

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L N + ++LLD SL +    D+ +R+ LAATLCIR  P  RP++ +V+KLL G+ E ++W
Sbjct  618   LDNKEYSQLLDPSLQDDSKGDQMERLALAATLCIRHNPQSRPEMGMVLKLLNGDAEMLKW  677

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+  +N+  E  +V  ++    S++QS +NLA L++EDDSLS+ S +Q ISV+ YL
Sbjct  678   AKLQVNNPLEDSKVLKDEKLWRSNLQSHLNLAFLDMEDDSLSMGSIEQGISVEGYL  733



>emb|CDY04652.1| BnaC05g16900D [Brassica napus]
Length=738

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV+GTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KPI++ + K ++SLV+WAK I
Sbjct  552   DVSGTFGYLAPEYFMYGKMNDKIDVYAYGVVLLELLSGRKPINSESPKARQSLVMWAKPI  611

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +   ++LLD SLL+  D D+ +RM LAATLCIR  P  RP + +V+ LL+G+ E ++W
Sbjct  612   LDDRDYSQLLDPSLLDDNDGDQMERMALAATLCIRHNPQSRPDMGMVLNLLKGDMEKLKW  671

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A++ ++ G E  ++  ++    S++QS +NLA L++EDD+ S+ S DQ ISV+DYL
Sbjct  672   AKEEVSIGLEDSKLLKDEKLHRSNLQSHLNLAFLDMEDDAHSMVSMDQGISVEDYL  727



>ref|XP_010459867.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=752

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KP+++ + K QESLV+WAK I
Sbjct  566   DIAGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQESLVMWAKTI  625

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L N + ++LLD SL +    D+ +R+ LAATLCIR  P  RP++ +V+KLL G+ E ++W
Sbjct  626   LDNKEYSQLLDPSLQDDSKGDQMERLALAATLCIRHNPQSRPEMGMVLKLLNGDAEMLKW  685

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+  +N+  E  +V  ++    S++QS +NLA L++EDDSLS+ S +Q ISV+ YL
Sbjct  686   AKLQVNNPLEDSKVLKDEKLWRSNLQSHLNLAFLDMEDDSLSMGSIEQGISVEGYL  741



>emb|CDY31344.1| BnaA02g33970D [Brassica napus]
Length=677

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF+HGK+ ++IDVYA GVVLLELLSG+KPI    +KGQESLVLWA  I
Sbjct  495   DIAGTFGYLAPEYFMHGKVTDRIDVYAFGVVLLELLSGRKPICVDQSKGQESLVLWANPI  554

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK T LLD SL     +D  ++++LAATLCI+R P  RP++ +VVK+L+G+ E  +W
Sbjct  555   LESGKFTHLLDPSLETDNSNDLIEKLLLAATLCIKRSPNDRPQMSLVVKILQGDEEATEW  614

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQN-ISVDDYL  493
              +Q + +  +  E       ++I+S INLALL+LEDD+ S +S + N ISV+DYL
Sbjct  615   GKQQVRASQDAREY-----LTNIESHINLALLDLEDDAASDSSPEANSISVEDYL  664



>ref|XP_004978901.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X2 [Setaria italica]
Length=754

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 133/183 (73%), Gaps = 10/183 (5%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N KIDVYA GVVLLEL+SG+KP+ N   KGQESLV+WA  I
Sbjct  562   DVAGTFGYLAPEYFMHGKVNSKIDVYAFGVVLLELISGRKPLCNGCPKGQESLVMWANSI  621

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L+D +L      +E +RM LAA+LCIR+ P  RP+ID V+KLLEG+ + ++W
Sbjct  622   IQGGKLTQLVDPNLPTEGHTNEVERMTLAASLCIRQAPQNRPQIDAVLKLLEGDNDILKW  681

Query  654   ARQNLNSGDEV--DEVGGEQPA----SSIQSFINLALLNLEDDSLSITSSD---QNISVD  502
             AR  +    EV  DE     PA    ++IQS+INLA  +++DDS S++S+D    N S++
Sbjct  682   ARSQVGLAYEVDGDECVMTPPAPGSNANIQSYINLA-FDVDDDSASVSSTDFIAANTSLE  740

Query  501   DYL  493
             +YL
Sbjct  741   EYL  743



>ref|XP_009149675.1| PREDICTED: receptor like protein kinase S.2-like [Brassica rapa]
Length=747

 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV+GTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KPI++ + K +ESLV+WAK I
Sbjct  561   DVSGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPINSESPKARESLVMWAKPI  620

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +   ++LLD  LL+  + D+ +RM LAATLCIR  P  RP + +V+ L++G+ E ++W
Sbjct  621   LDDRDYSQLLDPCLLDDNNGDQMERMALAATLCIRHNPQSRPDMGMVLNLVKGDMEILKW  680

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A++ ++SG E  ++  ++    S++QS +NLA L++EDD+ S+ S DQ ISV+DYL
Sbjct  681   AKEEISSGLEDSKLLKDEKLHRSNLQSHLNLAFLDMEDDAHSMVSMDQGISVEDYL  736



>gb|KJB48947.1| hypothetical protein B456_008G094600 [Gossypium raimondii]
Length=699

 Score =   188 bits (477),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 127/178 (71%), Gaps = 12/178 (7%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +  +DVAGTFGYLAPEY +HGK+++KIDVYA G+VLLELL+G+KPIDN   KGQESL +W
Sbjct  523   MTCMDVAGTFGYLAPEYLMHGKMSDKIDVYAFGIVLLELLTGRKPIDNNRPKGQESLAVW  582

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
                         LL+  L +  +  E +RMVLAATLCIRR P+ RP+I +++KLL G+ E
Sbjct  583   ------------LLNPQLGSGCEFHEIERMVLAATLCIRRAPLMRPQISLILKLLLGDQE  630

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
                WA Q + + +EVD    E   ++++S +NLALL+LEDDS+S +S +Q++ ++DYL
Sbjct  631   VTNWAEQQVRTSEEVDVSDEELYPTNMESHLNLALLDLEDDSVSASSDEQSLEIEDYL  688



>ref|XP_010461185.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X2 [Camelina sativa]
Length=715

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 134/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLW
Sbjct  529   VSGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLW  588

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  IL++GK  +LLD SL N   +D  ++++LAATLCI+R P  RP+I +V+K+L+G+ E
Sbjct  589   ANPILESGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPYDRPQIGLVLKILQGDEE  648

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
               +W +Q + + +E +        ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  649   ATEWGKQQVRTSEEENAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  702



>ref|XP_010461193.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X3 [Camelina sativa]
Length=714

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 134/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLW
Sbjct  528   VSGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLW  587

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  IL++GK  +LLD SL N   +D  ++++LAATLCI+R P  RP+I +V+K+L+G+ E
Sbjct  588   ANPILESGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPYDRPQIGLVLKILQGDEE  647

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
               +W +Q + + +E +        ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  648   ATEWGKQQVRTSEEENAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  701



>ref|XP_010461177.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Camelina sativa]
Length=715

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 134/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLW
Sbjct  529   VSGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLW  588

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  IL++GK  +LLD SL N   +D  ++++LAATLCI+R P  RP+I +V+K+L+G+ E
Sbjct  589   ANPILESGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPYDRPQIGLVLKILQGDEE  648

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
               +W +Q + + +E +        ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  649   ATEWGKQQVRTSEEENAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  702



>emb|CDP11935.1| unnamed protein product [Coffea canephora]
Length=776

 Score =   187 bits (476),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 131/188 (70%), Gaps = 16/188 (9%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLEL+SG+KPI N + KGQESLV+WAK 
Sbjct  581   TDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELISGRKPISNDSPKGQESLVMWAKP  640

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL +GK ++LLD +L + YD +E +RM LAA LCIRR    RP++ +++KLL+G+ E   
Sbjct  641   ILNSGKFSQLLDPNLSSNYDGEELERMALAAALCIRRAARARPQMSLILKLLQGDIEVTN  700

Query  657   WAR------QNLNSGDEVDEVGGEQP-------ASSIQSFINLALLNLEDDSLSITSSDQ  517
             WAR      +  N+   VD + G           S++QS +NLA   +ED   S++S +Q
Sbjct  701   WARLQVNGLEGTNTAKLVDSLEGSDALDDETFSHSNLQSHLNLAFHGVED---SLSSIEQ  757

Query  516   NISVDDYL  493
              IS++DYL
Sbjct  758   TISLEDYL  765



>ref|XP_002893177.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69436.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=757

 Score =   187 bits (475),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KPI++ + K Q+SLV+WAK I
Sbjct  571   DVAGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPINSESPKAQDSLVMWAKPI  630

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + + ++LLD+SL +  + D+ +RM LAATLCIR  P  RP + +V+KLL+G+ E ++W
Sbjct  631   LDDKEYSQLLDSSLEDDNNGDQMERMALAATLCIRHNPQSRPTMGMVLKLLKGDVEILKW  690

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+  +++  E  ++  ++    S++QS +NLA L++EDDSLS+ S +Q ISV++YL
Sbjct  691   AKLQVSNHLEDSKLLKDEKLRRSNLQSHLNLAFLDMEDDSLSMGSMEQGISVEEYL  746



>ref|NP_201199.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
 dbj|BAA96897.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13057.1| unknown protein [Arabidopsis thaliana]
 gb|AAP68229.1| At5g63940 [Arabidopsis thaliana]
 gb|AED97818.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
Length=705

 Score =   187 bits (475),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 132/177 (75%), Gaps = 6/177 (3%)
 Frame = -2

Query  1020  GVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAK  841
             G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLEL+SG+KPI    +KGQESLVLWA 
Sbjct  521   GGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVLWAN  580

Query  840   QILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
              IL +GK  +LLD SL N   +D  ++++LAATLCI+R P  RP+I +V+K+L+GE E  
Sbjct  581   PILDSGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPHDRPQIGLVLKILQGEEEAT  640

Query  660   QWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
             +W +Q + + ++V         ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  641   EWGKQQVRASEDVSAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  692



>ref|XP_008781626.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Phoenix dactylifera]
Length=804

 Score =   187 bits (475),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 132/183 (72%), Gaps = 11/183 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+NEK DVYA GVVLLEL+SG+KP+     KGQESLV+WAK+I
Sbjct  613   DVAGTFGYLAPEYFMYGKVNEKTDVYAFGVVLLELISGRKPVCTGCPKGQESLVIWAKKI  672

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK  +L+D  L   Y  D+ +RM+LAA+LCIRR P  RP+I  V+KLL G+ + ++ 
Sbjct  673   LQDGKVKQLVDPCLGTNYSDDQLERMILAASLCIRRAPRCRPRIATVLKLLGGDDDILKR  732

Query  654   ARQNLNSGDEVDEVGGEQPA--SSIQSFINLALLNLEDDSLSITSSD-------QNISVD  502
             A+  +++  E D +  E     S+IQS+INLAL  L+DDSLS++S D        N S++
Sbjct  733   AKSQVSASKEFDGLDDEASLQDSNIQSYINLAL--LDDDSLSVSSVDPAVDFIAANTSLE  790

Query  501   DYL  493
             +YL
Sbjct  791   EYL  793



>ref|XP_010444316.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11 isoform X2 [Camelina sativa]
 ref|XP_010444317.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11 isoform X3 [Camelina sativa]
Length=713

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLW
Sbjct  527   VSGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLW  586

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  IL++GK  +LLD SL N   +D  ++++LAATLCI+R    RP+I +V+K+L+G+ E
Sbjct  587   ANPILESGKFAQLLDPSLENENSNDLIEKLLLAATLCIKRTAYDRPQIGLVLKILQGDEE  646

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
               QW +Q + + +E +        ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  647   ATQWGKQQVRTSEEENAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  700



>ref|XP_006829313.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Amborella trichopoda]
 gb|ERM96729.1| hypothetical protein AMTR_s00202p00019370 [Amborella trichopoda]
Length=753

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 134/182 (74%), Gaps = 8/182 (4%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVY+ GVVLLELLSG+KPI N   KG+ESLV+WA  +
Sbjct  561   DVAGTFGYLAPEYFMYGKVNDKIDVYSFGVVLLELLSGRKPISNDLPKGKESLVMWATPL  620

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ GK  EL+D +L + YD D+  R++LAA+LCIRR    RP + +++KLL+G+ + ++W
Sbjct  621   LEKGKVLELVDPTLGDDYDRDQMHRVMLAASLCIRRAARSRPHMSLILKLLKGDDDVVKW  680

Query  654   ARQNLNSGDEVDEVGGEQPASS-IQSFINLALLNLEDDSLSITSSDQNI-------SVDD  499
             AR  L++ +E+D V  E   S  IQS +NLAL +++ D  S++S DQ++       S++D
Sbjct  681   ARLQLSASEELDGVDEETFCSPDIQSHVNLALHDVDFDMQSVSSVDQSVDNITSYKSLED  740

Query  498   YL  493
             YL
Sbjct  741   YL  742



>ref|XP_010444315.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11 isoform X1 [Camelina sativa]
Length=713

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLW
Sbjct  527   VSGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLW  586

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  IL++GK  +LLD SL N   +D  ++++LAATLCI+R    RP+I +V+K+L+G+ E
Sbjct  587   ANPILESGKFAQLLDPSLENENSNDLIEKLLLAATLCIKRTAYDRPQIGLVLKILQGDEE  646

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
               QW +Q + + +E +        ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  647   ATQWGKQQVRTSEEENAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  700



>ref|XP_010055963.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X2 [Eucalyptus grandis]
Length=765

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+K+DVYA GVVLLELLSG+KPI N   KG+ESLV+WA+ 
Sbjct  580   TDVAGTFGYLAPEYFMYGKVNDKVDVYAFGVVLLELLSGRKPISNDFPKGRESLVMWARP  639

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK +ELLD +L   YDH + +RMVLAATLC+RR P  RP++  VVKLL G+ + ++
Sbjct  640   ILHGGKISELLDPTLGENYDHQQLERMVLAATLCVRRAPRARPQMSHVVKLLHGDVDVVK  699

Query  657   WARQNLNSGDEVDEVGGEQPA-SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
              A+  + S D+ D    E  A  +IQS +NLAL ++EDDS S++  D N+S++DYL
Sbjct  700   SAQLQV-SCDQSDAADDEACAYPNIQSHLNLALHDVEDDSSSVSIIDSNVSLEDYL  754



>gb|EMS48655.1| Proline-rich receptor-like protein kinase PERK13 [Triticum urartu]
Length=672

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 134/185 (72%), Gaps = 12/185 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDV+A GVVLLEL+SG+KP+     KGQESLV+WA  I
Sbjct  478   DVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCPKGQESLVMWANSI  537

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L D SL     +DE +RM LAA+LCIR  P  RP I +V+KLL+G+ + ++W
Sbjct  538   IQGGKLTQLADPSLPTEGHNDEIERMTLAASLCIRPTPQHRPHITVVLKLLDGDNDILKW  597

Query  654   ARQNL-----NSGDEVDEVGGEQP---ASSIQSFINLALLNLEDDSLSITSSD---QNIS  508
             AR ++     + GDE D V    P   +++IQS+INLA  +++DDS S++S+D    N S
Sbjct  598   ARSHVGLSYDSDGDEDDVVTLAPPPENSTNIQSYINLA-FDVDDDSASVSSNDFITANTS  656

Query  507   VDDYL  493
             +++YL
Sbjct  657   LEEYL  661



>ref|XP_010055962.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Eucalyptus grandis]
 gb|KCW72535.1| hypothetical protein EUGRSUZ_E01004 [Eucalyptus grandis]
Length=767

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+K+DVYA GVVLLELLSG+KPI N   KG+ESLV+WA+ 
Sbjct  582   TDVAGTFGYLAPEYFMYGKVNDKVDVYAFGVVLLELLSGRKPISNDFPKGRESLVMWARP  641

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK +ELLD +L   YDH + +RMVLAATLC+RR P  RP++  VVKLL G+ + ++
Sbjct  642   ILHGGKISELLDPTLGENYDHQQLERMVLAATLCVRRAPRARPQMSHVVKLLHGDVDVVK  701

Query  657   WARQNLNSGDEVDEVGGEQPA-SSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
              A+  + S D+ D    E  A  +IQS +NLAL ++EDDS S++  D N+S++DYL
Sbjct  702   SAQLQV-SCDQSDAADDEACAYPNIQSHLNLALHDVEDDSSSVSIIDSNVSLEDYL  756



>ref|XP_009110180.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Brassica 
rapa]
Length=710

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 137/177 (77%), Gaps = 3/177 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KP+++ + K +ESLV+WAK I
Sbjct  523   DVAGTFGYLAPEYFMYGKMNDKIDVYAYGVVLLELLSGRKPVNSESPKARESLVMWAKPI  582

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +   ++LLD SL+N  + D+ +RM LAATLCIR  P  RP++ +V+ LL+G+ E ++W
Sbjct  583   LDDRDYSQLLDQSLVNHNNGDQMERMALAATLCIRHNPQSRPEMGMVLNLLKGDVEMLKW  642

Query  654   ARQNLNSGDEVDEVGGEQ--PASSIQSFINLALLNLED-DSLSITSSDQNISVDDYL  493
             A++ ++SG E  ++  ++    S++QS +N+A L++ED +S+S+ S  Q ISV+DYL
Sbjct  643   AKEQVSSGLEDSKLLKDEKLKRSNLQSHLNVAFLDMEDEESISMRSMVQGISVEDYL  699



>ref|XP_009130426.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X2 [Brassica rapa]
Length=686

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 131/175 (75%), Gaps = 6/175 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI     KGQESLVLWA  I
Sbjct  504   DIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICVDQTKGQESLVLWANPI  563

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK ++LLD SL    +++  ++++LAATLCI+R P  RP++ +VVK+L+G+ E  +W
Sbjct  564   LESGKFSQLLDPSLETDNNNELIEKLLLAATLCIKRSPNDRPQMSLVVKILQGDEEATEW  623

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQN-ISVDDYL  493
              +Q + + ++          ++I+S INLALL+LEDD+ S +S + N ISV+DYL
Sbjct  624   GKQQVRASEDATAY-----LTNIESHINLALLDLEDDAASDSSPEANSISVEDYL  673



>ref|XP_009130425.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Brassica rapa]
Length=691

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 131/175 (75%), Gaps = 6/175 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI     KGQESLVLWA  I
Sbjct  509   DIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICVDQTKGQESLVLWANPI  568

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK ++LLD SL    +++  ++++LAATLCI+R P  RP++ +VVK+L+G+ E  +W
Sbjct  569   LESGKFSQLLDPSLETDNNNELIEKLLLAATLCIKRSPNDRPQMSLVVKILQGDEEATEW  628

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQN-ISVDDYL  493
              +Q + + ++          ++I+S INLALL+LEDD+ S +S + N ISV+DYL
Sbjct  629   GKQQVRASEDATAY-----LTNIESHINLALLDLEDDAASDSSPEANSISVEDYL  678



>ref|XP_010484157.1| PREDICTED: probable receptor-like protein kinase At3g17420 [Camelina 
sativa]
Length=712

 Score =   185 bits (469),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLW
Sbjct  526   VSGGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLW  585

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  IL++GK  +LLD SL N   +D  ++++LAATLCI+R P  RP+I +V+K+L+G+ E
Sbjct  586   ANPILESGKFAQLLDPSLENDNSNDLIEKLLLAATLCIKRTPYDRPQIGLVLKILQGDEE  645

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
               +W +Q + + +E +        ++I+S  NLALL+LEDD+ S +S +  +ISV++YL
Sbjct  646   ATEWGKQQVRTSEEENAY-----LTNIESHRNLALLDLEDDAASDSSPEASSISVEEYL  699



>ref|XP_009410684.1| PREDICTED: serine/threonine-protein kinase PAK 6 [Musa acuminata 
subsp. malaccensis]
Length=753

 Score =   184 bits (468),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 125/169 (74%), Gaps = 4/169 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEY ++GK+NEK+DVYA GVVLLELLSG+KPI +   KGQESL++WAK I
Sbjct  562   DVAGTFGYLAPEYILYGKVNEKVDVYAFGVVLLELLSGRKPISSGCPKGQESLLMWAKPI  621

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G   +L+D  L N +  D+ +RM+LAA+LC RR    RP I +V+KLL+G+ +T++W
Sbjct  622   LQDGDTKQLIDPGLKNEFSSDQVERMILAASLCARRLHHARPHIALVLKLLQGDDDTVEW  681

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQN  514
             AR  +N+    D +  E P   S IQS +NLALL+++DD  SI+S+D  
Sbjct  682   ARSEVNA--RADMLDDEMPNQESDIQSHLNLALLDVKDDLNSISSTDHT  728



>emb|CDY39836.1| BnaC02g42820D [Brassica napus]
Length=679

 Score =   184 bits (467),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 132/175 (75%), Gaps = 6/175 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLWA  I
Sbjct  497   DIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICVDQSKGQESLVLWANPI  556

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK  +LLD SL    +++  ++++LAATLCI+R P  RP++ +VVK+L+G+ +  +W
Sbjct  557   LESGKFAQLLDPSLETDNNNELIEKLLLAATLCIKRAPHDRPQMSLVVKILQGDEDATEW  616

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
              +Q + + ++  E       ++I+S INLALL+LEDD+ S +S +  +ISV+DYL
Sbjct  617   GKQQVRASEDAREY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEDYL  666



>ref|XP_002864878.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41137.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=708

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 132/177 (75%), Gaps = 6/177 (3%)
 Frame = -2

Query  1020  GVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAK  841
             G D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLWA 
Sbjct  524   GGDIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLWAN  583

Query  840   QILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
              IL++GK  +LLD SL N   +D  ++++LAATLCI+R P  RP+I +V+K+L+G+ E  
Sbjct  584   PILESGKFAQLLDPSLENDNSNDLVEKLLLAATLCIKRTPHERPQIGLVLKILQGDEEAT  643

Query  660   QWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
             +W +Q + + ++          ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  644   EWGKQQVRASEDESAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  695



>emb|CDY38812.1| BnaC08g19860D [Brassica napus]
Length=704

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 136/177 (77%), Gaps = 3/177 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSG+KP+ + + K +ESLV+WAK I
Sbjct  517   DVAGTFGYLAPEYFMYGKMNDKIDVYAYGVVLLELLSGRKPVSSESPKARESLVMWAKPI  576

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +   ++LLD SL+N  + D+ +RM LAATLCIR  P  RP++ +V+ LL+G+ E ++W
Sbjct  577   LDDRDHSQLLDQSLVNHNNSDQMERMALAATLCIRHNPQSRPEMGMVLNLLKGDVEMLKW  636

Query  654   ARQNLNSGDEVDEVGGEQ--PASSIQSFINLALLNLED-DSLSITSSDQNISVDDYL  493
             A++ +++G E  ++  ++    S++QS +N+A L++ED +S+S+ S  Q ISV+DYL
Sbjct  637   AKEQVSNGLEDSKLLKDEKLKRSNLQSHLNVAFLDMEDEESISMRSMVQGISVEDYL  693



>dbj|BAJ97602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 134/185 (72%), Gaps = 12/185 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDV+A GVVLLEL+SG+KP+     KGQESLV+WA  I
Sbjct  539   DVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCPKGQESLVMWANSI  598

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L D SL      DE +RM LAA+LCIR  P  RP I +V+KLL+G+ +T++W
Sbjct  599   IQGGKLTQLADPSLPTEGHTDEIERMTLAASLCIRPTPQHRPHIAVVLKLLDGDNDTLKW  658

Query  654   ARQNLN----SGDEVDEVGGEQP----ASSIQSFINLALLNLEDDSLSITSSD---QNIS  508
             AR ++     S  +VD+V    P    +++IQS+INLA  ++++DS S++S+D    N S
Sbjct  659   ARSHVGLSYESDGDVDDVVTLAPPPENSTNIQSYINLA-FDVDNDSASVSSNDFITANTS  717

Query  507   VDDYL  493
             +++YL
Sbjct  718   LEEYL  722



>gb|AFW65488.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW65489.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=524

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 11/184 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+  KIDVYA GVVLLEL+SG+KP+     KGQESLV+WA  I
Sbjct  331   DVAGTFGYLAPEYFMHGKVGNKIDVYAFGVVLLELISGRKPLCTGCPKGQESLVMWANSI  390

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK  +L+D +L      DE +RM LAA+LCIR+ P  RP+ID V+KLL G+ +T++W
Sbjct  391   IQGGKLRQLVDPNLPTEGHVDEVERMTLAASLCIRQTPQNRPEIDAVLKLLHGDNDTLKW  450

Query  654   ARQNLN---SGDEVDEVGGEQPA----SSIQSFINLALLNLEDDSLSITSSD---QNISV  505
             AR  +       ++DE     PA    ++IQS+INLA  +++DDS S++S+D    N S+
Sbjct  451   ARSQVGLSCESSDIDEFVMTPPAPRSNTNIQSYINLA-FDVDDDSASVSSNDFIAANTSL  509

Query  504   DDYL  493
             ++YL
Sbjct  510   EEYL  513



>gb|AAF87904.1|AC015447_14 Similar to protein kinases [Arabidopsis thaliana]
Length=705

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KP+++ + K Q+SLV+WAK I
Sbjct  519   DVAGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQDSLVMWAKPI  578

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + + ++LLD+SL +  + D+ ++M LAATLCIR  P  RP + +V++LL+G+ E ++W
Sbjct  579   LDDKEYSQLLDSSLQDDNNSDQMEKMALAATLCIRHNPQTRPTMGMVLELLKGDVEMLKW  638

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+  +++  E   +  ++    S++QS +NLA L++EDDSLS+ S +Q ISV++YL
Sbjct  639   AKLQVSNPLEDSMLLKDEKLRRSNLQSHLNLAFLDMEDDSLSMGSMEQGISVEEYL  694



>ref|XP_006303211.1| hypothetical protein CARUB_v10011454mg [Capsella rubella]
 gb|EOA36109.1| hypothetical protein CARUB_v10011454mg [Capsella rubella]
Length=752

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KP+++ + K QESL++WAK I
Sbjct  566   DIAGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQESLIMWAKPI  625

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L   +   LLD SL      +  +RM LAATLCIR  P  RP++ +VVKLL G+ E ++W
Sbjct  626   LDEKEYYRLLDPSLQEDSKGNHMERMALAATLCIRHNPQSRPEMGMVVKLLNGDAEMLKW  685

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+  +++  E  +V  ++    S++QS +NLA L++EDDSLS+ S +Q ISV++YL
Sbjct  686   AKLQVSNPLEDSKVLKDEKLWRSNLQSHLNLAFLDMEDDSLSLGSIEQGISVENYL  741



>ref|NP_173578.2| putative protein kinase [Arabidopsis thaliana]
 gb|AAL57632.1| At1g21590/F24J8_9 [Arabidopsis thaliana]
 gb|AAM98263.1| At1g21590/F24J8_9 [Arabidopsis thaliana]
 gb|AEE30121.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=756

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF++GK+N KIDVYA GVVLLELLSG+KP+++ + K Q+SLV+WAK I
Sbjct  570   DVAGTFGYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQDSLVMWAKPI  629

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + + ++LLD+SL +  + D+ ++M LAATLCIR  P  RP + +V++LL+G+ E ++W
Sbjct  630   LDDKEYSQLLDSSLQDDNNSDQMEKMALAATLCIRHNPQTRPTMGMVLELLKGDVEMLKW  689

Query  654   ARQNLNSGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             A+  +++  E   +  ++    S++QS +NLA L++EDDSLS+ S +Q ISV++YL
Sbjct  690   AKLQVSNPLEDSMLLKDEKLRRSNLQSHLNLAFLDMEDDSLSMGSMEQGISVEEYL  745



>ref|XP_011027696.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Populus euphratica]
Length=704

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+KIDVYA GVVLLELLSGKKPI N   KGQESLV+WAK 
Sbjct  566   TDVAGTFGYLAPEYFMYGKVNKKIDVYAFGVVLLELLSGKKPISNDLPKGQESLVMWAKP  625

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             IL  GK ++LLD+SL ++YD D+ +RMVLAATLC++R P  RP++ +VVKLL+G+ E  +
Sbjct  626   ILNGGKVSQLLDSSLGDSYDLDQIERMVLAATLCVKRAPRARPQMSLVVKLLQGDVEATK  685

Query  657   WARQNLNSG  631
             WAR  +N+ 
Sbjct  686   WARLQVNAA  694



>ref|XP_008679652.1| PREDICTED: probable receptor-like protein kinase At1g49730 [Zea 
mays]
 gb|AFW65490.1| putative protein kinase superfamily protein [Zea mays]
Length=739

 Score =   182 bits (461),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 11/184 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+  KIDVYA GVVLLEL+SG+KP+     KGQESLV+WA  I
Sbjct  546   DVAGTFGYLAPEYFMHGKVGNKIDVYAFGVVLLELISGRKPLCTGCPKGQESLVMWANSI  605

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK  +L+D +L      DE +RM LAA+LCIR+ P  RP+ID V+KLL G+ +T++W
Sbjct  606   IQGGKLRQLVDPNLPTEGHVDEVERMTLAASLCIRQTPQNRPEIDAVLKLLHGDNDTLKW  665

Query  654   ARQNLN---SGDEVDEVGGEQPA----SSIQSFINLALLNLEDDSLSITSSD---QNISV  505
             AR  +       ++DE     PA    ++IQS+INLA  +++DDS S++S+D    N S+
Sbjct  666   ARSQVGLSCESSDIDEFVMTPPAPRSNTNIQSYINLA-FDVDDDSASVSSNDFIAANTSL  724

Query  504   DDYL  493
             ++YL
Sbjct  725   EEYL  728



>gb|EMT07237.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1398

 Score =   185 bits (469),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 91/172 (53%), Positives = 126/172 (73%), Gaps = 2/172 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGY+APEYF HGK+N+KIDVYA GVVLLE++SG+KPI    AKGQESLV W
Sbjct  710   LTCTDITGTFGYMAPEYFSHGKVNKKIDVYAFGVVLLEIISGRKPIITGCAKGQESLVGW  769

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A+ +L +G+  +L+D++L N YD DE +RM LAA+LC R     RP+  +V+KLLEG+ E
Sbjct  770   ARPLLSSGEIKQLVDSALGNDYDCDEMERMTLAASLCTRTSSDSRPETPLVLKLLEGDDE  829

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNL--EDDSLSITSSDQ  517
             T+QWAR  + +G +V +     P S++QS +NLALL +  E+D+LS  S+++
Sbjct  830   TVQWARSQMCAGSDVSDEEAMTPRSNMQSHLNLALLGVDEEEDTLSRCSTER  881



>ref|XP_010237868.1| PREDICTED: putative L-type lectin-domain containing receptor 
kinase V.2 isoform X2 [Brachypodium distachyon]
Length=742

 Score =   181 bits (460),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDV+A GVVLLEL+SG+KP+     KGQESLV+WA  I
Sbjct  550   DVAGTFGYLAPEYFMHGKVNDKIDVFAYGVVLLELISGRKPLCTGCPKGQESLVMWANSI  609

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK  EL+D S       DE +RM LAA+LCIR  P  RP I  VVKLL+G+ + ++W
Sbjct  610   IQGGKLAELVDPSFPTEGHDDEVERMTLAASLCIRPAPQHRPHIAAVVKLLDGDNDILKW  669

Query  654   ARQNLNSGDEVD------EVGGEQPASSIQSFINLALLNLEDDSLSITSSD---QNISVD  502
             AR  + S  E D       +   + +++IQS+INLA  +++DDS S++S+D    N S++
Sbjct  670   ARSQIGSSYESDTDEDAVTLTPPENSTNIQSYINLA-FDVDDDSASVSSNDFITANTSLE  728

Query  501   DYL  493
             +YL
Sbjct  729   EYL  731



>ref|XP_010237867.1| PREDICTED: putative L-type lectin-domain containing receptor 
kinase V.2 isoform X1 [Brachypodium distachyon]
Length=741

 Score =   181 bits (460),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDV+A GVVLLEL+SG+KP+     KGQESLV+WA  I
Sbjct  549   DVAGTFGYLAPEYFMHGKVNDKIDVFAYGVVLLELISGRKPLCTGCPKGQESLVMWANSI  608

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK  EL+D S       DE +RM LAA+LCIR  P  RP I  VVKLL+G+ + ++W
Sbjct  609   IQGGKLAELVDPSFPTEGHDDEVERMTLAASLCIRPAPQHRPHIAAVVKLLDGDNDILKW  668

Query  654   ARQNLNSGDEVD------EVGGEQPASSIQSFINLALLNLEDDSLSITSSD---QNISVD  502
             AR  + S  E D       +   + +++IQS+INLA  +++DDS S++S+D    N S++
Sbjct  669   ARSQIGSSYESDTDEDAVTLTPPENSTNIQSYINLA-FDVDDDSASVSSNDFITANTSLE  727

Query  501   DYL  493
             +YL
Sbjct  728   EYL  730



>ref|XP_010521198.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
 ref|XP_010521207.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
 ref|XP_010521216.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
 ref|XP_010521224.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=709

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 132/173 (76%), Gaps = 4/173 (2%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             VAGTFGYLAPEYF+HGK+ EKIDVYA GVVLLELLSG+KPI +   KGQESLV+WAK IL
Sbjct  528   VAGTFGYLAPEYFMHGKVTEKIDVYAFGVVLLELLSGRKPICSDYPKGQESLVMWAKPIL  587

Query  831   KNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWA  652
             ++GK ++LLD +L +  +++  ++MVLAATLCIRR P  RP+I +V+K+L+G+ E  +W 
Sbjct  588   ESGKFSQLLDPNLESNENNELIEKMVLAATLCIRRTPHARPQISLVLKILQGDEEATEWG  647

Query  651   RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
             +Q + + +E +        ++I+S INLALL+LED++   +S +  ISV++YL
Sbjct  648   KQQVEASEEEEVAS----PTNIESHINLALLDLEDEANPDSSPEATISVEEYL  696



>gb|EPS63840.1| hypothetical protein M569_10941, partial [Genlisea aurea]
Length=721

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             +VAGTFGYLAPEYF++GK+NEKIDVYA GVVLLELL+G+KPI++   KGQESLVLWAK +
Sbjct  537   NVAGTFGYLAPEYFMYGKVNEKIDVYAYGVVLLELLTGRKPINSNCPKGQESLVLWAKPL  596

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L + K T LLDA+    YDH + +RM LAA+LC+RR P  RP+++ ++KLL+G+ E   W
Sbjct  597   LHSEKFTTLLDANFGRNYDHQQAERMALAASLCVRRAPRARPQMNTILKLLQGDEEVTAW  656

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDD  544
             A   +N   E  E     P+S++QS ++LALL +E++
Sbjct  657   AHLQVNVLAEASE-EETSPSSTLQSHLSLALLGVEEE  692



>ref|XP_006279577.1| hypothetical protein CARUB_v10025977mg [Capsella rubella]
 gb|EOA12475.1| hypothetical protein CARUB_v10025977mg [Capsella rubella]
Length=711

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 131/177 (74%), Gaps = 6/177 (3%)
 Frame = -2

Query  1020  GVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAK  841
             G  +AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLWA 
Sbjct  527   GGGIAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICIDQSKGQESLVLWAN  586

Query  840   QILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETI  661
              IL++GK  +LLD SL N    +  ++++LAATLCI+R P  RP+I +V+K+L+G+ E  
Sbjct  587   PILESGKFAQLLDPSLENDNSDELIEKLLLAATLCIKRTPYDRPQIGLVLKILQGDVEAT  646

Query  660   QWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
             +W +Q + + +  DE       ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  647   EWGKQQVRTSE--DETA---YLTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  698



>ref|XP_004981112.1| PREDICTED: uncharacterized protein LOC101777140 [Setaria italica]
Length=934

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGYLAPEYF +GK+NEKIDVYA GVVLLE++SG++PI   + KGQESLV W
Sbjct  749   LTCTDITGTFGYLAPEYFSYGKVNEKIDVYAFGVVLLEIISGRRPITPGSPKGQESLVGW  808

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +L +G+  +L+D  L N YD DE +RM LAA+LC R     RP++ +V+KLL+G+ E
Sbjct  809   AKPLLSSGEIKQLVDPFLGNDYDCDEMERMTLAASLCTRTSSHSRPEMSLVLKLLQGDDE  868

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNL-EDDSLSITSSDQNISVDDY  496
             TI WAR  + +  +  +     P +++QS +NLALL + EDD+LS  SS  + S D Y
Sbjct  869   TIGWARLQVTASFDGSDEETATPDANMQSHLNLALLGVEEDDTLSRCSSTVDTSADGY  926



>gb|KFK28085.1| hypothetical protein AALP_AA8G470300 [Arabis alpina]
Length=699

 Score =   179 bits (455),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 131/175 (75%), Gaps = 6/175 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLV+WA  I
Sbjct  517   DIAGTFGYLAPEYFLHGKVTDKIDVYAFGVVLLELLSGRKPICVDQSKGQESLVMWANPI  576

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++GK  +LLD SL     ++  ++++LAATLCI+R P  RP++ +V+K+L+G+ E  +W
Sbjct  577   LESGKFVQLLDPSLETDNSNELIEKLLLAATLCIKRSPHDRPQMGLVLKILQGDEEATEW  636

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
              +Q + + +  DE       ++I+S INLALL+LEDD+ S +S +  +ISV+DYL
Sbjct  637   GKQQVRASE--DEAA---YLTNIESHINLALLDLEDDAASDSSPEASSISVEDYL  686



>ref|XP_002463556.1| hypothetical protein SORBIDRAFT_01g001890 [Sorghum bicolor]
 gb|EER90554.1| hypothetical protein SORBIDRAFT_01g001890 [Sorghum bicolor]
Length=945

 Score =   181 bits (459),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGY+APEYF +GK+NEKID+YA GVVLLE++SG++PI   +AKGQESLV W
Sbjct  755   LTCTDITGTFGYMAPEYFSYGKVNEKIDIYAFGVVLLEIISGRRPITQGSAKGQESLVGW  814

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +L +G+  +L+D  L N YD DE +RM LAA+LC R     RP++ +V+KLL+G+ E
Sbjct  815   AKPLLSSGEIKQLIDPFLGNNYDCDEMERMTLAASLCTRTSSHSRPEMSLVLKLLQGDDE  874

Query  666   TIQWARQNLNSG-DEVD-EVGGEQPASSIQSFINLALLNL-EDDSLSITSSDQ---NISV  505
             TI WAR  + +  D  D E     P  ++QS++NLALL + EDD+LS  SS +   + S 
Sbjct  875   TIGWARAQVTASFDGSDEEATAAAPDVNMQSYLNLALLGVEEDDTLSHCSSTERTVDTSA  934

Query  504   DDY  496
             D Y
Sbjct  935   DGY  937



>dbj|BAF01933.1| hypothetical protein [Arabidopsis thaliana]
Length=188

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 128/170 (75%), Gaps = 2/170 (1%)
 Frame = -2

Query  996  GYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQILKNGKA  817
             YLAPEYF++GK+N KIDVYA GVVLLELLSG+KP+++ + K Q+SLV+WAK IL + + 
Sbjct  8    SYLAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQDSLVMWAKPILDDKEY  67

Query  816  TELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWARQNLN  637
            ++LLD+SL +  + D+ ++M LAATLCIR  P  RP + +V++LL+G+ E ++WA+  ++
Sbjct  68   SQLLDSSLQDDNNSDQMEKMALAATLCIRHNPQTRPTMGMVLELLKGDVEMLKWAKLQVS  127

Query  636  SGDEVDEVGGEQP--ASSIQSFINLALLNLEDDSLSITSSDQNISVDDYL  493
            +  E   +  ++    S++QS +NLA L++EDDSLS+ S +Q ISV++YL
Sbjct  128  NPLEDSMLLKDEKLRRSNLQSHLNLAFLDMEDDSLSMGSMEQGISVEEYL  177



>gb|EEC68959.1| hypothetical protein OsI_37687 [Oryza sativa Indica Group]
Length=631

 Score =   178 bits (451),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 135/186 (73%), Gaps = 10/186 (5%)
 Frame = -2

Query  1020  GVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAK  841
             G DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLEL+SG+KP+ +   KG+ESLV+WA 
Sbjct  435   GDDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELVSGRKPVSSGGGKGKESLVMWAN  494

Query  840   QILKNGKATELLDASLLN--AYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
              I++ GK T+L+D SL    +    E +RM LAA LCIRR P  RP I  V+KLL+G+ +
Sbjct  495   TIIQGGKLTDLVDPSLPTDGSGVAGEVERMTLAAALCIRRSPQRRPSIANVLKLLDGDGD  554

Query  666   TIQWARQ--NLNSGDEVDEVGGEQPASS-IQSFINLALLNLEDDSLSITS-----SDQNI  511
              ++WAR    L++GD+ D+  G  P    IQS+INLALL+++DDS S++S     +  N+
Sbjct  555   AVRWARSQAGLSAGDDTDDGDGASPEKKDIQSYINLALLDVDDDSASVSSGGGDFTAANV  614

Query  510   SVDDYL  493
             S+++Y+
Sbjct  615   SLEEYM  620



>gb|ABA91867.2| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG93083.1| unnamed protein product [Oryza sativa Japonica Group]
Length=541

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 128/184 (70%), Gaps = 14/184 (8%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDVYA GVVLLEL+SGKKP+     KGQESLV+WA  I
Sbjct  351   DVAGTFGYLAPEYFMHGKVNDKIDVYAFGVVLLELISGKKPLCTGCPKGQESLVMWANSI  410

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L+D +L      ++ +RM LAA+LCIR  P  RP I +V+KLL G+   ++W
Sbjct  411   IQGGKLTQLVDPNLPTEDHANKVERMTLAASLCIRPTPQRRPHIAVVLKLLNGDNGILKW  470

Query  654   ARQNLNSGDEVDEVGGEQPA-------SSIQSFINLALLNLEDDSLSITSSD---QNISV  505
             AR  +    E D   G++P         +IQS+INLA  +++DDS S++S+D    N S+
Sbjct  471   ARSEVGLSYESD---GDEPVVTLPENNRNIQSYINLA-FDVDDDSASVSSNDFIAANTSL  526

Query  504   DDYL  493
             ++YL
Sbjct  527   EEYL  530



>ref|XP_006394226.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
 gb|ESQ31512.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
Length=710

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 130/174 (75%), Gaps = 6/174 (3%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             +AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLWA  IL
Sbjct  529   IAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICVDQSKGQESLVLWANPIL  588

Query  831   KNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWA  652
             ++GK  +L+D +L     +D  ++++LAATLCI+R P  RP+I +V+K+L+G+ E  +W 
Sbjct  589   ESGKFAQLMDPNLETDNSNDLVEKLLLAATLCIKRAPHDRPQISLVLKILQGDEEATEWG  648

Query  651   RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
             +Q + + +  DE       ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  649   KQQVRASE--DETA---YLTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  697



>ref|XP_006394225.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
 gb|ESQ31511.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
Length=708

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 130/174 (75%), Gaps = 6/174 (3%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             +AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLELLSG+KPI    +KGQESLVLWA  IL
Sbjct  527   IAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELLSGRKPICVDQSKGQESLVLWANPIL  586

Query  831   KNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWA  652
             ++GK  +L+D +L     +D  ++++LAATLCI+R P  RP+I +V+K+L+G+ E  +W 
Sbjct  587   ESGKFAQLMDPNLETDNSNDLVEKLLLAATLCIKRAPHDRPQISLVLKILQGDEEATEWG  646

Query  651   RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
             +Q + + +  DE       ++I+S INLALL+LEDD+ S +S +  +ISV++YL
Sbjct  647   KQQVRASE--DETA---YLTNIESHINLALLDLEDDAASDSSPEASSISVEEYL  695



>ref|NP_001067422.1| Os11g0194900 [Oryza sativa Japonica Group]
 dbj|BAF27785.1| Os11g0194900, partial [Oryza sativa Japonica Group]
Length=667

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 128/184 (70%), Gaps = 14/184 (8%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDVYA GVVLLEL+SGKKP+     KGQESLV+WA  I
Sbjct  477   DVAGTFGYLAPEYFMHGKVNDKIDVYAFGVVLLELISGKKPLCTGCPKGQESLVMWANSI  536

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L+D +L      ++ +RM LAA+LCIR  P  RP I +V+KLL G+   ++W
Sbjct  537   IQGGKLTQLVDPNLPTEDHANKVERMTLAASLCIRPTPQRRPHIAVVLKLLNGDNGILKW  596

Query  654   ARQNLNSGDEVDEVGGEQPA-------SSIQSFINLALLNLEDDSLSITSSD---QNISV  505
             AR  +    E D   G++P         +IQS+INLA  +++DDS S++S+D    N S+
Sbjct  597   ARSEVGLSYESD---GDEPVVTLPENNRNIQSYINLA-FDVDDDSASVSSNDFIAANTSL  652

Query  504   DDYL  493
             ++YL
Sbjct  653   EEYL  656



>ref|XP_009150459.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Brassica 
rapa]
Length=697

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 7/175 (4%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             +AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLEL+SG+KPI    +KGQESLV+WA  IL
Sbjct  515   IAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVMWANPIL  574

Query  831   KNGKATELLDASL-LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++GK  +LLD SL  +   +D  ++++LAATLCI+R P  RP+I +VVK+L+G+ +  +W
Sbjct  575   ESGKFAQLLDPSLEADDSSNDLIEKLLLAATLCIKRAPHDRPQIGLVVKILQGDEDATEW  634

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
              +Q + + ++          ++I+S INLALL+LEDD+ S +S +  +ISV+DYL
Sbjct  635   GKQQVKASEDATAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEDYL  684



>emb|CDY43771.1| BnaA06g23070D [Brassica napus]
Length=679

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 7/175 (4%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             +AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLEL+SG+KPI    +KGQESLV+WA  IL
Sbjct  497   IAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVMWANPIL  556

Query  831   KNGKATELLDASL-LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++GK  +LLD SL  +   +D  ++++LAATLCI+R P  RP+I +VVK+L+G+ +  +W
Sbjct  557   ESGKFAQLLDPSLEADDSSNDLIEKLLLAATLCIKRAPHDRPQIGLVVKILQGDEDATEW  616

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
              +Q + + ++          ++I+S INLALL+LEDD+ S +S +  +ISV+DYL
Sbjct  617   GKQQVKASEDATAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEDYL  666



>emb|CDX84466.1| BnaC03g50340D [Brassica napus]
Length=701

 Score =   177 bits (448),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 7/175 (4%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             +AGTFGYLAPEYF+HGK+ +KIDVYA GVVLLEL+SG+KPI    +KGQESLV+WA  IL
Sbjct  519   IAGTFGYLAPEYFMHGKVTDKIDVYAFGVVLLELISGRKPICVDQSKGQESLVMWANPIL  578

Query  831   KNGKATELLDASL-LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++GK  +LLD SL  +   +D  ++++LAATLCI+R P  RP+I +VVK+L+G+ +  +W
Sbjct  579   ESGKFAQLLDPSLEADDSSNDLIEKLLLAATLCIKRAPHDRPQIGLVVKILQGDEDATEW  638

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSD-QNISVDDYL  493
              +Q + + ++          ++I+S INLALL+LEDD+ S +S +  +ISV+DYL
Sbjct  639   GKQQVKASEDATAY-----LTNIESHINLALLDLEDDAASDSSPEASSISVEDYL  688



>gb|EEC78249.1| hypothetical protein OsI_17914 [Oryza sativa Indica Group]
Length=737

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 128/184 (70%), Gaps = 14/184 (8%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDVYA GVVLLEL+SGKKP+     KGQESLV+WA  I
Sbjct  547   DVAGTFGYLAPEYFMHGKVNDKIDVYAFGVVLLELISGKKPLCTGCPKGQESLVMWANSI  606

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L+D +L      ++ +RM LAA+LCIR  P  RP I +V+KLL G+   ++W
Sbjct  607   IQGGKLTQLVDPNLPTEDHANKVERMTLAASLCIRPTPQRRPHIAVVLKLLNGDNGILKW  666

Query  654   ARQNLNSGDEVDEVGGEQPA-------SSIQSFINLALLNLEDDSLSITSSD---QNISV  505
             AR  +    E D   G++P         +IQS+INLA  +++DDS S++S+D    N S+
Sbjct  667   ARSEVGLSYESD---GDEPVVTLPENNRNIQSYINLA-FDVDDDSASVSSNDFIAANTSL  722

Query  504   DDYL  493
             ++YL
Sbjct  723   EEYL  726



>gb|AAX96058.1| At5g63940 [Oryza sativa Japonica Group]
 gb|EAZ17716.1| hypothetical protein OsJ_33259 [Oryza sativa Japonica Group]
Length=745

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 128/184 (70%), Gaps = 14/184 (8%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDVYA GVVLLEL+SGKKP+     KGQESLV+WA  I
Sbjct  555   DVAGTFGYLAPEYFMHGKVNDKIDVYAFGVVLLELISGKKPLCTGCPKGQESLVMWANSI  614

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L+D +L      ++ +RM LAA+LCIR  P  RP I +V+KLL G+   ++W
Sbjct  615   IQGGKLTQLVDPNLPTEDHANKVERMTLAASLCIRPTPQRRPHIAVVLKLLNGDNGILKW  674

Query  654   ARQNLNSGDEVDEVGGEQPA-------SSIQSFINLALLNLEDDSLSITSSD---QNISV  505
             AR  +    E D   G++P         +IQS+INLA  +++DDS S++S+D    N S+
Sbjct  675   ARSEVGLSYESD---GDEPVVTLPENNRNIQSYINLA-FDVDDDSASVSSNDFIAANTSL  730

Query  504   DDYL  493
             ++YL
Sbjct  731   EEYL  734



>ref|XP_006663269.1| PREDICTED: proline-rich receptor-like protein kinase PERK13-like 
[Oryza brachyantha]
Length=667

 Score =   176 bits (447),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 128/181 (71%), Gaps = 8/181 (4%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDVYA GV+LLEL+SGKKP+     KGQESLV+WA  I
Sbjct  477   DVAGTFGYLAPEYFMHGKVNDKIDVYAFGVILLELISGKKPLCTGCPKGQESLVMWANSI  536

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L+D +L      ++ +RM LAA+LCIR  P  RP I  V+KLL G+   ++W
Sbjct  537   IQGGKLTQLVDPNLPTVDHANKVERMTLAASLCIRPTPQHRPHIADVLKLLNGDSSILKW  596

Query  654   ARQ--NLNSGDEVDEVGGEQPAS--SIQSFINLALLNLEDDSLSITSSD---QNISVDDY  496
             AR    L+   + DE     PA+  +IQS+INLA  +++DDS S++S+D    N S+++Y
Sbjct  597   ARSEVGLSYDSDGDEAVVTPPANNRNIQSYINLA-FDVDDDSASVSSNDFIAANTSLEEY  655

Query  495   L  493
             L
Sbjct  656   L  656



>ref|XP_008644345.1| PREDICTED: uncharacterized protein LOC103625730 [Zea mays]
 gb|AFW67032.1| putative protein kinase superfamily protein [Zea mays]
Length=914

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGY+APEYF HG++NEKIDVYA GVVLLE++SG++PI   +AKGQESLV W
Sbjct  730   LTCTDITGTFGYMAPEYFSHGEVNEKIDVYAFGVVLLEIVSGRRPITPGSAKGQESLVGW  789

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK +L +G    L+D  L N YD DE +RM LAA+LC R     RP++ +V+KLL+G+ E
Sbjct  790   AKPLLSSGGIKHLVDPFLGNDYDCDEMERMTLAASLCTRTSWHSRPEMSLVLKLLQGDDE  849

Query  666   TIQWARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLE-DDSLSITSSDQNISVDDY  496
             T+ WAR     G + +E     P  ++QS ++LALL ++ DD+LS  SS +  S D Y
Sbjct  850   TMGWARSASFDGSD-EEAIAAGPDLNMQSHLSLALLGVDADDTLSRCSSTERTSADGY  906



>gb|EMT26702.1| hypothetical protein F775_52533 [Aegilops tauschii]
Length=778

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 9/168 (5%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N+KIDV+A GVVLLEL+SG+KP+     KGQESLV+WA  I
Sbjct  579   DVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCPKGQESLVMWANSI  638

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ GK T+L D SL      DE +RM LAA+LCIR  P  RP I +V+KLL+G+ + ++W
Sbjct  639   IQGGKLTQLADPSLPTEGHADEIERMTLAASLCIRPTPQHRPHIAVVLKLLDGDNDILKW  698

Query  654   ARQNL-----NSGDEVDEVGGEQPA---SSIQSFINLALLNLEDDSLS  535
             AR ++     + GDE D V    P    ++IQS+INLA  +++DDS S
Sbjct  699   ARSHVGLSYESDGDEDDVVTLAPPPENNTNIQSYINLA-FDVDDDSAS  745



>gb|EEE52871.1| hypothetical protein OsJ_35430 [Oryza sativa Japonica Group]
Length=719

 Score =   174 bits (440),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 133/187 (71%), Gaps = 10/187 (5%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLEL+SG+KP+ +   KG+ESLV+W
Sbjct  521   VTGDDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELVSGRKPVSSGGGKGKESLVMW  580

Query  846   AKQILKNGKATELLDASLLN--AYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGE  673
             A  I++ GK T+L+D SL    +    E +RM LAA LCIRR P  RP I  V+KLL+G+
Sbjct  581   ANTIIQGGKLTDLVDPSLPTDGSGVAGEVERMTLAAALCIRRSPQRRPSIANVLKLLDGD  640

Query  672   PETIQWARQ--NLNSGDEVDEVGGEQPASS-IQSFINLALLNLEDDSLSITS-----SDQ  517
              + ++W R    L++GD+ D+  G  P    IQS+INLALL++ DDS S++S     +  
Sbjct  641   GDAVRWVRSQAGLSAGDDTDDGDGASPEKKDIQSYINLALLDVVDDSASVSSGGGDFTAA  700

Query  516   NISVDDY  496
             N+S+++Y
Sbjct  701   NVSLEEY  707



>gb|AGW24429.1| receptor-like cytosolic serine/threonine-protein kinase RBK1, 
partial [Avicennia marina var. marina]
Length=150

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             +D  DVAGTFGYLAPEYF+HGK+NEKIDVYA GVVLLELLSG+KPIDN + KGQESLV+W
Sbjct  50    MDTFDVAGTFGYLAPEYFMHGKLNEKIDVYAFGVVLLELLSGRKPIDNGHPKGQESLVMW  109

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRR  727
             AK ILK GK  EL D +L NA D+D+F+RMVLAATLCIRR
Sbjct  110   AKHILKEGKILELQDPNLGNACDNDQFERMVLAATLCIRR  149



>ref|XP_004978900.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X1 [Setaria italica]
Length=784

 Score =   173 bits (439),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 133/213 (62%), Gaps = 40/213 (19%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DVAGTFGYLAPEYF+HGK+N KIDVYA GVVLLEL+SG+KP+ N   KGQESLV+WA  I
Sbjct  562   DVAGTFGYLAPEYFMHGKVNSKIDVYAFGVVLLELISGRKPLCNGCPKGQESLVMWANSI  621

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDI--------------  697
             ++ GK T+L+D +L      +E +RM LAA+LCIR+ P  RP+ID               
Sbjct  622   IQGGKLTQLVDPNLPTEGHTNEVERMTLAASLCIRQAPQNRPQIDAVSFSALLDAYSAQV  681

Query  696   ----------------VVKLLEGEPETIQWARQNLNSGDEV--DEVGGEQPA----SSIQ  583
                             V+KLLEG+ + ++WAR  +    EV  DE     PA    ++IQ
Sbjct  682   FMLFIILLQASGCTHQVLKLLEGDNDILKWARSQVGLAYEVDGDECVMTPPAPGSNANIQ  741

Query  582   SFINLALLNLEDDSLSITSSD---QNISVDDYL  493
             S+INLA  +++DDS S++S+D    N S+++YL
Sbjct  742   SYINLA-FDVDDDSASVSSTDFIAANTSLEEYL  773



>ref|XP_003577000.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Brachypodium distachyon]
Length=753

 Score =   170 bits (431),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 131/200 (66%), Gaps = 23/200 (12%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+++KIDVYA GVVLLEL+SG+KP+ +   KGQESLV+W
Sbjct  529   ITGDDMAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELVSGRKPVSSGGPKGQESLVMW  588

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             A  I++ GK TEL+D +L       E +RM LA  LCIRREP  RP I  V+KL++G+ +
Sbjct  589   ANSIVQGGKLTELVDPNLPTD-GSGEVERMALAGALCIRREPQRRPSIANVLKLIDGDSD  647

Query  666   TIQWARQNLNSGD--------EVDEVGGEQPAS--------SIQSFINLALLNL----ED  547
              I+WAR  L   D         VD    E+  S         IQS+I LALL++    +D
Sbjct  648   AIKWARSQLGVSDTDSEKDYNAVDIDDDEEDYSVVTLPEKNDIQSYIKLALLDVTGEDDD  707

Query  546   DSLSITSS--DQNISVDDYL  493
             D++SI+S     N+S+++Y+
Sbjct  708   DAMSISSDFIAANMSLEEYM  727



>ref|XP_010933340.1| PREDICTED: proline-rich receptor-like protein kinase PERK5 isoform 
X1 [Elaeis guineensis]
 ref|XP_010933341.1| PREDICTED: proline-rich receptor-like protein kinase PERK5 isoform 
X1 [Elaeis guineensis]
Length=674

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK++EKIDVYA GVVLLELLSG+KPI++ N KGQESLV+WA  I
Sbjct  481   DVVGTFGYLAPEYFMYGKVSEKIDVYAFGVVLLELLSGRKPINDDNPKGQESLVMWATTI  540

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G  T LLD +L    D  +   M+LAA+LCIRR    RP++  ++ +L+G  +   W
Sbjct  541   LERGDVTNLLDPNLDAKLDEAKMRIMILAASLCIRRAACLRPQMSQILNILQGVEDIEAW  600

Query  654   ARQNLNSG-DEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQN--ISVDDYL  493
             A  ++++  +E+D    E  PASSI++ + LALL++EDD+ S++S +Q+   S+++YL
Sbjct  601   ANCHIDTTLNELDSQDEETYPASSIETHLGLALLDVEDDA-SVSSFEQSQLASLEEYL  657



>ref|XP_011046242.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Populus euphratica]
Length=543

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVYA GVVLLELLSG+KPI + N K QESL+LWAK I
Sbjct  354   DVVGTFGYLAPEYFMYGKVSDKIDVYAFGVVLLELLSGRKPISSENTKSQESLLLWAKPI  413

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             +++G A  L+D +L   +D  +  RMVLAAT CI R    RPK+  ++KLL G+ E  +W
Sbjct  414   IESGNAICLVDPNLNGNFDEVQMQRMVLAATHCITRAARLRPKMSEILKLLRGDKEQEKW  473

Query  654   AR------QNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVDD  499
             A       Q   + D  DEV    P SS +S ++LALL+++ DS S +S +   N+S+++
Sbjct  474   ANPQNKDLQATENQDNDDEV---YPNSSAESHLSLALLDVDYDSTSFSSWEHGNNLSIEE  530

Query  498   YL  493
             Y 
Sbjct  531   YF  532



>ref|XP_002305520.1| kinase family protein [Populus trichocarpa]
 gb|EEE86031.1| kinase family protein [Populus trichocarpa]
Length=678

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 130/179 (73%), Gaps = 5/179 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             +V GTFGYLAPEYF++GK+++KIDVYA GVVLLELLSG++PI + + KGQESLV+WAK I
Sbjct  489   EVVGTFGYLAPEYFMYGKVSDKIDVYAFGVVLLELLSGRRPISSESTKGQESLVMWAKPI  548

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G A  L+D +L   +D  +  RMVLAAT CI R    RPK+  ++KLL G+ E  +W
Sbjct  549   LESGDAKGLVDPNLNGNFDEVQMQRMVLAATHCITRAARLRPKMSEILKLLRGDTELEEW  608

Query  654   AR-QNLNSGDEVDEVGGEQ--PASSIQSFINLALLNLEDDSLSITSSDQ--NISVDDYL  493
                QN +  D+ ++   ++  P+SS +  ++LALL+++DDS S +S +Q  N+S+++Y+
Sbjct  609   VNPQNKDPRDQENQDNDDEVYPSSSAELHLSLALLDVDDDSTSFSSLEQVNNLSLEEYV  667



>ref|XP_010933342.1| PREDICTED: proline-rich receptor-like protein kinase PERK5 isoform 
X2 [Elaeis guineensis]
Length=673

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK++EKIDVYA GVVLLELLSG+KPI++ N KGQESLV+WA  I
Sbjct  480   DVVGTFGYLAPEYFMYGKVSEKIDVYAFGVVLLELLSGRKPINDDNPKGQESLVMWATTI  539

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G  T LLD +L    D  +   M+LAA+LCIRR    RP++  ++ +L+G  +   W
Sbjct  540   LERGDVTNLLDPNLDAKLDEAKMRIMILAASLCIRRAACLRPQMSQILNILQGVEDIEAW  599

Query  654   ARQNLNSG-DEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQN--ISVDDYL  493
             A  ++++  +E+D    E  PASSI++ + LALL++EDD+ S++S +Q+   S+++YL
Sbjct  600   ANCHIDTTLNELDSQDEETYPASSIETHLGLALLDVEDDA-SVSSFEQSQLASLEEYL  656



>gb|EMS52526.1| Putative proline-rich receptor-like protein kinase PERK11 [Triticum 
urartu]
Length=468

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 120/183 (66%), Gaps = 10/183 (5%)
 Frame = -2

Query  1020  GVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAK  841
             G D+AGTFGYLAPEYF+HGK+++K+DVYA GVVLLEL+SG+KP+ +   KGQES+V+WA 
Sbjct  248   GDDLAGTFGYLAPEYFMHGKVSDKMDVYAFGVVLLELVSGRKPVSSGGPKGQESIVMWAN  307

Query  840   QILKNGKATELLDASLLNAYDH-DEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPET  664
               ++ GK TEL+D SL    D+  E +RM LAA LCIRR P  RP +  V+KLL+G+ + 
Sbjct  308   SAVQGGKLTELVDPSLPTDGDNAGEMERMALAAALCIRRAPQGRPSMANVLKLLDGDSDA  367

Query  663   IQWARQNL--------NSGDEVDEVGGEQP-ASSIQSFINLALLNLEDDSLSITSSDQNI  511
             +QWAR  L        N GDE        P  + IQS+I LALL+  D+     S+    
Sbjct  368   VQWARSQLGVPNACDDNHGDEDYYSAAASPDKNDIQSYIKLALLDGGDEEDDDDSASMGC  427

Query  510   SVD  502
             +VD
Sbjct  428   AVD  430



>ref|XP_011046218.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Populus euphratica]
 ref|XP_011046226.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Populus euphratica]
 ref|XP_011046234.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Populus euphratica]
Length=680

 Score =   168 bits (426),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVYA GVVLLELLSG+KPI + N K QESL+LWAK I
Sbjct  491   DVVGTFGYLAPEYFMYGKVSDKIDVYAFGVVLLELLSGRKPISSENTKSQESLLLWAKPI  550

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             +++G A  L+D +L   +D  +  RMVLAAT CI R    RPK+  ++KLL G+ E  +W
Sbjct  551   IESGNAICLVDPNLNGNFDEVQMQRMVLAATHCITRAARLRPKMSEILKLLRGDKEQEKW  610

Query  654   AR------QNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVDD  499
             A       Q   + D  DEV    P SS +S ++LALL+++ DS S +S +   N+S+++
Sbjct  611   ANPQNKDLQATENQDNDDEV---YPNSSAESHLSLALLDVDYDSTSFSSWEHGNNLSIEE  667

Query  498   YL  493
             Y 
Sbjct  668   YF  669



>ref|XP_002313708.1| hypothetical protein POPTR_0009s13710g [Populus trichocarpa]
 gb|EEE87663.1| hypothetical protein POPTR_0009s13710g [Populus trichocarpa]
Length=621

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVYA GVVLLELLSG+KPI + N K QESLVLWAK I
Sbjct  432   DVVGTFGYLAPEYFMYGKVSDKIDVYAFGVVLLELLSGRKPISSENTKSQESLVLWAKPI  491

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             +++G A  L+D +L   +D  +  RMVLAAT CI R    RPK+  ++KLL G+ E  +W
Sbjct  492   IESGNAIGLVDPNLNGNFDEVQMQRMVLAATHCITRAARLRPKMSEILKLLRGDKEPEKW  551

Query  654   AR------QNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVDD  499
                     Q+  + D  DEV    P SS +S ++LALL+++ DS S +S +   N+S+++
Sbjct  552   VNPQNKDLQDPENQDNDDEV---YPNSSAESHLSLALLDVDYDSTSFSSWEHGNNLSIEE  608

Query  498   YL  493
             Y 
Sbjct  609   YF  610



>ref|XP_010028727.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Eucalyptus grandis]
 gb|KCW55526.1| hypothetical protein EUGRSUZ_I01415 [Eucalyptus grandis]
Length=687

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 128/187 (68%), Gaps = 12/187 (6%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L  VDV GTFGYLAPEYF++GK+++K+DVYA GVVLLELLSG+KPI +  AKGQESLV+W
Sbjct  493   LTKVDVVGTFGYLAPEYFMYGKLSDKVDVYAFGVVLLELLSGRKPISSDAAKGQESLVMW  552

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK I+++G A+ +LD  L    D  +  RMVLAA LC+ R    RP ++ ++K++ G+  
Sbjct  553   AKPIIESGDASSILDPDLGGRVDEVQMQRMVLAARLCLTRSARLRPNMNQILKIINGDIN  612

Query  666   TIQWARQNLN-------SGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--N  514
               +W     +       S D  DEV    P SS +S ++LALL++ DDS SI+S++Q  +
Sbjct  613   VDEWLDYKCDHWVDSEISDDNDDEV---YPNSSAESHLSLALLDVYDDSTSISSTEQRSS  669

Query  513   ISVDDYL  493
             ISV++Y+
Sbjct  670   ISVEEYM  676



>ref|XP_004977217.1| PREDICTED: proline-rich receptor-like protein kinase PERK13-like 
[Setaria italica]
Length=696

 Score =   168 bits (425),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 125/186 (67%), Gaps = 10/186 (5%)
 Frame = -2

Query  1020  GVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAK  841
             G DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLEL+SG+KP+     KGQESLV+WA 
Sbjct  499   GDDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELISGRKPVSAGGPKGQESLVMWAN  558

Query  840   QILKNGKATELLDASL-LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPET  664
              +++ GK  +L+D SL L   D  E +RM LAA LCIRR    RP +  VVKLL G+ + 
Sbjct  559   SVIQGGKLMDLVDPSLPLADGDGGEVERMALAAALCIRRAHQHRPSMSNVVKLLAGDGDA  618

Query  663   IQWARQNLNSGDEVDEVGGEQPASS-----IQSFINLALLN-LEDDSLSITSS---DQNI  511
             + WA+  +      D  G     +S     IQS+INLAL + ++DD+ S+ S+   D N+
Sbjct  619   VMWAKSQVGVSGGSDHGGCGGVVTSPDKNDIQSYINLALRDIIDDDASSVGSADFIDANM  678

Query  510   SVDDYL  493
             S+++YL
Sbjct  679   SLEEYL  684



>ref|XP_009413203.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=541

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 123/177 (69%), Gaps = 3/177 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DV+A GVVLLELL+G+KPID+ N KGQESLV+WA  I
Sbjct  354   DVVGTFGYLAPEYFMYGKVSDKMDVFAFGVVLLELLTGRKPIDDENPKGQESLVMWASPI  413

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G   ELLD  L   YD  E  RMV+AA+LCI R    RP++  ++ LL+GE +    
Sbjct  414   LERGDFMELLDPDLNENYDEVEMRRMVVAASLCITRRARLRPQMREILTLLQGEEDMEAR  473

Query  654   ARQNLN-SGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNI-SVDDYL  493
              R +++ S D +D    E  P SSI+S + LALL++EDD+   +    N+ S+D+YL
Sbjct  474   MRCHVDASSDTLDCEDDEAYPCSSIRSHVGLALLDVEDDASLASFEQSNLGSLDEYL  530



>ref|XP_009413128.1| PREDICTED: proline-rich receptor-like protein kinase PERK5 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 123/177 (69%), Gaps = 3/177 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DV+A GVVLLELL+G+KPID+ N KGQESLV+WA  I
Sbjct  434   DVVGTFGYLAPEYFMYGKVSDKMDVFAFGVVLLELLTGRKPIDDENPKGQESLVMWASPI  493

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G   ELLD  L   YD  E  RMV+AA+LCI R    RP++  ++ LL+GE +    
Sbjct  494   LERGDFMELLDPDLNENYDEVEMRRMVVAASLCITRRARLRPQMREILTLLQGEEDMEAR  553

Query  654   ARQNLN-SGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNI-SVDDYL  493
              R +++ S D +D    E  P SSI+S + LALL++EDD+   +    N+ S+D+YL
Sbjct  554   MRCHVDASSDTLDCEDDEAYPCSSIRSHVGLALLDVEDDASLASFEQSNLGSLDEYL  610



>ref|XP_007041834.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007041835.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007041836.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX97665.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX97666.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX97667.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
Length=683

 Score =   165 bits (417),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 124/181 (69%), Gaps = 3/181 (2%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   DV GTFGYLAPEYF++GK+++KIDVYA GVVLLELLSGK+PI     +GQ+SLV+W
Sbjct  492   LTQADVVGTFGYLAPEYFMYGKLSDKIDVYAFGVVLLELLSGKRPIGFETPRGQQSLVMW  551

Query  846   AKQILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE  667
             AK I++NG    +LD +L    +  +  RMVLAATLCI R    RPK+  +++LL+G+  
Sbjct  552   AKPIIENGDVKGILDPNLNGNINETQMKRMVLAATLCITRSARLRPKMSEILELLKGDEG  611

Query  666   TIQWARQNLNSGDEVDEVGGE-QPASSIQSFINLALLNLEDDSLSITSSDQ--NISVDDY  496
               +WA    ++ +  D    E  P SS +  ++LA+L+++DDS S +S +Q  N+S+++Y
Sbjct  612   VEKWAETRHDNTESQDHNDDEVYPNSSAELHLSLAMLDIDDDSTSFSSMEQSSNLSMEEY  671

Query  495   L  493
             L
Sbjct  672   L  672



>ref|XP_011046681.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Populus 
euphratica]
 ref|XP_011046682.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Populus 
euphratica]
Length=679

 Score =   164 bits (415),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 127/182 (70%), Gaps = 11/182 (6%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             +V GTFGYLAPEYF++GK++ KIDVYA GVVLLELLSG++PI + + KGQESLV+WAK I
Sbjct  490   EVVGTFGYLAPEYFMYGKVSVKIDVYAFGVVLLELLSGRRPISSESTKGQESLVMWAKPI  549

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G A  L+D +L   +D  +  RMVLAAT CI R    RP++  ++KLL G+ E  +W
Sbjct  550   LESGDAKGLVDPNLNGNFDEVQMQRMVLAATHCITRASRLRPQMSEILKLLRGDKELEEW  609

Query  654   AR-QN-----LNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVDD  499
                QN       + D  DEV    P+SS +  ++LALL+++DDS S +S +Q  N+S+++
Sbjct  610   VNPQNKDPLDTENQDNDDEV---YPSSSAELHLSLALLDVDDDSTSFSSLEQVNNLSLEE  666

Query  498   YL  493
             Y+
Sbjct  667   YV  668



>ref|NP_001049518.1| Os03g0241600 [Oryza sativa Japonica Group]
 dbj|BAF11432.1| Os03g0241600, partial [Oryza sativa Japonica Group]
Length=253

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 118/175 (67%), Gaps = 4/175 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+ +K+DVYA GVVLLELL+G+KPI + + KGQESLV+WA  I
Sbjct  71    DVVGTFGYLAPEYFMYGKVTDKVDVYAFGVVLLELLTGRKPISDGSPKGQESLVMWASPI  130

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +G  ++LLDA L   +D  E  RM LAA+LC+RR    RPKI  V+ +L GE E +  
Sbjct  131   LDSGDISDLLDADLDVKHDDAEVKRMALAASLCLRRSARLRPKISQVLSVLRGESE-VSL  189

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITSSDQNISVDDYL  493
                     D VD+     PA+++++ + LALL++ED +S+S T       +++YL
Sbjct  190   DDLKAEPADCVDD--ETYPAANVRTHLGLALLDVEDAESISSTEHSNLSPLEEYL  242



>gb|EMT19880.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=842

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 113/164 (69%), Gaps = 10/164 (6%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G D+AGTFGYLAPEYF+HGK+++K+DVYA GVVLLEL+SG+KP+ +   KGQES+V+W
Sbjct  620   VTGDDLAGTFGYLAPEYFMHGKVSDKMDVYAFGVVLLELVSGRKPVSSGGPKGQESIVMW  679

Query  846   AKQILKNGKATELLDASLLNAYDH-DEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEP  670
             A  +++ GK TEL+D SL    D+  E +R+ LAA LCIRR P  RP +  V+KLL+G+ 
Sbjct  680   ANSVVQGGKLTELVDPSLPTDGDNAGEMERIALAAALCIRRAPHVRPSMANVLKLLDGDS  739

Query  669   ETIQWARQNLNSGDEVDEVGGEQPASS---------IQSFINLA  565
             + +QWAR  L   +  D+  G++   S         IQS+I LA
Sbjct  740   DAVQWARSQLGMPNACDDNHGDKDYDSAAALPDKNDIQSYIKLA  783



>gb|ABA95941.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
Length=738

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 133/202 (66%), Gaps = 25/202 (12%)
 Frame = -2

Query  1026  LDGVDVAGTFG---------------YLAPEYFVHGKINEKIDVYALGVVLLELLSGKKP  892
             + G DVAGTFG               YLAPEYF+HGK+++KIDVYA GVVLLEL+SG+KP
Sbjct  525   VTGDDVAGTFGFVAAAASSHLLEEFKYLAPEYFMHGKVSDKIDVYAFGVVLLELVSGRKP  584

Query  891   IDNTNAKGQESLVLWAKQILKNGKATELLDASLLN--AYDHDEFDRMVLAATLCIRREPI  718
             + +   KG+ESLV+WA  I++ GK T+L+D SL    +    E +RM LAA LCIRR P 
Sbjct  585   VSSGGGKGKESLVMWANTIIQGGKLTDLVDPSLPTDGSGVAGEVERMTLAAALCIRRSPQ  644

Query  717   FRPKIDIVVKLLEGEPETIQWARQ--NLNSGDEVDEVGGEQPASS-IQSFINLALLNLED  547
              RP I  V+KLL+G+ + ++W R    L++GD+ D+  G  P    IQS+INLALL++ D
Sbjct  645   RRPSIANVLKLLDGDGDAVRWVRSQAGLSAGDDTDDGDGASPEKKDIQSYINLALLDVVD  704

Query  546   DSLSITS-----SDQNISVDDY  496
             DS S++S     +  N+S+++Y
Sbjct  705   DSASVSSGGGDFTAANVSLEEY  726



>gb|KJB47679.1| hypothetical protein B456_008G036300 [Gossypium raimondii]
 gb|KJB47680.1| hypothetical protein B456_008G036300 [Gossypium raimondii]
Length=455

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 124/187 (66%), Gaps = 16/187 (9%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DV GTFGYLAPEYF++GK+++KIDVYA GV+LLELLSGK+PI   N KGQ+SLV+WAK 
Sbjct  262   ADVVGTFGYLAPEYFMYGKLSDKIDVYAFGVILLELLSGKRPISFENHKGQQSLVMWAKP  321

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             ++++G    +LD  L    +  +  RM++AATLCI R    RPK+  V++LL GE    +
Sbjct  322   MIESGDMKGILDPDLSGNINATQMHRMMVAATLCITRSARLRPKMSEVLELLRGEEAIEK  381

Query  657   WA----------RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--N  514
             WA            N++ GD+ DEV    P S     ++LA+L+++DDS S +S +Q  N
Sbjct  382   WAATQNENKESQEHNIDDGDD-DEV---YPNSRADLHLSLAMLDVDDDSTSFSSMEQSSN  437

Query  513   ISVDDYL  493
             IS+++YL
Sbjct  438   ISMEEYL  444



>ref|XP_006664395.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like [Oryza brachyantha]
Length=727

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 125/191 (65%), Gaps = 13/191 (7%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G DVAGTFGYLAPEYF+HGK+++KIDVYA GVVLLEL+SG+KP+ +   KGQESLV+W
Sbjct  523   VTGDDVAGTFGYLAPEYFMHGKVSDKIDVYAFGVVLLELISGRKPVSSGGPKGQESLVMW  582

Query  846   AKQILKNGKATELLDASLL----NAYD-HDEFDRMVLAATLCIRREPIFRPKIDIVVKLL  682
             A  I+  GK  +L+D +L       +D   E +RM LAATLCIRR P  RP I  V+KLL
Sbjct  583   ANSIIHGGKLADLVDPALPADGDGGFDVAGEVERMTLAATLCIRRSPQRRPSIANVMKLL  642

Query  681   EGEPETIQWARQNLNSGDEVDEVGGEQPASS-----IQSFINLALLNLEDDSLSITSSD-  520
             +G+ + ++WAR         D   G+   S      IQS+INLALL+ +D +   +  D 
Sbjct  643   DGDGDAVKWARSQAGLSFGEDADDGDGDVSPPEKKDIQSYINLALLDDDDSASVSSGGDF  702

Query  519   --QNISVDDYL  493
                N+S+++Y+
Sbjct  703   TSANMSLEEYM  713



>ref|XP_009398916.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   161 bits (408),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 124/178 (70%), Gaps = 4/178 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDV+A GVVLLELL+G++PI + N KGQESLV+WA  I
Sbjct  443   DVVGTFGYLAPEYFMYGKVSDKIDVFAFGVVLLELLTGRRPISDDNPKGQESLVMWATPI  502

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G   ELLD ++   YD  +  R+ LAA+LC  R    RP++  ++ LL+GE E   W
Sbjct  503   LERGDFMELLDPNVKETYDEVQMRRIALAASLCTTRRACLRPRMTEILSLLQGEEEIEAW  562

Query  654   ARQNLN-SGDEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDYL  493
                +++ + + +D    E  P+SS+ S I +ALL++++D  S++S DQ+   S+++YL
Sbjct  563   IGCHIDATSNRLDCQDDEAFPSSSVGSHIGMALLDVDEDDASLSSFDQSNLGSLEEYL  620



>ref|XP_010646860.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Vitis vinifera]
Length=578

 Score =   161 bits (407),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 122/183 (67%), Gaps = 12/183 (7%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVY+ GVVLLELLSG+KPI + + KGQESLV+WAK I
Sbjct  388   DVVGTFGYLAPEYFMYGKVSDKIDVYSFGVVLLELLSGRKPIGSESPKGQESLVMWAKPI  447

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G    ++D  L   +D  +  R VLAATLCI +    RPKI  ++KLL GE +  +W
Sbjct  448   LESGNLRSIMDPDLDGKFDEVQMQRTVLAATLCITQAARRRPKISQILKLLRGEKDVAKW  507

Query  654   ARQNL-------NSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVD  502
                 +       N  +  DEV    P SS +S + LALL+++D+  S +S +Q   +S++
Sbjct  508   VNSQIEDQHDLENQDENDDEV---YPDSSAESHLGLALLDVDDNFTSFSSMEQGNRLSLE  564

Query  501   DYL  493
             +Y+
Sbjct  565   EYM  567



>ref|XP_002534152.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF28235.1| ATP binding protein, putative [Ricinus communis]
Length=622

 Score =   161 bits (407),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 121/178 (68%), Gaps = 4/178 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVYA GVV+LELLSG+KPI      GQESLV+WAK I
Sbjct  434   DVVGTFGYLAPEYFMYGKLSDKIDVYAFGVVILELLSGRKPIVYETPNGQESLVMWAKPI  493

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             +++G A  +LD SL   +D  +  RMVLAA LCI R    RPKI  V+KLL G+ +   W
Sbjct  494   IESGNARGILDPSLDENFDEAQMRRMVLAANLCITRAARLRPKISEVLKLLRGDKDAATW  553

Query  654   AR-QNLNSGDEVDEVGGE-QPASSIQSFINLALLNLEDDSLSITSSDQN--ISVDDYL  493
                +N +  D   ++  E  P SS +  +NLALL+++DDS S +S +Q   + +++YL
Sbjct  554   VTLRNKDLDDPEKDLDDEVYPNSSPELHLNLALLDVDDDSTSFSSLEQGNILYMEEYL  611



>emb|CBI37873.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   161 bits (407),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 122/183 (67%), Gaps = 12/183 (7%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVY+ GVVLLELLSG+KPI + + KGQESLV+WAK I
Sbjct  468   DVVGTFGYLAPEYFMYGKVSDKIDVYSFGVVLLELLSGRKPIGSESPKGQESLVMWAKPI  527

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G    ++D  L   +D  +  R VLAATLCI +    RPKI  ++KLL GE +  +W
Sbjct  528   LESGNLRSIMDPDLDGKFDEVQMQRTVLAATLCITQAARRRPKISQILKLLRGEKDVAKW  587

Query  654   ARQNL-------NSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVD  502
                 +       N  +  DEV    P SS +S + LALL+++D+  S +S +Q   +S++
Sbjct  588   VNSQIEDQHDLENQDENDDEV---YPDSSAESHLGLALLDVDDNFTSFSSMEQGNRLSLE  644

Query  501   DYL  493
             +Y+
Sbjct  645   EYM  647



>ref|XP_004505816.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like 
isoform X1 [Cicer arietinum]
 ref|XP_004505817.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like 
isoform X2 [Cicer arietinum]
 ref|XP_004505818.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like 
isoform X3 [Cicer arietinum]
Length=657

 Score =   161 bits (407),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+ GTFGYLAPEYF++GK++EKIDVYA GVVLLEL+SG++PI +   KGQESLV+WAK I
Sbjct  477   DLVGTFGYLAPEYFMYGKVSEKIDVYAFGVVLLELISGREPISSEPCKGQESLVVWAKPI  536

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++NG   +LLD  L   +D  +  RMVLAA+LCI R    RPK+  ++K+L+G+ E    
Sbjct  537   IENGDIKDLLDPKLEGNFDETQMQRMVLAASLCITRAARLRPKLKQILKILKGDNEVEYC  596

Query  654   ARQNLNSGDEV-DEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNIS  508
               ++ ++ + + DEV    P SS +  ++LALL ++DD+ S +S+D + S
Sbjct  597   FNEHSDNEENIDDEV---YPNSSAELHLSLALLGVDDDTTSCSSTDHSYS  643



>ref|XP_010646843.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X1 [Vitis vinifera]
 ref|XP_010646849.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X1 [Vitis vinifera]
 ref|XP_010646856.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X1 [Vitis vinifera]
 ref|XP_010646857.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X1 [Vitis vinifera]
Length=681

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 122/183 (67%), Gaps = 12/183 (7%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVY+ GVVLLELLSG+KPI + + KGQESLV+WAK I
Sbjct  491   DVVGTFGYLAPEYFMYGKVSDKIDVYSFGVVLLELLSGRKPIGSESPKGQESLVMWAKPI  550

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G    ++D  L   +D  +  R VLAATLCI +    RPKI  ++KLL GE +  +W
Sbjct  551   LESGNLRSIMDPDLDGKFDEVQMQRTVLAATLCITQAARRRPKISQILKLLRGEKDVAKW  610

Query  654   ARQNL-------NSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVD  502
                 +       N  +  DEV    P SS +S + LALL+++D+  S +S +Q   +S++
Sbjct  611   VNSQIEDQHDLENQDENDDEV---YPDSSAESHLGLALLDVDDNFTSFSSMEQGNRLSLE  667

Query  501   DYL  493
             +Y+
Sbjct  668   EYM  670



>ref|XP_004505819.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like 
isoform X4 [Cicer arietinum]
Length=642

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             D+ GTFGYLAPEYF++GK++EKIDVYA GVVLLEL+SG++PI +   KGQESLV+WAK I
Sbjct  462   DLVGTFGYLAPEYFMYGKVSEKIDVYAFGVVLLELISGREPISSEPCKGQESLVVWAKPI  521

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++NG   +LLD  L   +D  +  RMVLAA+LCI R    RPK+  ++K+L+G+ E    
Sbjct  522   IENGDIKDLLDPKLEGNFDETQMQRMVLAASLCITRAARLRPKLKQILKILKGDNEVEYC  581

Query  654   ARQNLNSGDEV-DEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNIS  508
               ++ ++ + + DEV    P SS +  ++LALL ++DD+ S +S+D + S
Sbjct  582   FNEHSDNEENIDDEV---YPNSSAELHLSLALLGVDDDTTSCSSTDHSYS  628



>emb|CAN73629.1| hypothetical protein VITISV_026641 [Vitis vinifera]
Length=693

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 122/183 (67%), Gaps = 12/183 (7%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++KIDVY+ GVVLLELLSG+KPI + + KGQESLV+WAK I
Sbjct  503   DVVGTFGYLAPEYFMYGKVSDKIDVYSFGVVLLELLSGRKPIGSESPKGQESLVMWAKPI  562

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L++G    ++D  L   +D  +  R VLAATLCI +    RPKI  ++KLL GE +  +W
Sbjct  563   LESGNLRSIMDPDLDGKFDEVQMQRXVLAATLCITQAARRRPKISQILKLLRGEKDVAKW  622

Query  654   ARQNL-------NSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVD  502
                 +       N  +  DEV    P SS +S + LALL+++D+  S +S +Q   +S++
Sbjct  623   VNSQIEDQHDLENQDENDDEV---YPDSSAESHLGLALLDVDDNFTSFSSMEQGNRLSLE  679

Query  501   DYL  493
             +Y+
Sbjct  680   EYM  682



>ref|XP_008665759.1| PREDICTED: uncharacterized protein LOC100191422 isoform X1 [Zea 
mays]
Length=884

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             L   D+ GTFGY+APEYF HG +NEKIDVYA GVVLLE++SG++PI   + KGQESLV W
Sbjct  690   LTCTDITGTFGYMAPEYFSHGTVNEKIDVYAFGVVLLEIISGRRPITPGSTKGQESLVGW  749

Query  846   AKQILKNGKATELLDASL-LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEP  670
             AK +L  G   EL+D  L  N YD DE +RM LAA+LC R     RP++ +V++LL+G+ 
Sbjct  750   AKPLLCGGGIRELVDPLLGRNEYDCDEMERMTLAASLCTRTSSRSRPEMSLVLRLLQGDD  809

Query  669   ETIQWARQNLNSG-DEVD-EVGGEQPASSIQSFINLALLNLE---DDSLSITSSDQNISV  505
             E I WAR  + +  D  D E     P  ++QS +NLALL +E   DD+LS + S  + +V
Sbjct  810   EAIGWARAQVTASFDGSDEEAAAAAPDLNMQSHLNLALLGVEVEDDDTLSQSQSQCSSTV  869

Query  504   D  502
             D
Sbjct  870   D  870



>gb|KHG24701.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Gossypium arboreum]
Length=521

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 123/187 (66%), Gaps = 16/187 (9%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DV GTFGYLAPEYF++GK+++KIDVYA GV+LLELLSGK+PI   N KGQ+SLV+WAK 
Sbjct  328   ADVVGTFGYLAPEYFMYGKLSDKIDVYAFGVILLELLSGKRPISFENHKGQQSLVMWAKP  387

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             ++++G    +LD  L    +  +  RM++AATLCI R    RP +  V++LL GE    +
Sbjct  388   MIESGDMKGILDPDLNGNINATQMHRMMIAATLCITRSARLRPNMSEVLELLRGEEAIEK  447

Query  657   WA----------RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--N  514
             WA            N++ GD+ DEV    P S     ++LA+L+++DDS S +S +Q  N
Sbjct  448   WAATQNENKESQEHNIDDGDD-DEV---YPNSRADLHLSLAMLDVDDDSTSFSSMEQSSN  503

Query  513   ISVDDYL  493
             IS+++YL
Sbjct  504   ISMEEYL  510



>ref|XP_008813513.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
Length=667

 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 120/180 (67%), Gaps = 10/180 (6%)
 Frame = -2

Query  1011  VAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQIL  832
             V GTFGYLAPEYF++GK++EKIDVYA GVVLLELLSG+KPI + N +GQESLV+WA  IL
Sbjct  480   VVGTFGYLAPEYFMYGKVSEKIDVYAFGVVLLELLSGRKPISDDNPEGQESLVMWATPIL  539

Query  831   KNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQWA  652
             + G    LLD +L   +D  +  RMVLAA+LCI R    RP++  +  LL+G  +   W 
Sbjct  540   ERGDVMNLLDPNLDLKHDEVQMRRMVLAASLCITRAARLRPQMSQIQSLLQGVEDMEAWM  599

Query  651   R-----QNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDYL  493
                     LN  D  DE     PASSI S + LALL++EDD+ S+TS +Q+   S+++YL
Sbjct  600   NCLTDTATLNELDCQDE--ETYPASSIGSHLGLALLDVEDDA-SVTSFEQSQLGSLEEYL  656



>ref|XP_010496668.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Camelina sativa]
Length=634

 Score =   159 bits (401),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+ PI + + +GQESLV+WAK +
Sbjct  454   DVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTPISSDSPRGQESLVMWAKPM  513

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ G A ELLD ++   +D D+F +MVLAAT C+ R    RP I  ++KLL GE E  +W
Sbjct  514   IEKGNAKELLDPNISGTFDEDQFHKMVLAATHCLTRAATHRPNIREILKLLRGEDEVAKW  573

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITS  526
              +  +   DE        P S+ +  ++LA++++ED DS+SI+S
Sbjct  574   VK--IVEEDEDCFDDEVYPNSNTELHLSLAMVDVEDNDSVSISS  615



>ref|XP_010496669.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Camelina sativa]
Length=617

 Score =   159 bits (401),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+ PI + + +GQESLV+WAK +
Sbjct  437   DVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTPISSDSPRGQESLVMWAKPM  496

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ G A ELLD ++   +D D+F +MVLAAT C+ R    RP I  ++KLL GE E  +W
Sbjct  497   IEKGNAKELLDPNISGTFDEDQFHKMVLAATHCLTRAATHRPNIREILKLLRGEDEVAKW  556

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITS  526
              +  +   DE        P S+ +  ++LA++++ED DS+SI+S
Sbjct  557   VK--IVEEDEDCFDDEVYPNSNTELHLSLAMVDVEDNDSVSISS  598



>ref|XP_006283621.1| hypothetical protein CARUB_v10004678mg [Capsella rubella]
 gb|EOA16519.1| hypothetical protein CARUB_v10004678mg [Capsella rubella]
Length=489

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 114/169 (67%), Gaps = 5/169 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+ PI   N +GQESLV+WAK +
Sbjct  308   DVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRNPISPQNPRGQESLVMWAKPL  367

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++NG    LLD  + N Y+  +F RMVLAA+ C+ R    RP I  +++LL  E E  +W
Sbjct  368   IENGNLKRLLDPEVTNTYEESQFQRMVLAASHCLTRSATHRPNIRQILRLLRDENEVGKW  427

Query  654   ARQNLNSGDEV-DEVGGEQPASSIQSFINLALLNLEDD-SLSITSSDQN  514
               +     D   DEV    P SS +  +++A+L +EDD S S++S +++
Sbjct  428   IMEEEEKEDCFDDEV---YPNSSAELHLSVAMLEVEDDESASVSSMERS  473



>ref|XP_010489258.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X2 [Camelina sativa]
Length=618

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+ PI + + +GQESLV+WAK +
Sbjct  438   DVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTPISSDSPRGQESLVMWAKPM  497

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             +  G A ELLD ++   +D D+F +MVLAAT C+ R    RP I  ++KLL GE +  +W
Sbjct  498   IDKGNAKELLDPNISGTFDEDQFHKMVLAATHCLTRAATHRPNIREILKLLRGEDDVAKW  557

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITS  526
              +  +   DE        P SS +  ++LA++++ED DS+SI+S
Sbjct  558   VK--IVEEDEDCFDDEVYPNSSTELHLSLAMVDVEDNDSVSISS  599



>ref|XP_002884015.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60274.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=635

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+ PI + + +GQES+V+WAK +
Sbjct  455   DVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTPISSDSPRGQESVVMWAKPM  514

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ G A ELLD ++   +D D+F +MVLAAT C+ R   +RP I  ++KLL GE +  +W
Sbjct  515   IEKGNAKELLDPNISGTFDEDQFHKMVLAATHCLTRAATYRPNIREILKLLRGEDDVSKW  574

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITS  526
              +  +   DE        P S+ +  ++LA++++ED DS+SI+S
Sbjct  575   VK--IVEEDEDCFDDEVYPNSNTELHLSLAMIDVEDNDSVSISS  616



>ref|XP_010489257.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Camelina sativa]
Length=635

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+ PI + + +GQESLV+WAK +
Sbjct  455   DVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTPISSDSPRGQESLVMWAKPM  514

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             +  G A ELLD ++   +D D+F +MVLAAT C+ R    RP I  ++KLL GE +  +W
Sbjct  515   IDKGNAKELLDPNISGTFDEDQFHKMVLAATHCLTRAATHRPNIREILKLLRGEDDVAKW  574

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITS  526
              +  +   DE        P SS +  ++LA++++ED DS+SI+S
Sbjct  575   VK--IVEEDEDCFDDEVYPNSSTELHLSLAMVDVEDNDSVSISS  616



>ref|XP_008800175.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Phoenix 
dactylifera]
Length=669

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 120/169 (71%), Gaps = 3/169 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GKI+EKIDVYA GVVLLELLSG+KPI++ N KGQESLV+WA  I
Sbjct  482   DVVGTFGYLAPEYFMYGKISEKIDVYAFGVVLLELLSGRKPINDGNPKGQESLVMWATPI  541

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G    L+D +L    D  +   ++LAA+LCIRR    RP++  ++ LL+G  +   W
Sbjct  542   LERGDVMNLVDPNLDAKLDEVQMRTIILAASLCIRRAASLRPRMSQILNLLQGVEDIEAW  601

Query  654   ARQNLNSG-DEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQN  514
                ++++  +E+D    E  PASSI++ + LALL++ED++ S+ S +Q+
Sbjct  602   MNCHIDTTLNELDCQDEETYPASSIETHLGLALLDVEDNA-SVASFEQS  649



>gb|KHG28516.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Gossypium arboreum]
Length=682

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 121/181 (67%), Gaps = 9/181 (5%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DV GTFGYLAPEYF++GK+++KIDVYA GVVLLELLSGK+PI   N KGQ+SLV+WAK 
Sbjct  494   ADVVGTFGYLAPEYFMYGKLSDKIDVYAFGVVLLELLSGKRPISFENLKGQQSLVMWAKP  553

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             I+++G    +LD +L    +  +  RMV AATLCI R    RPK+  +++LL GE E  +
Sbjct  554   IIESGDVKGILDPNLNGNINETQMHRMVRAATLCITRSGRLRPKMRQILELLRGEKEVEK  613

Query  657   WAR---QNLNSGDEV-DEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQ--NISVDDY  496
             W     + + S ++  DEV    P S  +  +++A+L+++DD  S +S +Q  N S D+Y
Sbjct  614   WGETPNEEMESQEQHDDEV---YPNSRPELHLSVAMLDVDDDCTSFSSMEQSSNFSTDEY  670

Query  495   L  493
             L
Sbjct  671   L  671



>ref|XP_010447006.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
 ref|XP_010447008.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
 ref|XP_010447009.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
Length=446

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 116/170 (68%), Gaps = 7/170 (4%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+ PI   N +GQESLV+WAK 
Sbjct  264   TDVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRNPISPQNPRGQESLVMWAKP  323

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             +++NG    LLD  + + +D  +F RMVLAA+ C+ R    RP I  +++LL  E E  +
Sbjct  324   LIENGNLKGLLDPEVTDIFDESQFQRMVLAASHCLTRSATHRPNIKQILRLLRDENEVGK  383

Query  657   WARQNLNSGDEVDEVGGEQ--PASSIQSFINLALLNLEDD-SLSITSSDQ  517
             W  +     DE+++   ++  P SS++   ++A+L +EDD S SI+S ++
Sbjct  384   WIMEE----DEIEDCFDDEVYPDSSVELHFSVAMLEVEDDESASISSMER  429



>ref|XP_010920120.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X2 [Elaeis guineensis]
Length=647

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 5/178 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK++EKIDVYA GVVLLELLSG+KPI + N +GQ+SLV+WA  I
Sbjct  460   DVVGTFGYLAPEYFMYGKVSEKIDVYAFGVVLLELLSGRKPISDDNPEGQQSLVMWAIPI  519

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G    L D +L   +D  +  RMVLAA+LCI R    RP++  ++ LL+G  +   W
Sbjct  520   LERGDVMNLSDPNLDMKHDVVQMRRMVLAASLCITRAARLRPQMSQILSLLQGVEDMEAW  579

Query  654   ARQNLNSG-DEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDYL  493
                + ++  +E+D    E  PASSI S + LALL++EDD+ S+ S +QN   S+++YL
Sbjct  580   MNCHADTTHNELDCQDEETYPASSIGSHLGLALLDVEDDA-SVASFEQNQLGSLEEYL  636



>emb|CDP14559.1| unnamed protein product [Coffea canephora]
Length=686

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 123/183 (67%), Gaps = 11/183 (6%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DV GTFGYLAPEYF++GK++EK+DVY+ GVVLLELLSG+KPI    +KG+ESLV+WAK 
Sbjct  496   CDVVGTFGYLAPEYFMYGKVSEKVDVYSFGVVLLELLSGRKPIGFDTSKGRESLVIWAKP  555

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPE---  667
              L++G    +LD +L + +D  E  RM LAA LC+ +    RPK+  ++K+L GE     
Sbjct  556   KLESGDVKGILDQNLDDNFDESEMHRMALAAKLCLTQAARVRPKMSQILKILTGEEHLGE  615

Query  666   --TIQWARQNLNSGD-EVDEVGGEQPASSIQSFINLALLNLEDDSLSITSSDQN--ISVD  502
               + +      N GD + DEV    P SS +S ++LALL++ D+S S +S DQ+  +SV+
Sbjct  616   EISTELGANPENQGDYDDDEV---YPDSSAESHLSLALLDVCDNSTSFSSQDQSSPLSVE  672

Query  501   DYL  493
             DYL
Sbjct  673   DYL  675



>ref|XP_010920119.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X1 [Elaeis guineensis]
Length=669

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 5/178 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK++EKIDVYA GVVLLELLSG+KPI + N +GQ+SLV+WA  I
Sbjct  482   DVVGTFGYLAPEYFMYGKVSEKIDVYAFGVVLLELLSGRKPISDDNPEGQQSLVMWAIPI  541

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L+ G    L D +L   +D  +  RMVLAA+LCI R    RP++  ++ LL+G  +   W
Sbjct  542   LERGDVMNLSDPNLDMKHDVVQMRRMVLAASLCITRAARLRPQMSQILSLLQGVEDMEAW  601

Query  654   ARQNLNSG-DEVDEVGGEQ-PASSIQSFINLALLNLEDDSLSITSSDQNI--SVDDYL  493
                + ++  +E+D    E  PASSI S + LALL++EDD+ S+ S +QN   S+++YL
Sbjct  602   MNCHADTTHNELDCQDEETYPASSIGSHLGLALLDVEDDA-SVASFEQNQLGSLEEYL  658



>gb|EAY89207.1| hypothetical protein OsI_10703 [Oryza sativa Indica Group]
Length=652

 Score =   157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 118/175 (67%), Gaps = 4/175 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+ +K+DVYA GVVLLELL+G+KPI + + KGQESLV+WA  I
Sbjct  470   DVVGTFGYLAPEYFMYGKVTDKVDVYAFGVVLLELLTGRKPISDGSPKGQESLVMWASPI  529

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +G  ++LLDA L   +D  E  RM LAA+LC+RR    RPKI  V+ +L GE E +  
Sbjct  530   LDSGDISDLLDADLDVKHDDAEVKRMALAASLCLRRSARLRPKISQVLSVLRGESE-VSL  588

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITSSDQNISVDDYL  493
                     D VD+     PA+++++ + LALL++ED +S+S T       +++YL
Sbjct  589   DDLKAEPADCVDD--ETYPAANVRTHLGLALLDVEDAESISSTEHSNLSPLEEYL  641



>gb|KCW72536.1| hypothetical protein EUGRSUZ_E01004 [Eucalyptus grandis]
Length=710

 Score =   157 bits (397),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DVAGTFGYLAPEYF++GK+N+K+DVYA GVVLLELLSG+KPI N   KG+ESLV+WA+ 
Sbjct  582   TDVAGTFGYLAPEYFMYGKVNDKVDVYAFGVVLLELLSGRKPISNDFPKGRESLVMWARP  641

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIV  694
             IL  GK +ELLD +L   YDH + +RMVLAATLC+RR P  RP++  V
Sbjct  642   ILHGGKISELLDPTLGENYDHQQLERMVLAATLCVRRAPRARPQMSHV  689



>gb|ABF94898.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ26226.1| hypothetical protein OsJ_10094 [Oryza sativa Japonica Group]
Length=652

 Score =   157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 118/175 (67%), Gaps = 4/175 (2%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+ +K+DVYA GVVLLELL+G+KPI + + KGQESLV+WA  I
Sbjct  470   DVVGTFGYLAPEYFMYGKVTDKVDVYAFGVVLLELLTGRKPISDGSPKGQESLVMWASPI  529

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             L +G  ++LLDA L   +D  E  RM LAA+LC+RR    RPKI  V+ +L GE E +  
Sbjct  530   LDSGDISDLLDADLDVKHDDAEVKRMALAASLCLRRSARLRPKISQVLSVLRGESE-VSL  588

Query  654   ARQNLNSGDEVDEVGGEQPASSIQSFINLALLNLED-DSLSITSSDQNISVDDYL  493
                     D VD+     PA+++++ + LALL++ED +S+S T       +++YL
Sbjct  589   DDLKAEPADCVDD--ETYPAANVRTHLGLALLDVEDAESISSTEHSNLSPLEEYL  641



>ref|XP_010437535.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
 ref|XP_010437536.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
 ref|XP_010437537.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
 ref|XP_010437538.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
 ref|XP_010437539.1| PREDICTED: pto-interacting protein 1-like [Camelina sativa]
Length=448

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 117/171 (68%), Gaps = 7/171 (4%)
 Frame = -2

Query  1017  VDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQ  838
              DV GTFGYLAPEYF++GK+++K+DVYALGVVLLEL+SG+ PI   N +GQESL++WAK 
Sbjct  264   TDVVGTFGYLAPEYFMYGKVSDKVDVYALGVVLLELISGRNPISPQNPRGQESLIMWAKP  323

Query  837   ILKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQ  658
             +++NG    LLD  + + YD  +F RMVLAA+ C+ R    RP I  +++LL  E E  +
Sbjct  324   LIENGNLKGLLDPEVTDIYDESQFQRMVLAASHCLTRSATHRPNIKQILRLLRDENEVGK  383

Query  657   WARQNLNSGDEVDEVGGEQ--PASSIQSFINLALLNLEDD-SLSITSSDQN  514
             W  +     +E+++   ++  P SS +   ++A+L +EDD S S++S +++
Sbjct  384   WIMEE----EEIEDCFDDEVYPDSSAELHFSVAMLEVEDDESASVSSMERS  430



>ref|XP_008663832.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-2 [Zea mays]
Length=715

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 120/197 (61%), Gaps = 24/197 (12%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G DVAGTFGYLAPEYF+HGK++EK+DVYA GVVLLEL+SG+KP+     +G+ SLV+W
Sbjct  512   VTGDDVAGTFGYLAPEYFMHGKVSEKMDVYAFGVVLLELVSGRKPVSAGGPRGKGSLVMW  571

Query  846   AKQILKNGKATELLDASL---LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEG  676
             A  +++ GK  +L+D +L       D  E +RM LAA LCIRR    RP +  VVKLL G
Sbjct  572   ANSVIQGGKVMDLVDPNLPLPATGGDGGEVERMALAAALCIRRAHQHRPTMSNVVKLLAG  631

Query  675   EPETIQWA---------------RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDS  541
             + + + WA               R    +    +E GG+     IQS+INLAL ++ DD 
Sbjct  632   DGDAVAWAKSQVGVPGDNDIDGRRHGCGAATSPEEKGGD-----IQSYINLALRDIVDDD  686

Query  540   LSITSS-DQNISVDDYL  493
              +  SS    +S+++YL
Sbjct  687   DNDASSVGSAVSLEEYL  703



>emb|CDY71941.1| BnaAnng39330D, partial [Brassica napus]
Length=335

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 115/165 (70%), Gaps = 5/165 (3%)
 Frame = -2

Query  1014  DVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLWAKQI  835
             DV GTFGYLAPEYF++GK+++K+DVYA GVVLLEL+SG+  I + + +GQESLV+WAK +
Sbjct  155   DVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTTISSDSPRGQESLVMWAKPV  214

Query  834   LKNGKATELLDASLLNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEGEPETIQW  655
             ++ G A ELLD ++   +D  +F +MVLAA  C+ R    RP I  ++KLL+GE E  +W
Sbjct  215   IEKGAAKELLDPNISWTFDEAQFQKMVLAAKHCLTRAATHRPNIREILKLLKGEDEVEKW  274

Query  654   ARQNLNSGDEV-DEVGGEQPASSIQSFINLALLNLED-DSLSITS  526
              ++     D   DEV    P S+ +  ++LA+L++ED DS+S+ S
Sbjct  275   VKKVGEDNDCFDDEV---YPNSNKELHLSLAMLDIEDNDSVSVGS  316



>gb|AFW56237.1| putative protein kinase superfamily protein [Zea mays]
Length=723

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 120/197 (61%), Gaps = 24/197 (12%)
 Frame = -2

Query  1026  LDGVDVAGTFGYLAPEYFVHGKINEKIDVYALGVVLLELLSGKKPIDNTNAKGQESLVLW  847
             + G DVAGTFGYLAPEYF+HGK++EK+DVYA GVVLLEL+SG+KP+     +G+ SLV+W
Sbjct  520   VTGDDVAGTFGYLAPEYFMHGKVSEKMDVYAFGVVLLELVSGRKPVSAGGPRGKGSLVMW  579

Query  846   AKQILKNGKATELLDASL---LNAYDHDEFDRMVLAATLCIRREPIFRPKIDIVVKLLEG  676
             A  +++ GK  +L+D +L       D  E +RM LAA LCIRR    RP +  VVKLL G
Sbjct  580   ANSVIQGGKVMDLVDPNLPLPATGGDGGEVERMALAAALCIRRAHQHRPTMSNVVKLLAG  639

Query  675   EPETIQWA---------------RQNLNSGDEVDEVGGEQPASSIQSFINLALLNLEDDS  541
             + + + WA               R    +    +E GG+     IQS+INLAL ++ DD 
Sbjct  640   DGDAVAWAKSQVGVPGDNDIDGRRHGCGAATSPEEKGGD-----IQSYINLALRDIVDDD  694

Query  540   LSITSS-DQNISVDDYL  493
              +  SS    +S+++YL
Sbjct  695   DNDASSVGSAVSLEEYL  711



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2611380075072